HHsearch results for GI: 254780536 and protein with PDBid: 3g87_A

>3g87_A Malonyl COA-acyl carrier protein transacylase; ssgcid, niaid, decode biostructures, dried seaweed, acyltransferase, transferase; 2.30A {Burkholderia pseudomallei 1710B}
Probab=100.00  E-value=0  Score=495.32  Aligned_cols=285  Identities=32%  Similarity=0.479  Sum_probs=248.0

Q ss_pred             CEEEEECCCCCCCCCCHHHHHHHHCHHHHHHHHHHHHHCCCCHHHHHCCCCHHHHHCHHHHHHHHHHHHH-HHHHHHHHC
Q ss_conf             9199980873337311589999859999999999998839897898538986783046765034566665-478999971
Q gi|254780536|r    1 MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPALTAVSM-AFIRVMEKN   79 (314)
Q Consensus         1 mk~~f~FpGQGsq~~gM~~~L~~~~p~~r~~~~~~~~~l~~~l~~~~~~~~~~~l~~~~~~Qp~i~~~~~-a~~~~l~~~   79 (314)
                      |.+|||||||||||+|||++||+++|.+   ++++|+++++++.+++++++.+.|++|.++||+||++++ +++.+|+.+
T Consensus         5 ~~~AFvFpGQGsQ~~gMg~~L~~~f~~~---~~~~d~~lg~~l~~~~~~~~~~~l~~t~~aQpai~a~~~~~~~~l~~~~   81 (394)
T 3g87_A            5 MLNTFMFPGQGSQAKGMGGALFDRFADL---TAQADAVLGYSIRALCVDDPRDELGRTQFTQPALYVVNALTYYAKCEDS   81 (394)
T ss_dssp             CEEEEEECCTTCCCTTCSTTHHHHTHHH---HHHHHHHHSSCHHHHHHTCTTCCTTSHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             CCEEEEECCCHHHHHHHHHHHHHHHHHH---HHHHHHHHCCCHHHHHCCCCHHHHCCHHHHHHHHHHHHHHHHHHHHHHC
T ss_conf             7779998983274775899999970999---9999998598999986189987976535799999999999999999966


Q ss_pred             CCCCCCCCCCCCCCCCCCHHHHHHCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCCE
Q ss_conf             88764354424665442012225317865023333345688653100111122222123503553112234421135420
Q gi|254780536|r   80 GLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICE  159 (314)
Q Consensus        80 gi~~~~~p~~v~GhSlGE~aAl~~aG~ls~eda~~lv~~R~~~m~~~~~~~~g~M~aV~~~~~~~~~~~~~~~~~~~~~~  159 (314)
                      |+    +||+++|||+|||+|+++||+||++|++++++.|+++|+++...   +|+++........+.+... .....++
T Consensus        82 Gv----~Pd~v~GHSlGE~aAa~~AG~ls~eda~~lv~~R~~~m~~~~~~---~~~~~~~~~~~~~~~~~~~-~~~~~v~  153 (394)
T 3g87_A           82 GE----TPDFLAGHSLGEFNALLAAGCFDFETGLKLVARRAELMSQARDG---AMAAIVNASREQIERTLDE-HGLVDTA  153 (394)
T ss_dssp             CC----CCSEEEECTTHHHHHHHHTTSSCHHHHHHHHHHHHHHHHHCCSE---EEEEEESCCHHHHHHHHHH-TTCTTCE
T ss_pred             CC----CCCEEECCCCCHHHHHHHCCCCCHHHHHHHHHHHHHHHHHCCCC---CCEEEECCCHHHHHHHHHC-CCCCEEE
T ss_conf             99----97576168861799998704789899999999999887505887---6322000227777788642-6786189


Q ss_pred             ECCCCCCCEEEECCCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCHHCCHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCC
Q ss_conf             01223222135303311289998888886531003555543234201020378888742223202877654204578710
Q gi|254780536|r  160 IANDNGGGQVVISGLQDAVKCAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV  239 (314)
Q Consensus       160 ia~~Ns~~q~visG~~~~l~~~~~~~~~~~~~~~~~L~v~~afHs~lm~~~~~~~~~~l~~i~~~~p~ipi~S~~~g~~~  239 (314)
                      |||+|+|+|+||||+.++++++.+.++++|+ ++++|+|++|||||+|+|+.++|++.++++++++|++|+|||+||+++
T Consensus       154 iA~~Nsp~~~VisG~~~~v~~l~~~l~~~gi-~~~~L~v~~afHS~~m~p~~~~~~~~l~~~~~~~P~ip~~S~vtg~~~  232 (394)
T 3g87_A          154 IANDNTPSQLVISGPAHEIARAEALFQHDRV-RYLRLNTSGAFHSKFMRPAQQAFAAHLQSFRLADPAIPVISNVSARPY  232 (394)
T ss_dssp             EEEEEETTEEEEEEEHHHHHHHGGGSCSSSC-EEEECSCSSCTTSGGGHHHHHHHHHHHTTSCCCCCSSCEECTTTSSBC
T ss_pred             EEEECCHHHHHCCCCHHHHHHHHHHHHHCCE-EEEEECCCCCCCCHHHHHHHHHHHHHHHCCCCCCCCCCEEECCCCEEC
T ss_conf             9997775673116767777899998885590-588603665567588999999999999539987999847978987376


Q ss_pred             CCCHHHHHHHHHHCCCCCCHHHHHHHHHHCC-----CCEEEEECCCHHHHHHHHHHCCCCCEEE
Q ss_conf             0100233222220448501999999999779-----9899993898799999998738981552
Q gi|254780536|r  240 SSIDEISRLLVEQVTGRVRWRETIQWFANHG-----VKSVYEVGSGKVLTGLAKRIDKSLSAVS  298 (314)
Q Consensus       240 ~~~~~~~~~l~~ql~~pV~f~~~i~~l~~~g-----~~~fiEiGP~~~Lt~l~~~~~~~~~~~~  298 (314)
                      ++. ++++||++|+++||+|.++|+++.+.|     +++|||+|||++|++|+++|+++.++..
T Consensus       233 ~~~-~~~~~~~~ql~~PV~f~~~i~~l~~~g~~~~~~~~fvEiGP~~vLs~lv~~i~~~~~~~~  295 (394)
T 3g87_A          233 ENG-RVSEGLAQQIASPVRWCESIRYLLALAAERGEAIEFTELGHGDVLTRLVHTIRRQTPAPA  295 (394)
T ss_dssp             CTT-CHHHHHHHGGGSCBCHHHHHHHHHHHHHHTTCCEEEEECSSSSHHHHHHHHHHHSSCC--
T ss_pred             CHH-HHHHHHHHHHHCCCCHHHHHHHHHHHHHHCCCCCEEEEECCCHHHHHHHHHHHHCCCCCE
T ss_conf             727-889999999838575999999999856540799889991987899999999862199833