BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780536|ref|YP_003064949.1| acyl-carrier-protein
S-malonyltransferase [Candidatus Liberibacter asiaticus str. psy62]
         (314 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|254780536|ref|YP_003064949.1| acyl-carrier-protein S-malonyltransferase [Candidatus Liberibacter
           asiaticus str. psy62]
 gi|254040213|gb|ACT57009.1| acyl-carrier-protein S-malonyltransferase [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 314

 Score =  644 bits (1662), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 314/314 (100%), Positives = 314/314 (100%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN
Sbjct: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
           AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG
Sbjct: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC
Sbjct: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS
Sbjct: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
           SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS
Sbjct: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300

Query: 301 KVEDIDLALRSIVG 314
           KVEDIDLALRSIVG
Sbjct: 301 KVEDIDLALRSIVG 314


>gi|315122865|ref|YP_004063354.1| acyl-carrier-protein S-malonyltransferase [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313496267|gb|ADR52866.1| acyl-carrier-protein S-malonyltransferase [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 314

 Score =  551 bits (1421), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 259/314 (82%), Positives = 287/314 (91%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M+ VLTFPGQGSQ++GMGRDL +SFPEARLVFEEVDHTLNQ+LSDLMWNG QEELT T N
Sbjct: 1   MAIVLTFPGQGSQIVGMGRDLCESFPEARLVFEEVDHTLNQHLSDLMWNGPQEELTVTYN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
           AQPALTAVSMAFIRVMEKNGLC +RDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG
Sbjct: 61  AQPALTAVSMAFIRVMEKNGLCFERDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           KSMQEAVPPGLG M AIIGLDD  V+  C QAS++GIC+IANDNGGGQ+VISG+QDAVKC
Sbjct: 121 KSMQEAVPPGLGGMAAIIGLDDRAVEFACEQASKIGICQIANDNGGGQIVISGMQDAVKC 180

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A D+CL KGA+RAVFLPVSAPFHSSLM PVSKVM+ ML  + KQDPVVP+LPN CASPVS
Sbjct: 181 AVDSCLEKGARRAVFLPVSAPFHSSLMAPVSKVMQNMLGDIQKQDPVVPVLPNVCASPVS 240

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
            IDEIS+LLVEQVT RVRWRETIQWFANHG+  +YE+GSGKVLTGLAKRIDKS+SA+S+ 
Sbjct: 241 DIDEISKLLVEQVTARVRWRETIQWFANHGMTHIYEIGSGKVLTGLAKRIDKSISAISVD 300

Query: 301 KVEDIDLALRSIVG 314
           K+E+IDLAL +I+G
Sbjct: 301 KIENIDLALETIIG 314


>gi|307322235|ref|ZP_07601603.1| malonyl CoA-acyl carrier protein transacylase [Sinorhizobium
           meliloti AK83]
 gi|306892122|gb|EFN22940.1| malonyl CoA-acyl carrier protein transacylase [Sinorhizobium
           meliloti AK83]
          Length = 314

 Score =  405 bits (1041), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 191/309 (61%), Positives = 241/309 (77%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           MS   TFPGQGSQ +GMG+DL ++FPEA  VF EVD  L + LSD+MWNG +E LT T N
Sbjct: 1   MSIAFTFPGQGSQAVGMGKDLAEAFPEAAAVFAEVDDALGEKLSDIMWNGPEETLTLTAN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
           AQPAL AVSMA IRV+E  GL +K  +S+VAGHSLGEY+ALCAA  FSL+DT RL+R RG
Sbjct: 61  AQPALMAVSMAVIRVLEAKGLDLKSKVSFVAGHSLGEYSALCAAGTFSLADTARLLRIRG 120

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
            +MQ AVP G G+M AIIGL+   V+++C  AS +G C+IANDNGGGQ+VISG + AV+ 
Sbjct: 121 NAMQAAVPVGKGAMAAIIGLEHDDVEAVCRDASSLGSCQIANDNGGGQLVISGEKPAVEK 180

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           AA     KGAKRA+ LPVSAPFHS+LMTP ++ M+  L +V K+DPVVP++ N  A+PVS
Sbjct: 181 AAALASEKGAKRALMLPVSAPFHSALMTPAAEAMRKALATVEKRDPVVPVVANVLAAPVS 240

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
              EI+RLLVEQVTG+VRWRET++WFA H V ++YE+GSGKVLTGLA+RIDK+++ ++++
Sbjct: 241 DAGEIARLLVEQVTGQVRWRETVEWFAAHEVTTLYEIGSGKVLTGLARRIDKTVTGIAVN 300

Query: 301 KVEDIDLAL 309
              DID AL
Sbjct: 301 SATDIDAAL 309


>gi|15964894|ref|NP_385247.1| acyl-carrier-protein S-malonyltransferase [Sinorhizobium meliloti
           1021]
 gi|9587284|gb|AAF89245.1|AF284419_1 malonyl-CoA:acyl carrier protein transacylase [Sinorhizobium
           meliloti]
 gi|15074073|emb|CAC45720.1| Probable malonyl CoA-acyl carrier protein transacylase
           [Sinorhizobium meliloti 1021]
          Length = 314

 Score =  403 bits (1036), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 191/309 (61%), Positives = 241/309 (77%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           MS   TFPGQGSQ +GMG+DL ++FPEA  VF EVD  L++ LSD+MWNG +E LT T N
Sbjct: 1   MSIAFTFPGQGSQAVGMGKDLAEAFPEAAAVFAEVDDALSEKLSDIMWNGPEETLTLTAN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
           AQPAL AVSMA IRV+E  GL +K  +S+VAGHSLGEY+ALCAA  FSL+DT RL+R RG
Sbjct: 61  AQPALMAVSMAVIRVLEAKGLDLKSKVSFVAGHSLGEYSALCAAGTFSLADTARLLRIRG 120

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
            +MQ AVP G G+M AIIGL+   V+++C  AS  G C+IANDNGGGQ+VISG + AV+ 
Sbjct: 121 NAMQAAVPVGKGAMAAIIGLEHDDVEAVCRDASSFGSCQIANDNGGGQLVISGEKPAVEK 180

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           AA     KGAKRA+ LPVSAPFHS+LMTP ++ M+  L +V K+DPVVP++ N  A+PVS
Sbjct: 181 AAALASEKGAKRALMLPVSAPFHSALMTPAAEAMRKALATVEKRDPVVPVVANVLAAPVS 240

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
              EI+RLLVEQVTG+VRWRET++WFA H V ++YE+GSGKVLTGLA+RIDK+++ ++++
Sbjct: 241 DAGEIARLLVEQVTGQVRWRETVEWFAAHEVTTLYEIGSGKVLTGLARRIDKTVTGIAVN 300

Query: 301 KVEDIDLAL 309
              DID AL
Sbjct: 301 SPADIDAAL 309


>gi|307300965|ref|ZP_07580734.1| malonyl CoA-acyl carrier protein transacylase [Sinorhizobium
           meliloti BL225C]
 gi|306903920|gb|EFN34506.1| malonyl CoA-acyl carrier protein transacylase [Sinorhizobium
           meliloti BL225C]
          Length = 314

 Score =  402 bits (1032), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 190/309 (61%), Positives = 241/309 (77%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           MS   TFPGQGSQ +GMG+DL ++FPEA  VF EVD  L++ LSD++WNG +E LT T N
Sbjct: 1   MSIAFTFPGQGSQAVGMGKDLAEAFPEAAAVFAEVDDALSEKLSDIIWNGPEETLTLTAN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
           AQPAL AVSMA IRV+E  GL +K  +S+VAGHSLGEY+ALCAA  FSL+DT RL+R RG
Sbjct: 61  AQPALMAVSMAVIRVLEAKGLDLKSKVSFVAGHSLGEYSALCAAGTFSLADTARLLRIRG 120

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
            +MQ AVP G G+M AIIGL+   V+++C  AS  G C+IANDNGGGQ+VISG + AV+ 
Sbjct: 121 NAMQAAVPVGKGAMAAIIGLEHDDVEAVCRDASSFGSCQIANDNGGGQLVISGEKPAVEK 180

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           AA     KGAKRA+ LPVSAPFHS+LMTP ++ M+  L +V K+DPVVP++ N  A+PVS
Sbjct: 181 AAALASEKGAKRALMLPVSAPFHSALMTPAAEAMRKALATVEKRDPVVPVVANVLAAPVS 240

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
              EI+RLLVEQVTG+VRWRET++WFA H V ++YE+GSGKVLTGLA+RIDK+++ ++++
Sbjct: 241 DAGEIARLLVEQVTGQVRWRETVEWFAAHEVTTLYEIGSGKVLTGLARRIDKTVTGIAVN 300

Query: 301 KVEDIDLAL 309
              DID AL
Sbjct: 301 SPADIDAAL 309


>gi|209548659|ref|YP_002280576.1| malonyl CoA-acyl carrier protein transacylase [Rhizobium
           leguminosarum bv. trifolii WSM2304]
 gi|209534415|gb|ACI54350.1| malonyl CoA-acyl carrier protein transacylase [Rhizobium
           leguminosarum bv. trifolii WSM2304]
          Length = 314

 Score =  398 bits (1023), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 183/313 (58%), Positives = 243/313 (77%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M+   TFPGQGSQ +GMG+DL ++F EAR VF+EVD  L + LSD+M+NG +E LT T N
Sbjct: 1   MTIAFTFPGQGSQAVGMGKDLAENFAEARAVFDEVDEALGEKLSDVMFNGPEETLTLTAN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
           AQPAL AVS+A +R++E  GL +K  ++YVAGHSLGEY+ALCAA  FSL+DT RL+R RG
Sbjct: 61  AQPALMAVSIAVVRILEAKGLDLKSKVAYVAGHSLGEYSALCAAGTFSLADTARLLRIRG 120

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
            +MQ AVP G+G+M AIIGL+   V ++C +A+  G C+IANDNGGGQ+VISG + AV+ 
Sbjct: 121 NAMQAAVPVGVGAMAAIIGLEHADVVAVCEEAAATGACQIANDNGGGQIVISGEKAAVEK 180

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           AA    +KGAKRA+ LPVSAPFHS LM P +  M+  L  V K DPVVP++ N  A+PV+
Sbjct: 181 AAGLATDKGAKRAILLPVSAPFHSKLMAPAADAMREALAKVAKSDPVVPVIANVRAAPVT 240

