HHsearch alignment for GI: 254780536 and conserved domain: KOG1202

>KOG1202 consensus.
Probab=100.00  E-value=5.5e-44  Score=286.12  Aligned_cols=295  Identities=23%  Similarity=0.281  Sum_probs=245.5

Q ss_pred             EEEECCCCCCCCCCHHHHHHHHCHHHHHHHHHHHHHC---CCCHHHHHCCCCHHHHHCHHHHHHHHHHHHHHHHHHHHHC
Q ss_conf             9998087333731158999985999999999999883---9897898538986783046765034566665478999971
Q gi|254780536|r    3 TVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTL---NQNLSDLMWNGSQEELTATCNAQPALTAVSMAFIRVMEKN   79 (314)
Q Consensus         3 ~~f~FpGQGsq~~gM~~~L~~~~p~~r~~~~~~~~~l---~~~l~~~~~~~~~~~l~~~~~~Qp~i~~~~~a~~~~l~~~   79 (314)
T Consensus       501 iwfiysGMGsQW~~Ma~~LMk-l~~F~dsi~~~ae~l~~~gldv~~vL~~s~~~tfdn~l~sfvsitAiQiaLtDlLs~l  579 (2376)
T KOG1202         501 IWFIYSGMGSQWAGMAKDLMK-LERFRDSIQRSAEVLKPFGLDVIDVLTRSDESTFDNILNSFVSITAIQIALTDLLSCL  579 (2376)
T ss_pred             EEEEEECCCCHHHHHHHHHHH-HHHHHHHHHHHHHHHCCCCCCHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHC
T ss_conf             699971775322677888760-3888999998886533227506554107986788899999999999999999999861


Q ss_pred             CCCCCCCCCCCCCCCCCCHHHHHHCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCCE
Q ss_conf             88764354424665442012225317865023333345688653100111122222123503553112234421135420
Q gi|254780536|r   80 GLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICE  159 (314)
Q Consensus        80 gi~~~~~p~~v~GhSlGE~aAl~~aG~ls~eda~~lv~~R~~~m~~~~~~~~g~M~aV~~~~~~~~~~~~~~~~~~~~~~  159 (314)
T Consensus       580 gi----~PDGIvGHS~GElgc~YaDGclt~EqtvlaAYwRG~sild~-~l~kGaMAAV-GLsWEq~~~r~-----P~~~~  648 (2376)
T KOG1202         580 GI----RPDGIVGHSLGELGCGYADGCLTQEQTVLAAYWRGQSILDT-HLPKGAMAAV-GLSWEQCKSRC-----PPDVV  648 (2376)
T ss_pred             CC----CCCCCCCCCCCHHCCCCCCCCCCHHHHHHHHHHCCCEECCC-CCCCCCHHHH-CCCHHHHHCCC-----CCCCC
T ss_conf             88----88752234532002100266668899999999757620003-4777413342-47799974419-----98432


Q ss_pred             ECCCCCCCEEEECCCCCHHHHHHHHHHHHHHHHCCCCCCC-CCCCCHHCCHHHHHHHHHHHHHHHC--CCCCCCCCCCC-
Q ss_conf             0122322213530331128999888888653100355554-3234201020378888742223202--87765420457-
Q gi|254780536|r  160 IANDNGGGQVVISGLQDAVKCAADTCLNKGAKRAVFLPVS-APFHSSLMTPVSKVMKWMLDSVTKQ--DPVVPILPNFC-  235 (314)
Q Consensus       160 ia~~Ns~~q~visG~~~~l~~~~~~~~~~~~~~~~~L~v~-~afHs~lm~~~~~~~~~~l~~i~~~--~p~ipi~S~~~-  235 (314)
T Consensus       649 paCHNs~D~~TiSGp~a~v~~~v~qL~~egvF-ak~V~t~G~aFHS~~m~a~~p~l~~~l~k~i~epK~rsarWlSTSip  727 (2376)
T KOG1202         649 PACHNSKDNVTISGPQASVFAFVEQLRAEGVF-AKEVRTGGYAFHSPYMEAAAPPLRQSLEKVIPEPKPRSARWLSTSIP  727 (2376)
T ss_pred             CCCCCCCCCEEECCCHHHHHHHHHHHHHCCEE-EEEECCCCCCCCCHHHHHHCHHHHHHHHHHCCCCCCCCCCHHHCCCC
T ss_conf             31037887337638727899999986445706-66743787312678887327699999998568998754332114687


Q ss_pred             -CCCCCCCH--HHHHHHHHHCCCCCCHHHHHHHHHHCCCCEEEEECCCHHHHHHHHHHC-CCCCEEECCC---HHHHHHH
Q ss_conf             -87100100--233222220448501999999999779989999389879999999873-8981552399---8999999
Q gi|254780536|r  236 -ASPVSSID--EISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRID-KSLSAVSISK---VEDIDLA  308 (314)
Q Consensus       236 -g~~~~~~~--~~~~~l~~ql~~pV~f~~~i~~l~~~g~~~fiEiGP~~~Lt~l~~~~~-~~~~~~~~~~---~~~~~~~  308 (314)
T Consensus       728 Ea~W~s~la~tsSA~Y~vnNl~SPVLF~eAlq~vP~nA--v~vEiAPH~LlqAiLkRsL~p~~t~v~Lmkr~h~~NlEff  805 (2376)
T KOG1202         728 EAQWHSSLARTSSAEYHVNNLVSPVLFHEALQHVPENA--VVVEIAPHGLLQAILKRSLKPSCTNVSLMKRGHRNNLEFF  805 (2376)
T ss_pred             HHHHCCHHHHHCCHHHHHHCCCCHHHHHHHHHHCCCCC--EEEEECCHHHHHHHHHHHCCCCCCEEHHHCCCCHHHHHHH
T ss_conf             56504756543024666633333788999997576540--6998562689999998523886435223217620039999


Q ss_pred             HHHH
Q ss_conf             9874
Q gi|254780536|r  309 LRSI  312 (314)
Q Consensus       309 l~~~  312 (314)
T Consensus       806 L~~l  809 (2376)
T KOG1202         806 LAGL  809 (2376)
T ss_pred             HHHH
T ss_conf             9877