HHsearch results for GI: 254780536 and protein with PDBid: 3im8_A

>3im8_A Malonyl acyl carrier protein transacylase; fatty acid synthesis, malonyl-COA, acyl carrier protein TRAN (MCAT), FABD, acyltransferase; 2.10A {Streptococcus pneumoniae}
Probab=100.00  E-value=0  Score=511.56  Aligned_cols=306  Identities=36%  Similarity=0.566  Sum_probs=285.7

Q ss_pred             CE-EEEECCCCCCCCCCHHHHHHHHCHHHHHHHHHHHHHCCCCHHHHHCCCCHHHHHCHHHHHHHHHHHHHHHHHHHHHC
Q ss_conf             91-99980873337311589999859999999999998839897898538986783046765034566665478999971
Q gi|254780536|r    1 MS-TVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPALTAVSMAFIRVMEKN   79 (314)
Q Consensus         1 mk-~~f~FpGQGsq~~gM~~~L~~~~p~~r~~~~~~~~~l~~~l~~~~~~~~~~~l~~~~~~Qp~i~~~~~a~~~~l~~~   79 (314)
                      |+ |||+|||||+||+|||++||+.+|.||+.++++++++++++.+++.. +++.++++.++||++|+++++++++|+++
T Consensus         1 m~k~AfvFpGQGsq~~~mg~~L~~~~p~~r~~~~~~~~~l~~~l~~~~~~-~~~~~~~~~~~q~~~~a~~~al~~~l~~~   79 (307)
T 3im8_A            1 MTKTAFLFAGQGAQYLGMGRDFYDQYPIVKETIDRASQVLGYDLRYLIDT-EEDKLNQTRYTQPAILATSVAIYRLLQEK   79 (307)
T ss_dssp             --CEEEEECCTTCCCTTTTHHHHHHCHHHHHHHHHHHHHHTSCHHHHHHH-CHHHHTSHHHHHHHHHHHHHHHHHHHHHT
T ss_pred             CCCEEEEECCCHHHHHHHHHHHHHCCHHHHHHHHHHHHHHCCCHHHHHCC-CHHHHHHHHHHHHHHHHHHHHHHHHHHHC
T ss_conf             96089997982563887999999749999999999998819999999669-76665216777699999999999999974


Q ss_pred             CCCCCCCCCCCCCCCCCCHHHHHHCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCCE
Q ss_conf             88764354424665442012225317865023333345688653100111122222123503553112234421135420
Q gi|254780536|r   80 GLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICE  159 (314)
Q Consensus        80 gi~~~~~p~~v~GhSlGE~aAl~~aG~ls~eda~~lv~~R~~~m~~~~~~~~g~M~aV~~~~~~~~~~~~~~~~~~~~~~  159 (314)
                      |+    +|++++|||+|||+|+++||+++++|++++++.|+++|+...+...|.|+++.+......++.+......+.++
T Consensus        80 Gi----~P~~v~GhSlGE~aA~~~aG~l~~eda~~l~~~R~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~  155 (307)
T 3im8_A           80 GY----QPDMVAGLSLGEYSALVASGALDFEDAVALVAKRGAYMEEAAPADSGKMVAVLNTPVEVIEEACQKASELGVVT  155 (307)
T ss_dssp             TC----CCSEEEESTTHHHHHHHHTTSSCHHHHHHHHHHHHHHHHHHSCTTSSEEEEEESSCHHHHHHHHHHHGGGSCEE
T ss_pred             CC----CCCEEECCCHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCE
T ss_conf             99----87488117741899986189999999999887899888734677776227776423556899876421037714


Q ss_pred             ECCCCCCCEEEECCCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCHHCCHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCC
Q ss_conf             01223222135303311289998888886531003555543234201020378888742223202877654204578710
Q gi|254780536|r  160 IANDNGGGQVVISGLQDAVKCAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV  239 (314)
Q Consensus       160 ia~~Ns~~q~visG~~~~l~~~~~~~~~~~~~~~~~L~v~~afHs~lm~~~~~~~~~~l~~i~~~~p~ipi~S~~~g~~~  239 (314)
                      |||+|+|+|+||||++++++++.+.++++|++++++|+|+.|||||+|+++.++|++.++.+++++|++|++|+++++++
T Consensus       156 ia~~Nsp~~~visG~~~~l~~~~~~l~~~g~~~~~~L~v~~afHs~~m~~~~~~~~~~~~~~~~~~p~~p~~S~~~~~~~  235 (307)
T 3im8_A          156 PANYNTPAQIVIAGEVVAVDRAVELLQEAGAKRLIPLKVSGPFHTSLLEPASQKLAETLAQVSFSDFTCPLVGNTEAAVM  235 (307)
T ss_dssp             EEEEEETTEEEEEECHHHHHHHHHHHHHHTCCEEEECCSSSCCSSGGGHHHHHHHHHHHHTCCCCCCSSCBBCTTTSSBC
T ss_pred             EEEECCCCCEEEECCHHHHHHHHHHHHHCCCCEEEECCCCCCCCCHHHCCCHHHHHHHHCCCCCCCCCCCCCCCCCCCCC
T ss_conf             62886799779848899999999999846997699889998735955586246899852032445787776556656668


Q ss_pred             CCCHHHHHHHHHHCCCCCCHHHHHHHHHHCCCCEEEEECCCHHHHHHHHHHCCCCCEEECCCHHHHHHHHHHH
Q ss_conf             0100233222220448501999999999779989999389879999999873898155239989999999874
Q gi|254780536|r  240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVEDIDLALRSI  312 (314)
Q Consensus       240 ~~~~~~~~~l~~ql~~pV~f~~~i~~l~~~g~~~fiEiGP~~~Lt~l~~~~~~~~~~~~~~~~~~~~~~l~~~  312 (314)
                      +. +.++++|.+|+++||+|.++|+.++++|++.|||+|||++|++|+++++++....++++.+++..+|+.|
T Consensus       236 ~~-~~~~~~~~~~l~~pV~f~~~i~~l~~~g~~~fiEiGP~~~Ls~l~~~i~~~~~~~~v~d~~sl~~~l~~L  307 (307)
T 3im8_A          236 QK-EDIAQLLTRQVKEPVRFYESIGVMQEAGISNFIEIGPGKVLSGFVKKIDQTAHLAHVEDQASLVALLEKL  307 (307)
T ss_dssp             CG-GGHHHHHHHHTTSCEEHHHHHHHHHHTTCCEEEEESSCSHHHHHHHHHCTTSEEEEESSHHHHHHHHTTC
T ss_pred             CH-HHHHHHHHHHHCCCCCHHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHCC
T ss_conf             86-7799999998158572999999999779999998598689999999983427704679999999999709