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
           + DEI+ LLVEQVTG+VRWRET++WFA +GV ++YE+GSGKVLTGLA+RIDK+++ +S++
Sbjct: 241 TADEIASLLVEQVTGQVRWRETVEWFAGNGVTTLYELGSGKVLTGLARRIDKTINGISVN 300

Query: 301 KVEDIDLALRSIV 313
              DID A+ +++
Sbjct: 301 GPADIDAAVAALM 313


>gi|222085441|ref|YP_002543971.1| malonyl CoA-acyl carrier protein transacylase [Agrobacterium
           radiobacter K84]
 gi|221722889|gb|ACM26045.1| malonyl CoA-acyl carrier protein transacylase [Agrobacterium
           radiobacter K84]
          Length = 313

 Score =  396 bits (1018), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 183/313 (58%), Positives = 243/313 (77%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M+   TFPGQGSQ +GMG+DL D+F EAR VFEEVD  L + LSD+++NG +++LT T N
Sbjct: 1   MTVAFTFPGQGSQTVGMGKDLADNFAEARAVFEEVDEALGEKLSDVIFNGPEDKLTLTAN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
           AQPAL AVS+A IRV++  GL +K  ++YVAGHSLGEY+ALCAA  FSL+DT RL+R RG
Sbjct: 61  AQPALMAVSIAVIRVLQARGLDLKSKVAYVAGHSLGEYSALCAAGTFSLADTARLLRIRG 120

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
            +MQ AVP G+G+M AIIGL+   V ++C +AS +G C+IANDNGGGQ+VISG +  V+ 
Sbjct: 121 NAMQAAVPVGVGAMAAIIGLEHADVVAVCTEASVLGACQIANDNGGGQIVISGEKAPVEK 180

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           AA+    KGAKRA+ LPVSAPFHSSLM P ++ M+  L  V K +P+VP++ N  A+PV+
Sbjct: 181 AAELATAKGAKRAILLPVSAPFHSSLMAPAAEAMRVALADVAKSNPIVPLIANVRAAPVT 240

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
              EI+ LLVEQVTG+VRWRET++WFA H V ++YE+G+GKVLTGLA+RIDKS++ ++++
Sbjct: 241 DAGEIANLLVEQVTGQVRWRETVEWFAAHNVTTLYEIGAGKVLTGLARRIDKSVNGIAVN 300

Query: 301 KVEDIDLALRSIV 313
              DID AL S++
Sbjct: 301 SAADIDTALASLL 313


>gi|227821463|ref|YP_002825433.1| malonyl-CoA:acyl carrier protein transacylase [Sinorhizobium fredii
           NGR234]
 gi|227340462|gb|ACP24680.1| malonyl-CoA:acyl carrier protein transacylase [Sinorhizobium fredii
           NGR234]
          Length = 314

 Score =  393 bits (1010), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 186/306 (60%), Positives = 236/306 (77%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           MS   TFPGQGSQ +GMG+DL ++FPEA  VF EVD  L + LSD +WNG +E LT T N
Sbjct: 1   MSIAFTFPGQGSQAVGMGKDLAEAFPEAAAVFAEVDDALGEKLSDTIWNGPEETLTLTAN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
           AQPAL AVS+A IRV+E  GL +   +S+VAGHSLGEY+ALCAA  FSL+DT RL+R RG
Sbjct: 61  AQPALMAVSIAVIRVLEARGLDLGSKVSFVAGHSLGEYSALCAAGTFSLADTARLLRIRG 120

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
            +MQ AVP G G+M AIIGL+   V+++C +AS +G C+IANDNGGGQ+VISG + AV+ 
Sbjct: 121 NAMQAAVPVGKGAMAAIIGLEHDDVEAVCREASSLGACQIANDNGGGQLVISGEKQAVEK 180

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           AA     KGAKRA+ LPVSAPFHSSLM P ++ M+  L  V K+DPVVP++ N  A+PVS
Sbjct: 181 AAALATEKGAKRALMLPVSAPFHSSLMAPAAEAMREALAQVEKRDPVVPVVANVLAAPVS 240

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
              EI+RLLVEQVTG+VRWRET+QWFA + V ++YE+GSGKVLTGLA+RIDK+++ ++++
Sbjct: 241 DAGEIARLLVEQVTGQVRWRETVQWFAGNDVTTLYEIGSGKVLTGLARRIDKTVNGIAVN 300

Query: 301 KVEDID 306
              DID
Sbjct: 301 TPADID 306


>gi|325292473|ref|YP_004278337.1| malonyl-CoA:acyl carrier protein transacylase [Agrobacterium sp.
           H13-3]
 gi|325060326|gb|ADY64017.1| malonyl-CoA:acyl carrier protein transacylase [Agrobacterium sp.
           H13-3]
          Length = 314

 Score =  392 bits (1007), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 187/314 (59%), Positives = 242/314 (77%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M    TFPGQGSQ IGMG++L D++PEAR VF+EVD  L Q LSD+MWNG +E LT T N
Sbjct: 1   MGIAFTFPGQGSQAIGMGKELADTYPEARAVFQEVDDALGQKLSDIMWNGPEETLTLTAN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
           AQPAL AVSMA +RV+E  GL +   +SYVAGHSLGEY+ALCAA  FS++DT RL+R RG
Sbjct: 61  AQPALMAVSMAVMRVLEARGLKLSDAVSYVAGHSLGEYSALCAAGTFSIADTARLLRIRG 120

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
            +MQ AVP G G+M AIIGL+   V +IC +A+ +G+C+IANDNGGGQ+VISG + AV+ 
Sbjct: 121 NAMQAAVPVGEGAMAAIIGLEHDAVSAICEEAAILGVCQIANDNGGGQLVISGGKAAVEK 180

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           AA     KGAKRA+ LPVSAPFHS+LM P ++ M+  L +V K +PVVP++ N  A+PVS
Sbjct: 181 AAAIASEKGAKRAIMLPVSAPFHSALMAPAAEAMREALAAVEKNNPVVPVIANVRAAPVS 240

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
             +EI+ LLVEQVTG+VRWRET++WFA + V  +YE+GSGKVLTGLA+RIDK+++ V+++
Sbjct: 241 DANEIAALLVEQVTGQVRWRETVEWFAANNVTQLYEIGSGKVLTGLARRIDKTVNGVAVN 300

Query: 301 KVEDIDLALRSIVG 314
              DID  L +++G
Sbjct: 301 GAADIDQLLATLIG 314


>gi|150395968|ref|YP_001326435.1| malonyl CoA-acyl carrier protein transacylase [Sinorhizobium
           medicae WSM419]
 gi|150027483|gb|ABR59600.1| malonyl CoA-acyl carrier protein transacylase [Sinorhizobium
           medicae WSM419]
          Length = 314

 Score =  392 bits (1006), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 186/309 (60%), Positives = 236/309 (76%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           MS   TFPGQGSQ +GMG+DL ++FPEA  VF EVD  L + LS +MW+G +E LT T N
Sbjct: 1   MSIAFTFPGQGSQAVGMGKDLAEAFPEAAAVFAEVDEALGEKLSHIMWDGPEETLTLTAN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
           AQPAL AVSMA IRV+E  GL +   +S+VAGHSLGEY+ALCAA  FSL+DT RL+R RG
Sbjct: 61  AQPALMAVSMAVIRVLESRGLDIGSKVSFVAGHSLGEYSALCAAGTFSLADTARLLRIRG 120

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
            +MQ AVP G G+M AIIGL+   V++IC ++S +G C+IANDNGGGQ+VISG + AV+ 
Sbjct: 121 NAMQAAVPVGKGAMAAIIGLEHADVEAICRESSSLGSCQIANDNGGGQLVISGEKPAVEK 180

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           AA     KGAKRA+ LPVSAPFHS+LMTP ++ M+  L +V K DPVVP++ N  A+PV 
Sbjct: 181 AAALATEKGAKRALMLPVSAPFHSALMTPAAEAMREALATVGKHDPVVPVVANVLAAPVR 240

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
              EI+RLLVEQVTG VRWRET++WFA + V ++YE+GSGKVLTGLA+RIDKS++ ++++
Sbjct: 241 DAVEIARLLVEQVTGPVRWRETVEWFAANDVTTLYEIGSGKVLTGLARRIDKSVTGIAVN 300

Query: 301 KVEDIDLAL 309
              DID  L
Sbjct: 301 SPADIDAVL 309


>gi|116251323|ref|YP_767161.1| malonyl CoA-acyl carrier protein transacylase [Rhizobium
           leguminosarum bv. viciae 3841]
 gi|115255971|emb|CAK07052.1| putative malonyl CoA-acyl carrier protein transacylase [Rhizobium
           leguminosarum bv. viciae 3841]
          Length = 314

 Score =  391 bits (1004), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 186/313 (59%), Positives = 243/313 (77%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M+   TFPGQGSQ +GMG+DL ++F EAR VFEEVD  L + LSD+M+NG ++ LT T N
Sbjct: 1   MTIAFTFPGQGSQAVGMGKDLAENFAEARAVFEEVDEALGEKLSDVMFNGPEDTLTLTAN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
           AQPAL AVS+A IRV+E  GL +K  ++YVAGHSLGEY+ALCAA  FSL+DT RL+R RG
Sbjct: 61  AQPALMAVSIAVIRVLEAKGLDLKSKVAYVAGHSLGEYSALCAAGTFSLADTARLLRIRG 120

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
            +MQ AVP G+G+M AIIGL+   V ++C +AS +G C+IANDNGGGQ+VISG + AV+ 
Sbjct: 121 NAMQAAVPVGVGAMAAIIGLEHADVIAVCEEASVIGACQIANDNGGGQIVISGEKAAVEK 180

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           AA    +KGAKRA+ LPVSAPFHS LM P +  M+  L  V K DPVVP++ N  A+PV+
Sbjct: 181 AAALATDKGAKRAILLPVSAPFHSMLMAPAADAMREALAKVAKSDPVVPVIANVRAAPVT 240

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
             DEI+ LLVEQVTG+VRWRET++WFA +GV ++YE+GSGKVLTGLA+RIDK+++ +S++
Sbjct: 241 GADEIASLLVEQVTGQVRWRETVEWFAGNGVTTLYELGSGKVLTGLARRIDKTINGISVN 300

