HHsearch results for GI: 254780536 and protein with PDBid: 2uv8_A

>2uv8_A Fatty acid synthase subunit alpha (FAS2); fatty acid biosynthesis, malonyl/palmitoyl transferase, phosphopantetheine, transferase; HET: GVL FMN; 3.10A {Saccharomyces cerevisiae} PDB: 2vkz_A* 3hmj_A*
Probab=99.66  E-value=4.4e-18  Score=128.00  Aligned_cols=100  Identities=14%  Similarity=0.114  Sum_probs=67.2

Q ss_pred             EEEEECCCCCCCCCCHHHHHHHHCHHHHHHH----------HHHHHHC--------CCCHHHHHCC-------CCHHHHH
Q ss_conf             1999808733373115899998599999999----------9999883--------9897898538-------9867830
Q gi|254780536|r    2 STVLTFPGQGSQVIGMGRDLYDSFPEARLVF----------EEVDHTL--------NQNLSDLMWN-------GSQEELT   56 (314)
Q Consensus         2 k~~f~FpGQGsq~~gM~~~L~~~~p~~r~~~----------~~~~~~l--------~~~l~~~~~~-------~~~~~l~   56 (314)
                      ..+|+|+|||+||+||+.+|+.++|.+.+.|          ++|+..+        +|++.+.++.       +....++
T Consensus      1756 ~~~f~~~gqg~q~vGm~~el~~s~~~~~~~F~~Rn~t~~~~~~c~~a~~p~~~f~~~Ws~~E~v~ks~~~~s~ga~a~l~ 1835 (1887)
T 2uv8_A         1756 IENMTKEKVSNGGVGVDVELITSINVENDTFIERNFTPQEIEYCSAQPSVQSSFAGTWSAKEAVFKSLGVKSLGGGAALK 1835 (1887)
T ss_dssp             --------------------------------------------------------------------------------
T ss_pred             EEEEECCCCCCCCCCCCHHHHHCCCCCCHHHHHHCCCHHHHHHHHHCCCCCCCCCCCCCHHHHHHHCCCCCCCCCCCCCC
T ss_conf             46883589987656634999850454473777521449999999853685435456766899975123666667777666


Q ss_pred             CHHHHHHHHHHHHHHH----HHHHHHCCCCCCCCCCCC-CCCCCCCHHHHHHCC
Q ss_conf             4676503456666547----899997188764354424-665442012225317
Q gi|254780536|r   57 ATCNAQPALTAVSMAF----IRVMEKNGLCVKRDISYV-AGHSLGEYTALCAAK  105 (314)
Q Consensus        57 ~~~~~Qp~i~~~~~a~----~~~l~~~gi~~~~~p~~v-~GhSlGE~aAl~~aG  105 (314)
                      +++++||.+++.+++|    +++|+++||    +|+.| +|||.||++|+|+|+
T Consensus      1836 ~iei~qp~~~A~~V~L~ga~a~~~~~~GV----~p~aVsIgHS~gEiaA~~vA~ 1885 (1887)
T 2uv8_A         1836 DIEIVRVNKNAPAVELHGNAKKAAEEAGV----TDVKVSISHDDLQAVAVAVST 1885 (1887)
T ss_dssp             ------------------------------------------------------
T ss_pred             CCEEECCCCCCEEEEECHHHHHHHHHCCC----CCCEEEECCCHHHHHHHHHHC
T ss_conf             53265778611178727899999998199----267277477545999984526