HHsearch results for GI: 254780536 and protein with PDBid: 2uv8_G

>2uv8_G Fatty acid synthase subunit beta (FAS1); fatty acid biosynthesis, malonyl/palmitoyl transferase, phosphopantetheine, transferase; HET: GVL FMN; 3.10A {Saccharomyces cerevisiae} PDB: 2vkz_G* 3hmj_G*
Probab=100.00  E-value=0  Score=436.17  Aligned_cols=288  Identities=23%  Similarity=0.243  Sum_probs=245.7

Q ss_pred             EEEEECCCCCCC--CCCHHHHHHHHCHHHHHHHHHHHHHC-----------------CCCHHHHHCCC----CHHHHHCH
Q ss_conf             199980873337--31158999985999999999999883-----------------98978985389----86783046
Q gi|254780536|r    2 STVLTFPGQGSQ--VIGMGRDLYDSFPEARLVFEEVDHTL-----------------NQNLSDLMWNG----SQEELTAT   58 (314)
Q Consensus         2 k~~f~FpGQGsq--~~gM~~~L~~~~p~~r~~~~~~~~~l-----------------~~~l~~~~~~~----~~~~l~~~   58 (314)
                      |++|+|+|||||  |.|||++||+.||.|.+.+++|...+                 |+|+..|+...    +.+.|.++
T Consensus       155 ~l~~lF~GQGsq~~~~~m~reLy~~~~~f~~~l~~~~a~l~~~l~~~~~~~~~~~~~g~d~~~wl~~~~~~p~~~~L~~~  234 (2051)
T 2uv8_G          155 QLVAIFGGQGNTDDYFEELRDLYQTYHVLVGDLIKFSAETLSELIRTTLDAEKVFTQGLNILEWLENPSNTPDKDYLLSI  234 (2051)
T ss_dssp             CEEEEECCTTSCSCHHHHHHHHHHHTHHHHHHHHHHHHHHHHHHHHHSSSHHHHCTTCCCHHHHHHCGGGCCCHHHHHSH
T ss_pred             EEEEEECCCCCCCCHHHHHHHHHHHCHHHHHHHHHHHHHHHHHHCCCHHHHHHHCCCCCCHHHHHCCCCCCCCHHHHCCC
T ss_conf             39999899888741247999999877688999999999987651554455544124565477653176568875664357


Q ss_pred             HHHHHHHHHHHHHHHH-HHHHCCCCCC---CCCCCCCCCCCCCHHHHHHCCCCCHHHHHHHHHHHHHHHHHH--------
Q ss_conf             7650345666654789-9997188764---354424665442012225317865023333345688653100--------
Q gi|254780536|r   59 CNAQPALTAVSMAFIR-VMEKNGLCVK---RDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQEA--------  126 (314)
Q Consensus        59 ~~~Qp~i~~~~~a~~~-~l~~~gi~~~---~~p~~v~GhSlGE~aAl~~aG~ls~eda~~lv~~R~~~m~~~--------  126 (314)
                      .++||+||++|+++|. +|+.+|+.|.   ..+++++|||+||++|+++||++|++|+.+++..|+++|+..        
T Consensus       235 ~vsqP~ifa~q~a~~~~~~~~~Gv~P~~l~~~~~av~GHSQGeiaAA~VAgalSleda~~~va~r~rll~~ig~r~~~~~  314 (2051)
T 2uv8_G          235 PISCPLIGVIQLAHYVVTAKLLGFTPGELRSYLKGATGHSQGLVTAVAIAETDSWESFFVSVRKAITVLFFIGVRCYEAY  314 (2051)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHTCCHHHHHHTEEEEEESTTHHHHHHHHHTCCCHHHHHHHHHHHHHHHHHHHHHHHHHS
T ss_pred             CCHHHHHHHHHHHHHHHHHHHHCCCHHHCCCCCCCCCCCCHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHCCC
T ss_conf             70067999999999999999809983441455622111529899999994458899999999999999998766541123