Query: 301 KVEDIDLALRSIV 313
              DID A+ +++
Sbjct: 301 GPADIDAAVAALM 313


>gi|241203937|ref|YP_002975033.1| malonyl CoA-acyl carrier protein transacylase [Rhizobium
           leguminosarum bv. trifolii WSM1325]
 gi|240857827|gb|ACS55494.1| malonyl CoA-acyl carrier protein transacylase [Rhizobium
           leguminosarum bv. trifolii WSM1325]
          Length = 314

 Score =  390 bits (1003), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 183/313 (58%), Positives = 245/313 (78%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M+   TFPGQGSQ +GMG+DL ++F EAR VF+EVD  L + LSD+M+NG ++ LT T N
Sbjct: 1   MTIAFTFPGQGSQAVGMGKDLAENFAEARAVFQEVDEALGEKLSDVMFNGPEDTLTLTAN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
           AQPAL AVS+A +RV+E  GL +K  ++YVAGHSLGEY+ALCAA  FSL+DT RL+R RG
Sbjct: 61  AQPALMAVSIAVVRVLEAKGLDLKSKVAYVAGHSLGEYSALCAAGTFSLADTARLLRIRG 120

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
            +MQ AVP G+G+M AIIGL+   V ++C  A+ +G C+IANDNGGGQ+VISG + AV+ 
Sbjct: 121 NAMQAAVPVGVGAMAAIIGLEHADVAAVCEAAAAIGACQIANDNGGGQIVISGEKAAVEK 180

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           AA    +KGAKRA+ LPVSAPFHS+LM P ++ M+  L +V K DPVVP++ N  A+PV+
Sbjct: 181 AAGLATDKGAKRAILLPVSAPFHSTLMAPAAEAMREALATVAKSDPVVPVIANVRAAPVT 240

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
             DEI+ LLVEQVTG+VRWRET++WFA +GV ++YE+GSGKVLTGLA+RIDK+++ +S++
Sbjct: 241 GADEIASLLVEQVTGQVRWRETVEWFAGNGVTTLYELGSGKVLTGLARRIDKTINGISVN 300

Query: 301 KVEDIDLALRSIV 313
              DID A+ +++
Sbjct: 301 GPADIDAAVAALM 313


>gi|110634120|ref|YP_674328.1| [Acyl-carrier-protein] S-malonyltransferase [Mesorhizobium sp.
           BNC1]
 gi|110285104|gb|ABG63163.1| [Acyl-carrier-protein] S-malonyltransferase [Chelativorans sp.
           BNC1]
          Length = 313

 Score =  384 bits (986), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 182/313 (58%), Positives = 236/313 (75%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M+   TFPGQGSQ +GMGRDL ++FPEAR VF+EVD  L Q+LS LMW G +EELT T N
Sbjct: 1   MTIAFTFPGQGSQAVGMGRDLAEAFPEARDVFQEVDEALGQSLSKLMWEGPEEELTLTAN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
           AQPAL AVS+A IRVMEK GL +K  ++YVAGHSLGEY+AL AA  FSL DT RL+R RG
Sbjct: 61  AQPALMAVSLAAIRVMEKAGLPLKDKVAYVAGHSLGEYSALAAAGTFSLLDTARLLRIRG 120

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
            +MQ AVP G G+M AIIGL+   V+ +C +A+   +C+IANDNGGGQ++ISG + AV+ 
Sbjct: 121 NAMQAAVPVGEGAMAAIIGLETADVEDVCLKAANGSVCQIANDNGGGQLIISGAKAAVEE 180

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           AA     +GAKRA+ LPVSAPFHS+LM P +  M+  L  V K  P VP++ N   SP+S
Sbjct: 181 AARLAGERGAKRAIMLPVSAPFHSALMEPAAVRMRDALAEVEKHAPSVPVIANVTVSPLS 240

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
              EI+  LVEQVTGRVRWRET++WFA +GV ++YE+GSGKVLTGLA+RI++ L+A++++
Sbjct: 241 DPQEIAERLVEQVTGRVRWRETVEWFAQNGVDTLYEIGSGKVLTGLARRINRDLNALAVN 300

Query: 301 KVEDIDLALRSIV 313
              DI+  L++++
Sbjct: 301 TPADIEATLKALL 313


>gi|86357080|ref|YP_468972.1| [acyl-carrier protein] S-malonyltransferase protein [Rhizobium etli
           CFN 42]
 gi|86281182|gb|ABC90245.1| [acyl-carrier protein] S-malonyltransferase protein [Rhizobium etli
           CFN 42]
          Length = 316

 Score =  383 bits (984), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 183/313 (58%), Positives = 242/313 (77%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M+   TFPGQGSQ +GMG+DL ++F EAR V EEVD  L + LSD+M+NG ++ LT T N
Sbjct: 3   MTIAFTFPGQGSQAVGMGKDLAENFAEARAVLEEVDEALGEKLSDVMFNGPEDTLTLTAN 62

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
           AQPAL AVS+A IRV++  GL +K  ++YVAGHSLGEY+ALCAA  FSL+DT RL+R RG
Sbjct: 63  AQPALMAVSIAVIRVLQAKGLDLKSKVAYVAGHSLGEYSALCAAGTFSLADTARLLRIRG 122

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
            +MQ AVP G+G+M AIIGL+   V ++C +A+  G C+IANDNGGGQ+VISG + AV+ 
Sbjct: 123 NAMQAAVPVGVGAMAAIIGLEHADVVAVCEEAAATGACQIANDNGGGQIVISGEKAAVEK 182

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           AA    ++GAKRA+ LPVSAPFHS LM P ++ M+  L +V K DPVVP++ N  A+PVS
Sbjct: 183 AAGLATDRGAKRAILLPVSAPFHSKLMAPAAEAMRAALATVAKSDPVVPLIANVRAAPVS 242

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
             DEI+ LLVEQVTG+VRWRET++WFA +GV ++YE+GSGKVLTGLA+RIDK+++ +S+ 
Sbjct: 243 GADEIASLLVEQVTGQVRWRETVEWFAGNGVTTLYELGSGKVLTGLARRIDKTVNGISVG 302

Query: 301 KVEDIDLALRSIV 313
              DID A+ +++
Sbjct: 303 GPADIDAAVAALM 315


>gi|260466961|ref|ZP_05813143.1| malonyl CoA-acyl carrier protein transacylase [Mesorhizobium
           opportunistum WSM2075]
 gi|259029258|gb|EEW30552.1| malonyl CoA-acyl carrier protein transacylase [Mesorhizobium
           opportunistum WSM2075]
          Length = 312

 Score =  382 bits (981), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 176/312 (56%), Positives = 232/312 (74%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M+   TFPGQGSQ +GMG+DL DSFPEAR VF+EVD  L +NLS L+W G +E LT T N
Sbjct: 1   MAVAFTFPGQGSQAVGMGKDLADSFPEARRVFQEVDDALGENLSKLIWEGPEEALTLTAN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
           AQPAL AVS+A IR +E  G  +K  ++YVAGHSLGEY+AL AA   S+ D  RL+R RG
Sbjct: 61  AQPALMAVSLAAIRALESRGFSLKDKVAYVAGHSLGEYSALAAAGFVSVGDAARLLRIRG 120

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
            +MQ AVPPG G+M AIIGL+   V++ CA+A++  +C++ANDNGGGQ+VISG + AV+ 
Sbjct: 121 NAMQAAVPPGEGAMAAIIGLEQADVEAACAEAAKGSVCQVANDNGGGQLVISGAKAAVEL 180

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           AA  C+ KGAKRA+ L VSAPFHS+LMTP +++M+  L  V K  PVVPI+ N   +P S
Sbjct: 181 AARLCIEKGAKRALMLQVSAPFHSALMTPAAEIMRDALAEVAKAAPVVPIVSNVTVTPTS 240

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
             DEISR LVEQV  RVRWRET++WF  +GV ++YE+G+GKVL+GLA+RI++ ++  S+ 
Sbjct: 241 DPDEISRRLVEQVVARVRWRETVEWFGANGVTALYEIGAGKVLSGLARRINRDIATASVG 300

Query: 301 KVEDIDLALRSI 312
              D++ AL ++
Sbjct: 301 AAVDVEAALAAL 312


>gi|190891124|ref|YP_001977666.1| [acyl-carrier-protein] S-malonyltransferase [Rhizobium etli CIAT
           652]
 gi|190696403|gb|ACE90488.1| [acyl-carrier-protein] S-malonyltransferase protein [Rhizobium etli
           CIAT 652]
          Length = 314

 Score =  380 bits (977), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 182/306 (59%), Positives = 237/306 (77%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M+   TFPGQGSQ +GMG+DL ++F EAR VFEEVD  L + LSD+M+NG ++ LT T N
Sbjct: 1   MTIAFTFPGQGSQAVGMGKDLAENFAEARAVFEEVDEALGEKLSDVMFNGPEDTLTLTAN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
           AQPAL AVS+A +RV++  GL +K  ++YVAGHSLGEY+ALCAA  FSL+DT RL+R RG
Sbjct: 61  AQPALMAVSIAVVRVLQAKGLDLKAKVAYVAGHSLGEYSALCAAGTFSLADTARLLRIRG 120

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
            +MQ AVP G+G+M AIIGL+   V +IC +A+  G C+IANDNGGGQ+VISG + AV+ 
Sbjct: 121 NAMQAAVPVGVGAMAAIIGLEHADVVAICEEAAATGACQIANDNGGGQIVISGEKAAVEK 180

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           AA    +KGAKRA+ LPVSAPFHS LM P ++ M+  L +V K DPVVP++ N  A+PV+
Sbjct: 181 AAGLATDKGAKRAILLPVSAPFHSKLMAPAAEAMRAALATVAKSDPVVPLIANVRAAPVT 240

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
              EI+ LLVEQVTG+VRWRET++WFA +GV ++YE+GSGKVLTGLA+RIDK+++ +S+ 
Sbjct: 241 DAGEIATLLVEQVTGQVRWRETVEWFAGNGVTTLYELGSGKVLTGLARRIDKTVNGISVG 300

