HHsearch alignment for GI: 254780536 and conserved domain: TIGR02813

>TIGR02813 omega_3_PfaA polyketide-type polyunsaturated fatty acid synthase PfaA; InterPro: IPR004432 Members of this entry represent PfaA, which is involved in omega-3 polyunsaturated fatty acid biosynthesis, for example PfaA from the eicosapentaenoic acid biosynthesis operon in Photobacterium profundum strain SS9. PfaA is found together with PfaB, PfaC, and PfaD, and the functions of the individual polypeptides have not yet been described. More distant homologues of PfaA, also included in this entry, appear to be involved in polyketide-like biosynthetic mechanisms of polyunsaturated fatty acid biosynthesis; an alternative to the more familiar iterated mechanism of chain extension and desaturation, and like PfaA the more distant homologues are likewise found near genes for homologues of PfaB, PfaC, and/or PfaD..
Probab=100.00  E-value=0  Score=408.37  Aligned_cols=305  Identities=32%  Similarity=0.455  Sum_probs=262.6

Q ss_pred             EEEEECCCCCCCCCCHHHHHHHHCHHHHHHHHHHHHHCCC----CHHHHHCCCC----------HHHHHCHHHHHHHHHH
Q ss_conf             1999808733373115899998599999999999988398----9789853898----------6783046765034566
Q gi|254780536|r    2 STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQ----NLSDLMWNGS----------QEELTATCNAQPALTA   67 (314)
Q Consensus         2 k~~f~FpGQGsq~~gM~~~L~~~~p~~r~~~~~~~~~l~~----~l~~~~~~~~----------~~~l~~~~~~Qp~i~~   67 (314)
T Consensus       590 Kv~ALFaGQGsQYlNMG~ELAc~fP~~~~~~~~~D~~F~~~~~~~Ls~~~yPIP~F~~~s~~AQ~~~L~~T~~AQsAIG~  669 (2773)
T TIGR02813       590 KVAALFAGQGSQYLNMGRELACNFPELRQALADADKVFTQAGKGALSSVLYPIPVFNDESRKAQEEALTNTAYAQSAIGV  669 (2773)
T ss_pred             EEEEEECCCCHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCHHHH
T ss_conf             07887327734677754887414768999999765565204665423221456665426789999999855521204548


Q ss_pred             HHHHHHHHHHHCCCCCCCCCCCCCCCCCCCHHHHHHCCCCCHHHHHHHHHHHHHHHHHHCCC-CCCCCCCCCCCHHHHHH
Q ss_conf             66547899997188764354424665442012225317865023333345688653100111-12222212350355311
Q gi|254780536|r   68 VSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQEAVPP-GLGSMVAIIGLDDCVVD  146 (314)
Q Consensus        68 ~~~a~~~~l~~~gi~~~~~p~~v~GhSlGE~aAl~~aG~ls~eda~~lv~~R~~~m~~~~~~-~~g~M~aV~~~~~~~~~  146 (314)
T Consensus       670 lS~g~y~~~T~AGF----~aD~~AGHSFGELsALcAaGViS~~DY~~LA~~RG~AMA~~~~e~~~G~~~a~~l~~~~~~~  745 (2773)
T TIGR02813       670 LSMGQYKLFTQAGF----KADMVAGHSFGELSALCAAGVISDDDYIKLAFSRGQAMAASTAEADIGVMYAVILAVKKSAE  745 (2773)
T ss_pred             HHHHHHHHHHHCCC----CCCCCCCCCHHHHHHHHHCCCCCHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHCCHH
T ss_conf             88999999984587----42323456446799998637655378999999850642488553012114545454203445


Q ss_pred             HHHHHHHCCCCCEECCCCCCCEEEECCCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCHHCCHHHHHHHHHHHHHHHCCC
Q ss_conf             22344211354200122322213530331128999888888653100355554323420102037888874222320287
Q gi|254780536|r  147 SICAQASRVGICEIANDNGGGQVVISGLQDAVKCAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDP  226 (314)
Q Consensus       147 ~~~~~~~~~~~~~ia~~Ns~~q~visG~~~~l~~~~~~~~~~~~~~~~~L~v~~afHs~lm~~~~~~~~~~l~~i~~~~p  226 (314)
T Consensus       746 ~~~~~i~~~~~v~iANYNs~~QlViAG~s~~~~~A~~~l~~~Gf-K~ipLPVSgAFHTPLVaHAQKPFs~AID~A~F~~P  824 (2773)
T TIGR02813       746 VIKNCIKDFEGVSIANYNSPTQLVIAGVSTAIQLAAKALKEKGF-KAIPLPVSGAFHTPLVAHAQKPFSAAIDKAKFNTP  824 (2773)
T ss_pred             HHHHHHHHHCCCEEEEECCCCCEEEECCCHHHHHHHHHHHCCCC-EEEECCCCCHHCCCCHHHCCCCHHHHHHCCCCCCC
T ss_conf             78888886337436630588756985641789999999852884-78745766100034013205735787501447898


Q ss_pred             CCCCCCCCCCCCCC-CCHHHHHHHHHHCCCCCCHHHHHHHHHHCCCCEEEEECCCHHHHHHHHHHCCC----CCEEECC-
Q ss_conf             76542045787100-10023322222044850199999999977998999938987999999987389----8155239-
Q gi|254780536|r  227 VVPILPNFCASPVS-SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKS----LSAVSIS-  300 (314)
Q Consensus       227 ~ipi~S~~~g~~~~-~~~~~~~~l~~ql~~pV~f~~~i~~l~~~g~~~fiEiGP~~~Lt~l~~~~~~~----~~~~~~~-  300 (314)
T Consensus       825 ~~plYsNgTg~~H~~~a~~IK~alK~H~L~SV~F~~~l~~~Y~~GaRVFVEFGPKNiL~KLvE~~L~~~~~~l~~IsiN~  904 (2773)
T TIGR02813       825 LVPLYSNGTGKLHKNDAKAIKKALKDHMLQSVHFSEQLEAMYAAGARVFVEFGPKNILQKLVENTLKDKEDELCAISINP  904 (2773)
T ss_pred             CEEEECCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHHHHCCEEEEEECC
T ss_conf             50210053113032128999999987678742256789999847996999547435678999999853015878998668


Q ss_pred             CH-HHHHHHHHH
Q ss_conf             98-999999987
Q gi|254780536|r  301 KV-EDIDLALRS  311 (314)
Q Consensus       301 ~~-~~~~~~l~~  311 (314)
T Consensus       905 NPK~~sD~QlR~  916 (2773)
T TIGR02813       905 NPKGDSDSQLRQ  916 (2773)
T ss_pred             CCCCCHHHHHHH
T ss_conf             898535689999