Q ss_pred             ----------------CCCCCCCCCCCCCCHHHHHHHHHHHHH----CCCCCEECCCCCCCEEEECCCCCHHHHHHHHHH
Q ss_conf             ----------------111122222123503553112234421----135420012232221353033112899988888
Q gi|254780536|r  127 ----------------VPPGLGSMVAIIGLDDCVVDSICAQAS----RVGICEIANDNGGGQVVISGLQDAVKCAADTCL  186 (314)
Q Consensus       127 ----------------~~~~~g~M~aV~~~~~~~~~~~~~~~~----~~~~~~ia~~Ns~~q~visG~~~~l~~~~~~~~  186 (314)
                                      .....|.|++|.+.+.+.+++++.+.+    ..+.+.||.+|+|+++||||++++++.+...|+
T Consensus       315 ~~~~l~~~~~~~~~~~~~g~~g~MlSV~gl~~e~v~~~l~~~~~~l~~~~~vsIAaVNGP~s~VVSG~p~aL~~l~~~l~  394 (2051)
T 2uv8_G          315 PNTSLPPSILEDSLENNEGVPSPMLSISNLTQEQVQDYVNKTNSHLPAGKQVEISLVNGAKNLVVSGPPQSLYGLNLTLR  394 (2051)
T ss_dssp             CCCCCCHHHHHHHHHTTCCSCCSEEEEESSCHHHHHHHHHHHHHTSCGGGCCEEEECCSSSEEEEESCHHHHHHHHHHHH
T ss_pred             CCCCCCCHHHHHHHHCCCCCCCCEEEECCCCHHHHHHHHHHHHCCCCCCCCEEEEEEECCCCEEEECCHHHHHHHHHHHH
T ss_conf             33456610222222116788885377058999999999998620478778679999968987799789999999999999


Q ss_pred             HHHH-----------------HHCCCCCCCCCCCCHHCCHHHHHHHHHHH----HHHHCCCCCCCCCCCCCCCCCC--CH
Q ss_conf             8653-----------------10035555432342010203788887422----2320287765420457871001--00
Q gi|254780536|r  187 NKGA-----------------KRAVFLPVSAPFHSSLMTPVSKVMKWMLD----SVTKQDPVVPILPNFCASPVSS--ID  243 (314)
Q Consensus       187 ~~~~-----------------~~~~~L~v~~afHs~lm~~~~~~~~~~l~----~i~~~~p~ipi~S~~~g~~~~~--~~  243 (314)
                      +++.                 .+.++|||++|||||+|+|+.+.+++.+.    ++.+++|+||+|||+||+++..  ..
T Consensus       395 ~~ga~~~~~q~r~~~~~rk~~v~~R~LpVs~AFHSp~Mep~vd~~~~~L~~~~~~l~~~~p~IPv~STvTG~~l~~~~~~  474 (2051)
T 2uv8_G          395 KAKAPSGLDQSRIPFSERKLKFSNRFLPVASPFHSHLLVPASDLINKDLVKNNVSFNAKDIQIPVYDTFDGSDLRVLSGS  474 (2051)
T ss_dssp             HHSCCTTCCGGGSCGGGCCCCCEEEECSCSSCTTSTTTHHHHHHHHHHHHSSSCCCCTTTCCSCBBCTTTCSBSSSCSSC
T ss_pred             HHCCCCCCCHHCCCCCCCCCCCCEEECCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCCCCCCEEECCCCCCCCCCCCC
T ss_conf             73052211000033333355453245268777767657879999999999733677767887745978887515455432


Q ss_pred             HHHHHHHHHCCCCCCHHHHHHHHHHCCCCEEEEECCCHH--HHHHHHHHCCC
Q ss_conf             233222220448501999999999779989999389879--99999987389
Q gi|254780536|r  244 EISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKV--LTGLAKRIDKS  293 (314)
Q Consensus       244 ~~~~~l~~ql~~pV~f~~~i~~l~~~g~~~fiEiGP~~~--Lt~l~~~~~~~  293 (314)
                      ...+||.+|+++||+|.++++    .|+++|||+|||++  |+.++++...+
T Consensus       475 l~~~YW~r~lR~pVrF~~av~----~G~t~flElGP~pVlgL~~lt~~~~~g  522 (2051)
T 2uv8_G          475 ISERIVDCIIRLPVKWETTTQ----FKATHILDFGPGGASGLGVLTHRNKDG  522 (2051)
T ss_dssp             HHHHHHHHHHTSCBCHHHHTC----CCCSEEEECSSSGGGSHHHHHHHHHTT
T ss_pred             CCHHHHHHHEECCCCHHHHHC----CCCCEEEEECCCCCCHHHHHHHHHHCC
T ss_conf             558999987132565788510----699889996979601588888876325