Query: 301 KVEDID 306
              DID
Sbjct: 301 GPADID 306


>gi|218671380|ref|ZP_03521050.1| [acyl-carrier-protein] S-malonyltransferase protein [Rhizobium etli
           GR56]
          Length = 314

 Score =  379 bits (974), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 180/313 (57%), Positives = 243/313 (77%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M+   TFPGQGSQ +GMG+DL ++F EAR VFEEVD  L + LSD+M++G ++ LT T N
Sbjct: 1   MTIAFTFPGQGSQAVGMGKDLAENFAEARAVFEEVDEALGEKLSDVMFSGPEDTLTLTAN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
           AQPAL AVS+A +RV++  GL +K  +++VAGHSLGEY+ALCAA  FSL+DT RL+R RG
Sbjct: 61  AQPALMAVSIAVVRVLQAKGLDLKSKVAFVAGHSLGEYSALCAAGTFSLADTARLLRIRG 120

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
            +MQ AVP G+G+M AIIGL+   V ++C +A+  G C+IANDNGGGQ+VISG + AV+ 
Sbjct: 121 NAMQAAVPVGVGAMAAIIGLEHADVIAVCEEAAVTGACQIANDNGGGQIVISGEKAAVEK 180

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           AA    +KGAKRA+ LPVSAPFHS LM P ++ M+  L +V K DP+VP++ N  A+PV+
Sbjct: 181 AAGLATDKGAKRAILLPVSAPFHSKLMAPAAEAMRAALATVAKSDPLVPLIANVRAAPVT 240

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
             DEI+ LLVEQVTG+VRWRET++WFA +GV ++YE+GSGKVLTGLA+RIDK+++ +S+ 
Sbjct: 241 DADEIANLLVEQVTGQVRWRETVEWFAGNGVTTLYELGSGKVLTGLARRIDKTVNGISVG 300

Query: 301 KVEDIDLALRSIV 313
              DID A+ +++
Sbjct: 301 GPADIDAAVAALM 313


>gi|15888434|ref|NP_354115.1| malonyl-CoA:acyl carrier protein transacylase [Agrobacterium
           tumefaciens str. C58]
 gi|15156124|gb|AAK86900.1| malonyl-CoA:acyl carrier protein transacylase [Agrobacterium
           tumefaciens str. C58]
          Length = 331

 Score =  379 bits (974), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 186/314 (59%), Positives = 241/314 (76%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M    TFPGQGSQ +GMG++L D++PEAR VF+EVD  L+Q LSD+MWNG +E LT T N
Sbjct: 18  MGIAFTFPGQGSQAVGMGKELADTYPEARAVFQEVDDALDQKLSDIMWNGPEETLTLTAN 77

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
           AQPAL AVSMA +RV+E  GL +   +SYVAGHSLGEY+ALCAA  FS++DT RL+R RG
Sbjct: 78  AQPALMAVSMAVMRVLEARGLKLSDTVSYVAGHSLGEYSALCAAGTFSIADTARLLRIRG 137

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
            +MQ AVP G G+M AIIGL+   V +IC +A  +G+C+IANDNGGGQ+VISG + AV+ 
Sbjct: 138 NAMQAAVPVGEGAMAAIIGLEHDAVSAICEEAGILGVCQIANDNGGGQLVISGSKTAVEK 197

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           AA     KGAKRA+ LPVSAPFHS+LM P ++ M+  L  V K +PVVP++ N  A+PVS
Sbjct: 198 AAAIASEKGAKRAIMLPVSAPFHSALMAPAAEAMREALAKVEKHNPVVPVVANVRAAPVS 257

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
             +EI+ LLVEQVTG+VRWRET++WFA + V  +YE+GSGKVLTGLA+RIDK+++ V+++
Sbjct: 258 DANEIAALLVEQVTGQVRWRETVEWFAANNVTQLYEIGSGKVLTGLARRIDKTVNGVAVN 317

Query: 301 KVEDIDLALRSIVG 314
              DID  L +++G
Sbjct: 318 GAADIDQLLATLIG 331


>gi|153007915|ref|YP_001369130.1| malonyl CoA-acyl carrier protein transacylase [Ochrobactrum
           anthropi ATCC 49188]
 gi|151559803|gb|ABS13301.1| malonyl CoA-acyl carrier protein transacylase [Ochrobactrum
           anthropi ATCC 49188]
          Length = 314

 Score =  379 bits (972), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 178/309 (57%), Positives = 231/309 (74%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M+   TFPGQGSQ +GMG+ L + F EAR VF+EVD  L + LS  M+ G ++ LT T N
Sbjct: 1   MAVAFTFPGQGSQAVGMGKALAEQFAEARAVFDEVDAALGEKLSATMFEGPEDVLTLTAN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
           AQPAL AVSMA +RVME  G  +K  +SYVAGHSLGEY+ALCAA+ FSL+DT RL+R RG
Sbjct: 61  AQPALMAVSMAVLRVMEARGFSLKDRVSYVAGHSLGEYSALCAARTFSLADTARLLRIRG 120

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
            +MQ+AVP G G+M AIIGL+   V+++C +A   G  +IANDNGGGQ+VISG + AV+ 
Sbjct: 121 NAMQKAVPAGEGAMAAIIGLEHGDVEAVCTEAKASGSVQIANDNGGGQLVISGSKAAVEL 180

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           AA     KGAKRA+ LPVSAPFHS+LM P  + M+  L SV K +P+VP++ N  A+PV+
Sbjct: 181 AARLASEKGAKRAIMLPVSAPFHSTLMGPAGEAMREALASVEKHNPIVPLIANVRAAPVT 240

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
             +EI+ LLVEQVTG+VRWRET++WFA +GV ++YEVGSGKVLTGLA+RI K ++  ++ 
Sbjct: 241 DANEIADLLVEQVTGQVRWRETVEWFAANGVTTLYEVGSGKVLTGLARRISKDVTGAAVG 300

Query: 301 KVEDIDLAL 309
             E+I+ AL
Sbjct: 301 SAEEIEAAL 309


>gi|222148140|ref|YP_002549097.1| malonyl CoA-acyl carrier protein transacylase [Agrobacterium vitis
           S4]
 gi|221735128|gb|ACM36091.1| malonyl CoA-acyl carrier protein transacylase [Agrobacterium vitis
           S4]
          Length = 314

 Score =  378 bits (970), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 181/313 (57%), Positives = 235/313 (75%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M    TFPGQGSQV+GMG+DL ++FPEAR VFEEVD  L + LSD+MWNGS E+LT T N
Sbjct: 1   MGVAFTFPGQGSQVVGMGKDLAEAFPEARTVFEEVDDALGEKLSDVMWNGSVEDLTLTAN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
           AQPAL AVS+A +RVME  G  + R +SYVAGHSLGEY+ALCAA  FSL+DT RL+R RG
Sbjct: 61  AQPALMAVSIAVLRVMEARGFSLARKVSYVAGHSLGEYSALCAAGTFSLADTARLLRIRG 120

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
            +MQ AVP G G+M AI+GL+   V+ +C  AS  G  +IANDNGGGQ+VISG + AV+ 
Sbjct: 121 NAMQAAVPVGAGAMAAILGLEHGDVEKVCKAASSDGPVQIANDNGGGQLVISGAKAAVEK 180

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A+   + KGAKRA+ LPVSAPFHS+LM P +  M   L +V  + PVVP++ N  A PVS
Sbjct: 181 ASVLAMEKGAKRAIMLPVSAPFHSTLMGPAADAMAQALATVEMKAPVVPLIANVVAVPVS 240

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
             +EI RLLVEQVTG+VRWRET++WF+++ V  +YE+G+GKVL+GL +RIDK+++  ++ 
Sbjct: 241 DPNEIRRLLVEQVTGQVRWRETVEWFSHNAVSVLYEIGAGKVLSGLVRRIDKNITGTAVG 300

Query: 301 KVEDIDLALRSIV 313
              DI+ AL +++
Sbjct: 301 SPADIEAALTALM 313


>gi|319784435|ref|YP_004143911.1| malonyl CoA-acyl carrier protein transacylase [Mesorhizobium ciceri
           biovar biserrulae WSM1271]
 gi|317170323|gb|ADV13861.1| malonyl CoA-acyl carrier protein transacylase [Mesorhizobium ciceri
           biovar biserrulae WSM1271]
          Length = 313

 Score =  377 bits (967), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 172/312 (55%), Positives = 230/312 (73%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M+   TFPGQGSQ +GMG+DL ++FPEAR +F+EVD  L +NLS L+W G +E L  T N
Sbjct: 1   MAVAFTFPGQGSQAVGMGKDLAEAFPEARRIFQEVDDALGENLSKLIWEGPEETLMLTAN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
           AQPAL AVS+A IR +E  G  +K  ++YVAGHSLGEY+AL AA   S++D  RL+R RG
Sbjct: 61  AQPALMAVSLAAIRALESRGFSLKGKVAYVAGHSLGEYSALAAAGFVSVADAARLLRIRG 120

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
            +MQ AVP G G+M AIIGL+   V++ CA+A++  +C+IANDNGGGQ+VISG + AV+ 
Sbjct: 121 NAMQAAVPAGEGAMAAIIGLEQADVEAACAEAAKGSVCQIANDNGGGQLVISGARAAVEL 180

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           AA  C  KGAKRA+ L VSAPFHS+LM P + VM+  L  VTK  PVVP+L N   SP S
Sbjct: 181 AAKLCTEKGAKRALMLQVSAPFHSALMAPAANVMRDALAGVTKNAPVVPVLSNVTVSPTS 240

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
             DEI+R LVEQ+TGRVRWRET++WF  +GV ++YE+G+GKVL+GLA+RI++ ++  S+ 
Sbjct: 241 DPDEIARRLVEQITGRVRWRETVEWFGANGVTTLYEIGAGKVLSGLARRINRDIATASVG 300

Query: 301 KVEDIDLALRSI 312
              +++  L ++
Sbjct: 301 SAAEVEATLAAL 312


>gi|327188003|gb|EGE55233.1| [acyl-carrier-protein] S-malonyltransferase protein [Rhizobium etli
           CNPAF512]
          Length = 314

