HHsearch alignment for GI: 254780536 and conserved domain: TIGR03131

>TIGR03131 malonate_mdcH malonate decarboxylase, epsilon subunit. Members of this protein family are the epsilon subunit of malonate decarboxylase. This subunit has malonyl-CoA/dephospho-CoA acyltransferase activity. Malonate decarboxylase may be a soluble enzyme, or linked to membrane subunits and active as a sodium pump. The epsilon subunit is closely related to the malonyl CoA-acyl carrier protein (ACP) transacylase family described by TIGR00128, but acts on an ACP subunit of malonate decarboxylase that has an unusual coenzyme A derivative as its prothetic group.
Probab=100.00  E-value=0  Score=553.02  Aligned_cols=295  Identities=33%  Similarity=0.421  Sum_probs=277.5

Q ss_pred             EEEECCCCCCCCCCHHHHHHHHCHHHHHHHHHHHHHCCCCHHHHHCCCCHHHHHCHHHHHHHHHHHHHHHHHHHHHCCCC
Q ss_conf             99980873337311589999859999999999998839897898538986783046765034566665478999971887
Q gi|254780536|r    3 TVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPALTAVSMAFIRVMEKNGLC   82 (314)
Q Consensus         3 ~~f~FpGQGsq~~gM~~~L~~~~p~~r~~~~~~~~~l~~~l~~~~~~~~~~~l~~~~~~Qp~i~~~~~a~~~~l~~~gi~   82 (314)
T Consensus         1 iafvFpGQGsQ~~gM~~~l~~-~~~~~~~~~~~~~~l~~~~~~~---~~~~~l~~t~~~Qpai~a~~~al~~~l~~~g~-   75 (295)
T TIGR03131         1 IALLFPGQGSQRAGMLAELPD-HPAVAAVLAEASDVLGIDPREL---DDAEALASTRSAQLCILAAGVAAWRALLALLP-   75 (295)
T ss_pred             EEEEECCCHHHHHHHHHHHHH-CCHHHHHHHHHHHHHCCCHHHC---CCHHHHCCCCCHHHHHHHHHHHHHHHHHHCCC-
T ss_conf             099968447889999999860-9099999999998868696663---75344326531519999999999999996499-


Q ss_pred             CCCCCCCCCCCCCCCHHHHHHCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCCEECC
Q ss_conf             64354424665442012225317865023333345688653100111122222123503553112234421135420012
Q gi|254780536|r   83 VKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIAN  162 (314)
Q Consensus        83 ~~~~p~~v~GhSlGE~aAl~~aG~ls~eda~~lv~~R~~~m~~~~~~~~g~M~aV~~~~~~~~~~~~~~~~~~~~~~ia~  162 (314)
T Consensus        76 ---~P~~v~GHSlGE~aA~~~AG~ls~edal~lv~~R~~lm~~~~~~~-~gm~av~~~~~~~~~~~~~~~----~v~iA~  147 (295)
T TIGR03131        76 ---RPSAVAGYSVGEYAAAVVAGVLTFDDALRLVALRAALMDQAVPGG-YGMLAVLGLDLAAVEALIAKH----GVYLAI  147 (295)
T ss_pred             ---CCCEEEECCHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHCCCC-CCEEEEECCCHHHHHHHHHHC----CEEEEE
T ss_conf             ---888897677758999998399989999999999999999747899-835875458698888655304----737857


Q ss_pred             CCCCCEEEECCCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCHHCCHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCC
Q ss_conf             23222135303311289998888886531003555543234201020378888742223202877654204578710010
Q gi|254780536|r  163 DNGGGQVVISGLQDAVKCAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSI  242 (314)
Q Consensus       163 ~Ns~~q~visG~~~~l~~~~~~~~~~~~~~~~~L~v~~afHs~lm~~~~~~~~~~l~~i~~~~p~ipi~S~~~g~~~~~~  242 (314)
T Consensus       148 ~Nsp~q~VisG~~~~i~~~~~~l~~~g~~~~~~L~v~~afHS~~m~~~~~~~~~~l~~~~~~~p~ipviS~~tg~~~~~~  227 (295)
T TIGR03131       148 INAPDQVVIAGSRAALRAVAELARAAGASRAKRLAVRVPSHTPLLAKAAEQFAEALAEIPLAAPRLPYLSGIDARLVRDA  227 (295)
T ss_pred             ECCCCCEEEECCHHHHHHHHHHHHHCCCCCEEECCCCCCCCCHHHHHHHHHHHHHHHCCCCCCCCCEEEECCCCCCCCCC
T ss_conf             53898669848999999999999977996220078887566099999999999998667777997169989876255684


Q ss_pred             HHHHHHHHHHCCCCCCHHHHHHHHHHCCCCEEEEECCCHHHHHHHHHHCCCCCEEECCCHHHHHHHHH
Q ss_conf             02332222204485019999999997799899993898799999998738981552399899999998
Q gi|254780536|r  243 DEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVEDIDLALR  310 (314)
Q Consensus       243 ~~~~~~l~~ql~~pV~f~~~i~~l~~~g~~~fiEiGP~~~Lt~l~~~~~~~~~~~~~~~~~~~~~~l~  310 (314)
T Consensus       228 ~~~~~~l~~ql~~pV~f~~~i~~l~~~g~~~fiEiGP~~~Ls~lv~~il~~~~~~~~~~~~~l~~~~~  295 (295)
T TIGR03131       228 AQIRDDLARQIATPVDWHDCMQAAYERGARLVIELGPGDVLTKLANEAFPELPARSADDFRSLDGLLA  295 (295)
T ss_pred             CCCHHHHHHHHHCCCCHHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHCCCCCEEECCCHHHHHHHHC
T ss_conf             34299999871156829999999995799999997986888999999859997685499989998749