HHsearch alignment for GI: 254780536 and conserved domain: TIGR00128

>TIGR00128 fabD malonyl CoA-acyl carrier protein transacylase; InterPro: IPR004410 Malonyl CoA-acyl carrier protein transacylase 2.3.1.39 from EC is involved in fatty acid biosynthesis and transfers the malonyl moeity from coenzyme A to acyl-carrier protein.; GO: 0004314 [acyl-carrier-protein] S-malonyltransferase activity, 0006633 fatty acid biosynthetic process.
Probab=100.00  E-value=0  Score=603.44  Aligned_cols=292  Identities=43%  Similarity=0.668  Sum_probs=282.2

Q ss_pred             CEEEEECCCCCCCCCCHHHHHHHHCHHHHHHHHHHHHHCCCCHHHHHCCCCHHHHHCHHHHHHHHHHHHHHHHHHHHHCC
Q ss_conf             91999808733373115899998599999999999988398978985389867830467650345666654789999718
Q gi|254780536|r    1 MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPALTAVSMAFIRVMEKNG   80 (314)
Q Consensus         1 mk~~f~FpGQGsq~~gM~~~L~~~~p~~r~~~~~~~~~l~~~l~~~~~~~~~~~l~~~~~~Qp~i~~~~~a~~~~l~~~g   80 (314)
T Consensus         1 ~~~A~vFPGQGSQ~~GMG~~L~~~~p~akelf~~A~~~Lg~~~~~l~~e~~~~~L~~T~~TQPALy~~s~~~y~~~~~~~   80 (295)
T TIGR00128         1 MKIAFVFPGQGSQTVGMGKDLYESYPIAKELFDQADEILGYDLKKLCQEGDAEELNKTQYTQPALYVVSAILYRKLKEKG   80 (295)
T ss_pred             CCEEEECCCCCCCCCCCCHHHHHCCHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHCHHHHHHHHHHHHHHHHHC
T ss_conf             92477517855553201033674064899999999887547799884268366675154013399999999999986415


Q ss_pred             CCCCCCCCCCCCCCCCCHHHHHHCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHHHHC-CCCCE
Q ss_conf             87643544246654420122253178650233333456886531001111222221235035531122344211-35420
Q gi|254780536|r   81 LCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASR-VGICE  159 (314)
Q Consensus        81 i~~~~~p~~v~GhSlGE~aAl~~aG~ls~eda~~lv~~R~~~m~~~~~~~~g~M~aV~~~~~~~~~~~~~~~~~-~~~~~  159 (314)
T Consensus        81 ~-G~~~P~f~AGHSLGEYsAL~aAGalDF~~al~LV~~RGe~M~~a~p~g~G~MaAv~Gld~e~l~~~~~~~~~eG~~V~  159 (295)
T TIGR00128        81 N-GGLKPDFVAGHSLGEYSALVAAGALDFETALKLVKKRGELMQEAVPEGGGAMAAVLGLDEEQLAQALEEATEEGEVVD  159 (295)
T ss_pred             C-CCCCCCEEECCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCEEEEECCCHHHHHHHHHHHHHCCCEEE
T ss_conf             8-984653462463478999998535148889999998899888515788874167654788899999987754796678


Q ss_pred             ECCCCCCCEEEECCCCCHHHHHHHHHH-HHHHHHCCCCCCCCCCCCHHCCHHHHHHHHHHHHHHHCCCCCCCCCCCCCCC
Q ss_conf             012232221353033112899988888-8653100355554323420102037888874222320287765420457871
Q gi|254780536|r  160 IANDNGGGQVVISGLQDAVKCAADTCL-NKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASP  238 (314)
Q Consensus       160 ia~~Ns~~q~visG~~~~l~~~~~~~~-~~~~~~~~~L~v~~afHs~lm~~~~~~~~~~l~~i~~~~p~ipi~S~~~g~~  238 (314)
T Consensus       160 ~AN~N~P~QvVIsG~k~~vE~a~~~~k~~~gakr~~PL~VSgafHs~~M~~a~~~f~~~L~~~~~~~~~~pViSNV~~~~  239 (295)
T TIGR00128       160 LANFNSPGQVVISGTKDEVEAAAALLKTEAGAKRALPLEVSGAFHSRLMKPAAEKFAETLEACQFNDATVPVISNVDAKP  239 (295)
T ss_pred             EEECCCCCCEEEECCHHHHHHHHHHHHHHCCCEEEECCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCCCEEEECCCCCH
T ss_conf             87637896179835678999999972544387075204577055776655689999999987426877510563787750


Q ss_pred             CCCCHHHHHHHHHHCCCCCCHHHHHHHHHHCCCCEEEEECCCHHHHHHHHHHCCC
Q ss_conf             0010023322222044850199999999977998999938987999999987389
Q gi|254780536|r  239 VSSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKS  293 (314)
Q Consensus       239 ~~~~~~~~~~l~~ql~~pV~f~~~i~~l~~~g~~~fiEiGP~~~Lt~l~~~~~~~  293 (314)
T Consensus       240 ~~~g~~~k~~L~~Ql~~pVrw~~s~~~l~~~G~~~f~EvGPG~VL~GL~kRi~~~  294 (295)
T TIGR00128       240 YTNGDRIKEKLIEQLYSPVRWTDSVEKLAARGVTEFAEVGPGKVLTGLIKRIKKD  294 (295)
T ss_pred             HCCHHHHHHHHHHHCCCCCCHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCC
T ss_conf             0144789999999701781147889998636630467546886112551202567