 Score =  373 bits (957), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 182/306 (59%), Positives = 238/306 (77%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M+   TFPGQGSQ +GMG+DL ++F EAR VFEEVD  L + LSD+M+NG ++ LT T N
Sbjct: 1   MTIAFTFPGQGSQAVGMGKDLAENFAEARAVFEEVDEALGEKLSDVMFNGPEDTLTLTAN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
           AQPAL AVS+A +RV++  GL +K  ++YVAGHSLGEY+ALCAA  FSL+DT RL+R RG
Sbjct: 61  AQPALMAVSIAVVRVLQAKGLDLKAKVAYVAGHSLGEYSALCAAGTFSLADTARLLRIRG 120

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
            +MQ AVP G+G+M AIIGL+   V ++C +A+  G C+IANDNGGGQ+VISG + AV+ 
Sbjct: 121 NAMQAAVPVGVGAMAAIIGLEHADVAAVCEEAAATGACQIANDNGGGQIVISGEKAAVEK 180

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           AA    +KGAKRA+ LPVSAPFHS LM P ++ M+  L +V K DPVVP++ N  A+PV+
Sbjct: 181 AAGLATDKGAKRAILLPVSAPFHSKLMAPAAEAMRAALATVAKSDPVVPLIANVRAAPVT 240

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
             DEI+ LLVEQVTG+VRWRET++WFA +GV ++YE+GSGKVLTGLA+RIDK+++ +S+ 
Sbjct: 241 DADEIATLLVEQVTGQVRWRETVEWFAGNGVTTLYELGSGKVLTGLARRIDKTVNGISVG 300

Query: 301 KVEDID 306
              DID
Sbjct: 301 GPADID 306


>gi|239831326|ref|ZP_04679655.1| malonyl CoA-acyl carrier protein transacylase [Ochrobactrum
           intermedium LMG 3301]
 gi|239823593|gb|EEQ95161.1| malonyl CoA-acyl carrier protein transacylase [Ochrobactrum
           intermedium LMG 3301]
          Length = 325

 Score =  372 bits (956), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 176/299 (58%), Positives = 225/299 (75%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M+   TFPGQGSQ +GMG+ L + F EAR VFEEVD  L + LS  M+ G ++ LT T N
Sbjct: 12  MAVAFTFPGQGSQAVGMGKALAEQFAEARAVFEEVDAALGEKLSATMFEGPEDVLTLTAN 71

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
           AQPAL AVSMA +RVME  G  +K  +SYVAGHSLGEY+ALCAA  FSL+DT RL+R RG
Sbjct: 72  AQPALMAVSMAVLRVMEARGFSLKDKVSYVAGHSLGEYSALCAAGTFSLADTARLLRIRG 131

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
            +MQ+AVP G G+M AIIGL+   V+++CA+A   G  +IANDNGGGQ+VISG + AV+ 
Sbjct: 132 NAMQKAVPVGEGAMAAIIGLEHGDVEAVCAEAKSSGSVQIANDNGGGQLVISGSKAAVEL 191

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           AA     KGAKRA+ LPVSAPFHS+LM P +  M+  L SV K +P+VP++ N  A+P +
Sbjct: 192 AAGLASEKGAKRAIMLPVSAPFHSTLMGPAADAMREALASVEKHNPIVPLIANVRAAPAT 251

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
             +EI+ LLVEQVTG+VRWRET++WFA +GV ++YEVGSGKVLTGLA+RI K ++ V++
Sbjct: 252 DANEIADLLVEQVTGQVRWRETVEWFATNGVTTLYEVGSGKVLTGLARRISKDVAGVAV 310


>gi|13476513|ref|NP_108083.1| acyl-carrier-protein S-malonyltransferase [Mesorhizobium loti
           MAFF303099]
 gi|14027274|dbj|BAB54228.1| malonyl CoA-acyl carrier protein transacylase [Mesorhizobium loti
           MAFF303099]
          Length = 315

 Score =  368 bits (944), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 172/314 (54%), Positives = 229/314 (72%), Gaps = 2/314 (0%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M+   TFPGQGSQ +GMG+DL D+FPEAR VF+EVD  L +NLS L+W G +E LT T N
Sbjct: 1   MAVAFTFPGQGSQAVGMGKDLADAFPEARRVFQEVDDALGENLSKLIWEGPEETLTLTAN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
           AQPAL AVS+A IR +E  G  +K  ++YVAGHSLGEY+AL AA   S++D  RL+R RG
Sbjct: 61  AQPALMAVSLAAIRALEARGFSLKDKVAYVAGHSLGEYSALAAAGFVSVADAARLLRIRG 120

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVG--ICEIANDNGGGQVVISGLQDAV 178
            +MQ AVP G G+M AIIGL+   V++ C +A++    +C+IANDNGGGQ+VISG + AV
Sbjct: 121 NAMQAAVPAGEGAMAAIIGLEQPDVEAACIEAAQGASKVCQIANDNGGGQLVISGAKAAV 180

Query: 179 KCAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASP 238
           + AA  C  KGAKRA+ L VSAPFHS+LM P + VM+  L  VTK  P VP++ N   +P
Sbjct: 181 ELAAKLCTEKGAKRALMLQVSAPFHSALMAPAANVMREALAGVTKHAPGVPVVSNVTVTP 240

Query: 239 VSSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVS 298
            S  DEI+R LVEQ+TGRVRWRET++WF  +GV ++YE+G+GKVL+GLA+RI++ ++  +
Sbjct: 241 TSDPDEIARRLVEQITGRVRWRETVEWFGANGVTTLYEIGAGKVLSGLARRINRDIATSA 300

Query: 299 ISKVEDIDLALRSI 312
           +    D++ AL + 
Sbjct: 301 VGTPADVEAALATF 314


>gi|49475328|ref|YP_033369.1| acyl-carrier-protein S-malonyltransferase [Bartonella henselae str.
           Houston-1]
 gi|49238134|emb|CAF27342.1| Malonyl CoA-acyl carrier protein transacylase [Bartonella henselae
           str. Houston-1]
          Length = 314

 Score =  368 bits (944), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 177/310 (57%), Positives = 228/310 (73%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M    TFPGQGSQ+IGMG+ L + F  AR+VFEEVD  L++ LSD+++ G  + LT T N
Sbjct: 1   MGAAFTFPGQGSQLIGMGKVLTEQFVAARMVFEEVDDALSEKLSDIIFEGPADVLTLTAN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
           AQPAL AVSMA IRVME+ GL V++ + +VAGHSLGEY+ALCAA  FSL+DT RL+R RG
Sbjct: 61  AQPALMAVSMAVIRVMEQLGLNVEKKVKFVAGHSLGEYSALCAAGTFSLTDTARLLRIRG 120

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
            +MQ AV  G GSM A+IGLD+  V+ IC   +  G+C+IANDNGGGQ+VISG   AV+ 
Sbjct: 121 NAMQAAVAVGEGSMAALIGLDEKDVEEICEIVAEEGLCQIANDNGGGQIVISGEAKAVET 180

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A +    KGAKRAV LPVSAPFHS+LM P +  MK  L +V K  P+VP++ N    P S
Sbjct: 181 AVEVASQKGAKRAVLLPVSAPFHSALMQPAANAMKNALLTVNKTAPIVPLIANVSVIPES 240

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
             + I  LLV+QVTGRVRWRETI+W + +GV +++E+GSGKVLTGLA+RI+K + A+++ 
Sbjct: 241 DPERIVSLLVQQVTGRVRWRETIEWISANGVNTLFEIGSGKVLTGLARRINKDIKALTVG 300

Query: 301 KVEDIDLALR 310
             E+I+ ALR
Sbjct: 301 TAEEIEAALR 310


>gi|320089963|pdb|3QAT|A Chain A, Crystal Structure Of
           Acyl-Carrier-Protein-S-Malonyltransferase From
           Bartonella Henselae
 gi|320089964|pdb|3QAT|B Chain B, Crystal Structure Of
           Acyl-Carrier-Protein-S-Malonyltransferase From
           Bartonella Henselae
          Length = 318

 Score =  367 bits (943), Expect = 1e-99,   Method: Compositional matrix adjust.
 Identities = 177/310 (57%), Positives = 228/310 (73%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M    TFPGQGSQ+IGMG+ L + F  AR+VFEEVD  L++ LSD+++ G  + LT T N
Sbjct: 5   MGAAFTFPGQGSQLIGMGKVLTEQFVAARMVFEEVDDALSEKLSDIIFEGPADVLTLTAN 64

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
           AQPAL AVSMA IRVME+ GL V++ + +VAGHSLGEY+ALCAA  FSL+DT RL+R RG
Sbjct: 65  AQPALMAVSMAVIRVMEQLGLNVEKKVKFVAGHSLGEYSALCAAGTFSLTDTARLLRIRG 124

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
            +MQ AV  G GSM A+IGLD+  V+ IC   +  G+C+IANDNGGGQ+VISG   AV+ 
Sbjct: 125 NAMQAAVAVGEGSMAALIGLDEKDVEEICEIVAEEGLCQIANDNGGGQIVISGEAKAVET 184

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A +    KGAKRAV LPVSAPFHS+LM P +  MK  L +V K  P+VP++ N    P S
Sbjct: 185 AVEVASQKGAKRAVLLPVSAPFHSALMQPAANAMKNALLTVNKTAPIVPLIANVSVIPES 244

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
             + I  LLV+QVTGRVRWRETI+W + +GV +++E+GSGKVLTGLA+RI+K + A+++ 
Sbjct: 245 DPERIVSLLVQQVTGRVRWRETIEWISANGVNTLFEIGSGKVLTGLARRINKDIKALTVG 304

Query: 301 KVEDIDLALR 310
             E+I+ ALR
Sbjct: 305 TAEEIEAALR 314


>gi|254718632|ref|ZP_05180443.1| malonyl CoA-acyl carrier protein transacylase [Brucella sp. 83/13]
 gi|265983611|ref|ZP_06096346.1| malonyl CoA-acyl carrier protein transacylase [Brucella sp. 83/13]
 gi|306839848|ref|ZP_07472646.1| malonyl CoA-acyl carrier protein transacylase [Brucella sp. NF
           2653]
 gi|264662203|gb|EEZ32464.1| malonyl CoA-acyl carrier protein transacylase [Brucella sp. 83/13]
 gi|306405034|gb|EFM61315.1| malonyl CoA-acyl carrier protein transacylase [Brucella sp. NF
           2653]
          Length = 314

 Score =  367 bits (941), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 175/299 (58%), Positives = 223/299 (74%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M+   TFPGQGSQ +GMG+ L + F EAR VF+EVD  L + LS  M+ G ++ LT T N
Sbjct: 1   MAVAFTFPGQGSQTVGMGKALAEQFAEARAVFDEVDEALGEKLSATMFEGPEDVLTLTAN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
           AQPAL AVSMA  R+ME  G  +K  +SYVAGHSLGEY+ALCAA  FSL+DT RL+R RG
Sbjct: 61  AQPALMAVSMAVQRIMEARGFSLKDKVSYVAGHSLGEYSALCAAGTFSLADTARLLRIRG 120

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
            +MQ+AVP G G+M AIIGL+   V+++C +A   G  +IANDNGGGQ+VISG + AV+ 
Sbjct: 121 NAMQKAVPVGEGAMAAIIGLEHGDVEAVCMEAKASGPVQIANDNGGGQLVISGAKAAVEL 180

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           AA     KGAKRA+ LPVSAPFHS+LM P +  M+  L +V KQDPVVP++ N  A+PV+
Sbjct: 181 AAKLGSEKGAKRAIMLPVSAPFHSTLMAPAADAMREALAAVEKQDPVVPLIANVRAAPVT 240

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
             +EI+ LLVEQVTG+VRWRETI+WF+ +GV ++YEVG GKVLTGLA+RI K +S  ++
Sbjct: 241 DANEIATLLVEQVTGQVRWRETIEWFSANGVTTLYEVGCGKVLTGLARRISKDVSGAAV 299


>gi|306845086|ref|ZP_07477666.1| malonyl CoA-acyl carrier protein transacylase [Brucella sp. BO1]
 gi|306274501|gb|EFM56296.1| malonyl CoA-acyl carrier protein transacylase [Brucella sp. BO1]
          Length = 314

 Score =  366 bits (939), Expect = 3e-99,   Method: Compositional matrix adjust.
 Identities = 175/299 (58%), Positives = 222/299 (74%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M+   TFPGQGSQ +GMG+ L + F EAR VF+EVD  L + LS  M+ G ++ LT T N
Sbjct: 1   MAVAFTFPGQGSQAVGMGKALAEQFAEARAVFDEVDEALGEKLSATMFEGPEDVLTLTAN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
           AQPAL AVSMA  R+ME  G  +K  +SYVAGHSLGEY+ALCAA  FSL+DT RL+R RG
Sbjct: 61  AQPALMAVSMAVQRIMEARGFSLKDKVSYVAGHSLGEYSALCAAGTFSLADTARLLRIRG 120

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
            +MQ+AVP G G+M AIIGL+   V+++C +A   G  +IANDNGGGQ+VISG + AV+ 
Sbjct: 121 NAMQKAVPVGEGAMAAIIGLEHGDVEAVCMEAKASGPVQIANDNGGGQLVISGAKAAVEL 180

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           AA     KGAKRA+ LPVSAPFHS+LM P +  M+  L +V KQDPVVP++ N  A+PV+
Sbjct: 181 AAKLGSEKGAKRAIMLPVSAPFHSTLMAPAADAMREALAAVEKQDPVVPLIANVRAAPVT 240

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
              EI+ LLVEQVTG+VRWRETI+WF+ +GV ++YEVG GKVLTGLA+RI K +S  ++
Sbjct: 241 DASEIAALLVEQVTGQVRWRETIEWFSANGVTTLYEVGCGKVLTGLARRISKDVSGAAV 299


>gi|23501358|ref|NP_697485.1| acyl-carrier-protein S-malonyltransferase [Brucella suis 1330]
 gi|23347251|gb|AAN29400.1| malonyl CoA-acyl carrier protein transacylase [Brucella suis 1330]
          Length = 314

 Score =  364 bits (935), Expect = 8e-99,   Method: Compositional matrix adjust.
 Identities = 174/299 (58%), Positives = 222/299 (74%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M+   TFPGQGSQ +GMG+ L + F EAR VF+EVD  L + LS  M+ G ++ LT T N
Sbjct: 1   MAVAFTFPGQGSQAVGMGKALAEQFAEARAVFDEVDEALGEKLSATMFEGPEDVLTLTAN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
           AQPAL AVSMA  R+ME  G  +K  +SYVAGHSLGEY+ALCAA  FSL+DT RL+R RG
Sbjct: 61  AQPALMAVSMAVQRIMEARGFSLKDKVSYVAGHSLGEYSALCAAGTFSLADTARLLRIRG 120

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
            +MQ+AVP G G+M AIIGL+   V+++C +A   G  +IANDNGGGQ+VISG + AV+ 
Sbjct: 121 NAMQKAVPVGEGAMAAIIGLEHGDVEAVCMEAKASGPVQIANDNGGGQLVISGARAAVEL 180

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           AA     KGAKRA+ LPVSAPFHS+LM P +  M+  L +V K DPVVP++ N  A+PV+
Sbjct: 181 AAKLGSEKGAKRAIMLPVSAPFHSTLMAPAADAMREALAAVEKHDPVVPLIANVRAAPVT 240

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
             +EI+ LLVEQVTG+VRWRETI+WF+ +GV ++YEVG GKVLTGLA+RI K +S  ++
Sbjct: 241 DANEIAALLVEQVTGQVRWRETIEWFSANGVTTLYEVGCGKVLTGLARRISKDVSGATV 299


>gi|148558951|ref|YP_001258475.1| malonyl CoA-acyl carrier protein transacylase [Brucella ovis ATCC
           25840]
 gi|161618428|ref|YP_001592315.1| malonyl CoA-acyl carrier protein transacylase [Brucella canis ATCC
           23365]
 gi|163842737|ref|YP_001627141.1| malonyl CoA-acyl carrier protein transacylase [Brucella suis ATCC
           23445]
 gi|225851993|ref|YP_002732226.1| malonyl CoA-acyl carrier protein transacylase [Brucella melitensis
           ATCC 23457]
 gi|254701260|ref|ZP_05163088.1| malonyl CoA-acyl carrier protein transacylase [Brucella suis bv. 5
           str. 513]
 gi|254707815|ref|ZP_05169643.1| malonyl CoA-acyl carrier protein transacylase [Brucella
           pinnipedialis M163/99/10]
 gi|254709603|ref|ZP_05171414.1| malonyl CoA-acyl carrier protein transacylase [Brucella
           pinnipedialis B2/94]
 gi|254712981|ref|ZP_05174792.1| malonyl CoA-acyl carrier protein transacylase [Brucella ceti
           M644/93/1]
 gi|254716665|ref|ZP_05178476.1| malonyl CoA-acyl carrier protein transacylase [Brucella ceti
           M13/05/1]
 gi|256031095|ref|ZP_05444709.1| malonyl CoA-acyl carrier protein transacylase [Brucella
           pinnipedialis M292/94/1]
 gi|256112980|ref|ZP_05453883.1| malonyl CoA-acyl carrier protein transacylase [Brucella melitensis
           bv. 3 str. Ether]
 gi|256159168|ref|ZP_05456981.1| malonyl CoA-acyl carrier protein transacylase [Brucella ceti
           M490/95/1]
 gi|256254498|ref|ZP_05460034.1| malonyl CoA-acyl carrier protein transacylase [Brucella ceti B1/94]
 gi|256264501|ref|ZP_05467033.1| acyl transferase domain-containing protein [Brucella melitensis bv.
           2 str. 63/9]
 gi|260566940|ref|ZP_05837410.1| acyl transferase domain-containing protein [Brucella suis bv. 4
           str. 40]
 gi|261218466|ref|ZP_05932747.1| malonyl CoA-acyl carrier protein transacylase [Brucella ceti
           M13/05/1]
 gi|261221673|ref|ZP_05935954.1| malonyl CoA-acyl carrier protein transacylase [Brucella ceti B1/94]
 gi|261315301|ref|ZP_05954498.1| malonyl CoA-acyl carrier protein transacylase [Brucella
           pinnipedialis M163/99/10]
 gi|261317131|ref|ZP_05956328.1| malonyl CoA-acyl carrier protein transacylase [Brucella
           pinnipedialis B2/94]
 gi|261320684|ref|ZP_05959881.1| malonyl CoA-acyl carrier protein transacylase [Brucella ceti
           M644/93/1]
 gi|261751799|ref|ZP_05995508.1| malonyl CoA-acyl carrier protein transacylase [Brucella suis bv. 5
           str. 513]
 gi|265988170|ref|ZP_06100727.1| malonyl CoA-acyl carrier protein transacylase [Brucella
           pinnipedialis M292/94/1]
 gi|265994416|ref|ZP_06106973.1| malonyl CoA-acyl carrier protein transacylase [Brucella melitensis
           bv. 3 str. Ether]
 gi|265997636|ref|ZP_06110193.1| malonyl CoA-acyl carrier protein transacylase [Brucella ceti
           M490/95/1]
 gi|306842258|ref|ZP_07474921.1| malonyl CoA-acyl carrier protein transacylase [Brucella sp. BO2]
 gi|148370208|gb|ABQ60187.1| malonyl CoA-acyl carrier protein transacylase [Brucella ovis ATCC
           25840]
 gi|161335239|gb|ABX61544.1| malonyl CoA-acyl carrier protein transacylase [Brucella canis ATCC
           23365]
 gi|163673460|gb|ABY37571.1| malonyl CoA-acyl carrier protein transacylase [Brucella suis ATCC
           23445]
 gi|225640358|gb|ACO00272.1| malonyl CoA-acyl carrier protein transacylase [Brucella melitensis
           ATCC 23457]
 gi|260156458|gb|EEW91538.1| acyl transferase domain-containing protein [Brucella suis bv. 4
           str. 40]
 gi|260920257|gb|EEX86910.1| malonyl CoA-acyl carrier protein transacylase [Brucella ceti B1/94]
 gi|260923555|gb|EEX90123.1| malonyl CoA-acyl carrier protein transacylase [Brucella ceti
           M13/05/1]
 gi|261293374|gb|EEX96870.1| malonyl CoA-acyl carrier protein transacylase [Brucella ceti
           M644/93/1]
 gi|261296354|gb|EEX99850.1| malonyl CoA-acyl carrier protein transacylase [Brucella
           pinnipedialis B2/94]
 gi|261304327|gb|EEY07824.1| malonyl CoA-acyl carrier protein transacylase [Brucella
           pinnipedialis M163/99/10]
 gi|261741552|gb|EEY29478.1| malonyl CoA-acyl carrier protein transacylase [Brucella suis bv. 5
           str. 513]
 gi|262552104|gb|EEZ08094.1| malonyl CoA-acyl carrier protein transacylase [Brucella ceti
           M490/95/1]
 gi|262765529|gb|EEZ11318.1| malonyl CoA-acyl carrier protein transacylase [Brucella melitensis
           bv. 3 str. Ether]
 gi|263094833|gb|EEZ18571.1| acyl transferase domain-containing protein [Brucella melitensis bv.
           2 str. 63/9]
 gi|264660367|gb|EEZ30628.1| malonyl CoA-acyl carrier protein transacylase [Brucella
           pinnipedialis M292/94/1]
 gi|306287638|gb|EFM59085.1| malonyl CoA-acyl carrier protein transacylase [Brucella sp. BO2]
          Length = 314

 Score =  364 bits (935), Expect = 8e-99,   Method: Compositional matrix adjust.
 Identities = 174/299 (58%), Positives = 222/299 (74%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M+   TFPGQGSQ +GMG+ L + F EAR VF+EVD  L + LS  M+ G ++ LT T N
Sbjct: 1   MAVAFTFPGQGSQAVGMGKALAEQFAEARAVFDEVDEALGEKLSATMFEGPEDVLTLTAN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
           AQPAL AVSMA  R+ME  G  +K  +SYVAGHSLGEY+ALCAA  FSL+DT RL+R RG
Sbjct: 61  AQPALMAVSMAVQRIMEARGFSLKDKVSYVAGHSLGEYSALCAAGTFSLADTARLLRIRG 120

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
            +MQ+AVP G G+M AIIGL+   V+++C +A   G  +IANDNGGGQ+VISG + AV+ 
Sbjct: 121 NAMQKAVPVGEGAMAAIIGLEHGDVEAVCMEAKASGPVQIANDNGGGQLVISGARAAVEL 180

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           AA     KGAKRA+ LPVSAPFHS+LM P +  M+  L +V K DPVVP++ N  A+PV+
Sbjct: 181 AAKLGSEKGAKRAIMLPVSAPFHSTLMAPAADAMREALAAVEKHDPVVPLIANVRAAPVT 240

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
             +EI+ LLVEQVTG+VRWRETI+WF+ +GV ++YEVG GKVLTGLA+RI K +S  ++
Sbjct: 241 DANEIAALLVEQVTGQVRWRETIEWFSANGVTTLYEVGCGKVLTGLARRISKDVSGAAV 299


>gi|240850221|ref|YP_002971614.1| malonyl CoA-acyl carrier protein transacylase FabD [Bartonella
           grahamii as4aup]
 gi|240267344|gb|ACS50932.1| malonyl CoA-acyl carrier protein transacylase FabD [Bartonella
           grahamii as4aup]
          Length = 314

 Score =  364 bits (935), Expect = 9e-99,   Method: Compositional matrix adjust.
 Identities = 173/309 (55%), Positives = 226/309 (73%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M     FPGQGSQ++GMG+ L + F  AR+VFEEVD  L + LS +++ G  + LT T N
Sbjct: 1   MGAAFIFPGQGSQLVGMGKALTEQFIAARMVFEEVDDALGEKLSKIIFEGPADVLTLTAN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
           AQPAL AVSMA IRVM++ GLC++  + +VAGHSLGEY+ALCAA  F+L+DT RL+R RG
Sbjct: 61  AQPALMAVSMAVIRVMQQLGLCIEEKVKFVAGHSLGEYSALCAAGTFTLTDTARLLRIRG 120

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
            +MQ AV  G GSM A+IGL++ +V+ IC   S  G+C+IANDNGGGQ+VISG   AV+ 
Sbjct: 121 NAMQAAVAVGEGSMAALIGLEEHIVEEICETVSGEGLCQIANDNGGGQIVISGKAKAVET 180

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A +    KGAKRA+ LPVSAPFHSSLM P +  MK  L +V K  P+VP++ N   +P S
Sbjct: 181 AVEIASTKGAKRALLLPVSAPFHSSLMQPAADAMKKALLTVNKMPPIVPLIANVSVAPES 240

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
           + + I+  LVEQVTGRVRWRETI+W A +GV +++EVGSGKVLTGL +RI+K +  V+I 
Sbjct: 241 NPERITTFLVEQVTGRVRWRETIEWIAANGVDTLFEVGSGKVLTGLTRRINKDIKGVTIG 300

Query: 301 KVEDIDLAL 309
            V++I+ AL
Sbjct: 301 TVDEIESAL 309


>gi|256368910|ref|YP_003106416.1| acyl-carrier-protein S-malonyltransferase [Brucella microti CCM
           4915]
 gi|255999068|gb|ACU47467.1| acyl-carrier-protein S-malonyltransferase [Brucella microti CCM
           4915]
          Length = 314

 Score =  364 bits (934), Expect = 1e-98,   Method: Compositional matrix adjust.
 Identities = 174/299 (58%), Positives = 222/299 (74%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M+   TFPGQGSQ +GMG+ L + F EAR VF+EVD  L + LS  M+ G ++ LT T N
Sbjct: 1   MAVAFTFPGQGSQAVGMGKALAEQFAEARAVFDEVDEALGEKLSATMFEGPEDVLTLTAN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
           AQPAL AVSMA  R+ME  G  +K  +SYVAGHSLGEY+ALCAA  FSL+DT RL+R RG
Sbjct: 61  AQPALMAVSMAVQRIMEARGFSLKDKVSYVAGHSLGEYSALCAAGTFSLADTARLLRIRG 120

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
            +MQ+AVP G G+M AIIGL+   V+++C +A   G  +IANDNGGGQ+VISG + AV+ 
Sbjct: 121 NAMQKAVPVGEGAMAAIIGLEHGDVEAVCMEAKASGPVQIANDNGGGQLVISGARAAVEL 180

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           AA     KGAKRA+ LPVSAPFHS+LM P +  M+  L +V K DPVVP++ N  A+PV+
Sbjct: 181 AAKLGSEKGAKRAIMLPVSAPFHSTLMAPAADAMREALAAVEKHDPVVPLIANARAAPVT 240

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
             +EI+ LLVEQVTG+VRWRETI+WF+ +GV ++YEVG GKVLTGLA+RI K +S  ++
Sbjct: 241 DANEIAALLVEQVTGQVRWRETIEWFSANGVTTLYEVGCGKVLTGLARRISKDVSGAAV 299


>gi|225626964|ref|ZP_03785003.1| malonyl CoA-acyl carrier protein transacylase [Brucella ceti str.
           Cudo]
 gi|260168226|ref|ZP_05755037.1| malonyl CoA-acyl carrier protein transacylase [Brucella sp. F5/99]
 gi|261757688|ref|ZP_06001397.1| acyl transferase domain-containing protein [Brucella sp. F5/99]
 gi|225618621|gb|EEH15664.1| malonyl CoA-acyl carrier protein transacylase [Brucella ceti str.
           Cudo]
 gi|261737672|gb|EEY25668.1| acyl transferase domain-containing protein [Brucella sp. F5/99]
          Length = 314

 Score =  363 bits (933), Expect = 1e-98,   Method: Compositional matrix adjust.
 Identities = 174/299 (58%), Positives = 221/299 (73%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M+   TFPGQGSQ +GMG+ L + F EAR VF+EVD  L + LS  M+ G ++ LT T N
Sbjct: 1   MAVAFTFPGQGSQAVGMGKALAEQFAEARAVFDEVDEALGEKLSATMFEGPEDVLTLTAN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
           AQPAL AVSMA  R+ME  G  +K  +SYVAGHSLGEY+ALCAA  FSL+DT RL+R RG
Sbjct: 61  AQPALMAVSMAVQRIMEARGFSLKDKVSYVAGHSLGEYSALCAAGTFSLADTARLLRIRG 120

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
            +MQ AVP G G+M AIIGL+   V+++C +A   G  +IANDNGGGQ+VISG + AV+ 
Sbjct: 121 NAMQTAVPVGEGAMAAIIGLEHGDVEAVCMEAKASGPVQIANDNGGGQLVISGARAAVEL 180

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           AA     KGAKRA+ LPVSAPFHS+LM P +  M+  L +V K DPVVP++ N  A+PV+
Sbjct: 181 AAKLGSEKGAKRAIMLPVSAPFHSTLMAPAADAMREALAAVEKHDPVVPLIANVRAAPVT 240

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
             +EI+ LLVEQVTG+VRWRETI+WF+ +GV ++YEVG GKVLTGLA+RI K +S  ++
Sbjct: 241 DANEIAALLVEQVTGQVRWRETIEWFSANGVTTLYEVGCGKVLTGLARRISKDVSGAAV 299


>gi|256060589|ref|ZP_05450757.1| malonyl CoA-acyl carrier protein transacylase [Brucella neotomae
           5K33]
 gi|261324586|ref|ZP_05963783.1| malonyl CoA-acyl carrier protein transacylase [Brucella neotomae
           5K33]
 gi|261300566|gb|EEY04063.1| malonyl CoA-acyl carrier protein transacylase [Brucella neotomae
           5K33]
          Length = 314

 Score =  363 bits (931), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 174/299 (58%), Positives = 221/299 (73%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M+   TFPGQGSQ +GMG+ L + F EAR VF+EVD  L + LS  M+ G ++ LT T N
Sbjct: 1   MAVAFTFPGQGSQAVGMGKALAEQFAEARAVFDEVDEALGEKLSATMFEGPEDVLTLTAN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
           AQPAL AVSMA  R+ME  G  +K  +SYVAGHSLGEY+ALCAA  FSL+DT RL+R RG
Sbjct: 61  AQPALMAVSMAVQRIMEARGFSLKDKVSYVAGHSLGEYSALCAAGTFSLADTARLLRIRG 120

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
             MQ+AVP G G+M AIIGL+   V+++C +A   G  +IANDNGGGQ+VISG + AV+ 
Sbjct: 121 NVMQKAVPVGEGAMAAIIGLEHGDVEAVCMEAKASGPVQIANDNGGGQLVISGARAAVEL 180

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           AA     KGAKRA+ LPVSAPFHS+LM P +  M+  L +V K DPVVP++ N  A+PV+
Sbjct: 181 AAKLGSEKGAKRAIMLPVSAPFHSTLMAPAADAMREALAAVEKHDPVVPLIANVRAAPVT 240

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
             +EI+ LLVEQVTG+VRWRETI+WF+ +GV ++YEVG GKVLTGLA+RI K +S  ++
Sbjct: 241 DANEIAALLVEQVTGQVRWRETIEWFSANGVTTLYEVGCGKVLTGLARRISKDVSGAAV 299


>gi|62289442|ref|YP_221235.1| acyl-carrier-protein S-malonyltransferase [Brucella abortus bv. 1
           str. 9-941]
 gi|82699368|ref|YP_413942.1| malonyl CoA-acyl carrier protein transacylase [Brucella melitensis
           biovar Abortus 2308]
 gi|189023691|ref|YP_001934459.1| acyl transferase [Brucella abortus S19]
 gi|237814929|ref|ZP_04593927.1| malonyl CoA-acyl carrier protein transacylase [Brucella abortus
           str. 2308 A]
 gi|254688753|ref|ZP_05152007.1| malonyl CoA-acyl carrier protein transacylase [Brucella abortus bv.
           6 str. 870]
 gi|254693236|ref|ZP_05155064.1| malonyl CoA-acyl carrier protein transacylase [Brucella abortus bv.
           3 str. Tulya]
 gi|254696882|ref|ZP_05158710.1| malonyl CoA-acyl carrier protein transacylase [Brucella abortus bv.
           2 str. 86/8/59]
 gi|254729786|ref|ZP_05188364.1| malonyl CoA-acyl carrier protein transacylase [Brucella abortus bv.
           4 str. 292]
 gi|256257000|ref|ZP_05462536.1| malonyl CoA-acyl carrier protein transacylase [Brucella abortus bv.
           9 str. C68]
 gi|260545808|ref|ZP_05821549.1| acyl transferase domain-containing protein [Brucella abortus NCTC
           8038]
 gi|260754233|ref|ZP_05866581.1| malonyl CoA-acyl carrier protein transacylase [Brucella abortus bv.
           6 str. 870]
 gi|260757453|ref|ZP_05869801.1| malonyl CoA-acyl carrier protein transacylase [Brucella abortus bv.
           4 str. 292]
 gi|260761278|ref|ZP_05873621.1| malonyl CoA-acyl carrier protein transacylase [Brucella abortus bv.
           2 str. 86/8/59]
 gi|260883259|ref|ZP_05894873.1| malonyl CoA-acyl carrier protein transacylase [Brucella abortus bv.
           9 str. C68]
 gi|261213480|ref|ZP_05927761.1| malonyl CoA-acyl carrier protein transacylase [Brucella abortus bv.
           3 str. Tulya]
 gi|297247854|ref|ZP_06931572.1| malonyl CoA-acyl carrier protein transacylase [Brucella abortus bv.
           5 str. B3196]
 gi|62195574|gb|AAX73874.1| FabD, malonyl CoA-acyl carrier protein transacylase [Brucella
           abortus bv. 1 str. 9-941]
 gi|82615469|emb|CAJ10438.1| Acyl transferase domain:Malonyl CoA-acyl carrier protein
           transacylase [Brucella melitensis biovar Abortus 2308]
 gi|189019263|gb|ACD71985.1| Acyl transferase domain protein [Brucella abortus S19]
 gi|237789766|gb|EEP63976.1| malonyl CoA-acyl carrier protein transacylase [Brucella abortus
           str. 2308 A]
 gi|260097215|gb|EEW81090.1| acyl transferase domain-containing protein [Brucella abortus NCTC
           8038]
 gi|260667771|gb|EEX54711.1| malonyl CoA-acyl carrier protein transacylase [Brucella abortus bv.
           4 str. 292]
 gi|260671710|gb|EEX58531.1| malonyl CoA-acyl carrier protein transacylase [Brucella abortus bv.
           2 str. 86/8/59]
 gi|260674341|gb|EEX61162.1| malonyl CoA-acyl carrier protein transacylase [Brucella abortus bv.
           6 str. 870]
 gi|260872787|gb|EEX79856.1| malonyl CoA-acyl carrier protein transacylase [Brucella abortus bv.
           9 str. C68]
 gi|260915087|gb|EEX81948.1| malonyl CoA-acyl carrier protein transacylase [Brucella abortus bv.
           3 str. Tulya]
 gi|297175023|gb|EFH34370.1| malonyl CoA-acyl carrier protein transacylase [Brucella abortus bv.
           5 str. B3196]
          Length = 314

 Score =  362 bits (930), Expect = 3e-98,   Method: Compositional matrix adjust.
 Identities = 174/299 (58%), Positives = 221/299 (73%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M+   TFPGQGSQ +GMG+ L + F EAR VF+EVD  L + LS  M+ G ++ LT T N
Sbjct: 1   MAVAFTFPGQGSQAVGMGKALAEQFAEARAVFDEVDEALGEKLSATMFEGPEDVLTLTAN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
           AQPAL AVSMA  R+ME  G  +K  +SYVAGHSLGEY+ALCAA  FSL+DT RL+R RG
Sbjct: 61  AQPALMAVSMAVQRIMEARGFSLKDKVSYVAGHSLGEYSALCAAGTFSLADTARLLRIRG 120

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
            +MQ+AVP G G+M AIIGL+   V+++C +A   G  +IANDNGGGQ+VISG + AV+ 
Sbjct: 121 NAMQKAVPVGEGAMAAIIGLEHGDVEAVCMEAKASGPVQIANDNGGGQLVISGARAAVEL 180

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           AA     KGAKRA+ LPVSAPFHS+LM P +  M   L +V K DPVVP++ N  A+PV+
Sbjct: 181 AAKLGSEKGAKRAIMLPVSAPFHSTLMAPAADAMLEALAAVEKHDPVVPLIANVRAAPVT 240

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
             +EI+ LLVEQVTG+VRWRETI+WF+ +GV ++YEVG GKVLTGLA+RI K +S  ++
Sbjct: 241 DANEIAALLVEQVTGQVRWRETIEWFSANGVTTLYEVGCGKVLTGLARRISKDVSGAAV 299


>gi|17987761|ref|NP_540395.1| acyl-carrier-protein S-malonyltransferase [Brucella melitensis bv.
           1 str. 16M]
 gi|256044172|ref|ZP_05447079.1| acyl-carrier-protein S-malonyltransferase [Brucella melitensis bv.
           1 str. Rev.1]
 gi|260563530|ref|ZP_05834016.1| acyl transferase domain-containing protein [Brucella melitensis bv.
           1 str. 16M]
 gi|265990586|ref|ZP_06103143.1| malonyl CoA-acyl carrier protein transacylase [Brucella melitensis
           bv. 1 str. Rev.1]
 gi|17983483|gb|AAL52659.1| malonyl CoA-acyl carrier protein transacylase [Brucella melitensis
           bv. 1 str. 16M]
 gi|260153546|gb|EEW88638.1| acyl transferase domain-containing protein [Brucella melitensis bv.
           1 str. 16M]
 gi|263001370|gb|EEZ13945.1| malonyl CoA-acyl carrier protein transacylase [Brucella melitensis
           bv. 1 str. Rev.1]
          Length = 314

 Score =  361 bits (927), Expect = 7e-98,   Method: Compositional matrix adjust.
 Identities = 173/299 (57%), Positives = 221/299 (73%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M+   TFPGQGSQ +GMG+ L + F EAR VF+EVD  L + LS  M+ G ++ LT T N
Sbjct: 1   MAVAFTFPGQGSQAVGMGKALAEQFAEARAVFDEVDEALGEKLSATMFEGPEDVLTLTAN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
           AQPAL AVSMA  R+ME  G  +K  +SYVAGHSLGEY+ALCAA  FSL+DT RL+R RG
Sbjct: 61  AQPALMAVSMAVQRIMEARGFSLKDKVSYVAGHSLGEYSALCAAGTFSLADTARLLRIRG 120

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
            +MQ+AVP G G+M AIIGL+   V+++C +A   G  +IANDNGGGQ+VISG + AV+ 
Sbjct: 121 NAMQKAVPVGEGAMAAIIGLEHGDVEAVCMEAKASGPVQIANDNGGGQLVISGARAAVEL 180

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           AA     KGAKRA+ LPVSAPFHS+LM P +  M+  L +V K D VVP++ N  A+PV+
Sbjct: 181 AAKLGSEKGAKRAIMLPVSAPFHSTLMAPAADAMREALAAVEKHDSVVPLIANVRAAPVT 240

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
             +EI+ LLVEQVTG+VRWRETI+WF+ +GV ++YEVG GKVLTGLA+RI K +S  ++
Sbjct: 241 DANEIAALLVEQVTGQVRWRETIEWFSANGVTTLYEVGCGKVLTGLARRISKDVSGAAV 299


>gi|121601676|ref|YP_988811.1| malonyl CoA-acyl carrier protein transacylase [Bartonella
           bacilliformis KC583]
 gi|120613853|gb|ABM44454.1| malonyl CoA-acyl carrier protein transacylase [Bartonella
           bacilliformis KC583]
          Length = 314

 Score =  360 bits (925), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 174/310 (56%), Positives = 222/310 (71%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M    TFPGQGSQV+GMG+ L + F EAR+VFEEVD  L + LS +++ G ++ LT T N
Sbjct: 1   MVAAFTFPGQGSQVVGMGKMLTEQFVEARMVFEEVDDALGEKLSHIIFEGPEDLLTLTAN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
           AQPAL AVS+A IRVMEK GL ++  + +VAGHSLGEY+ALCAA  FSL+DT RL+R RG
Sbjct: 61  AQPALMAVSLAIIRVMEKLGLNIESKVKFVAGHSLGEYSALCAANTFSLADTARLLRIRG 120

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
            +MQEAV  G G M A+IGL++  V+ IC    + GIC+IANDNGGGQ+VISG   AV+ 
Sbjct: 121 NAMQEAVAVGEGLMAALIGLNEQEVEEICKAVVKEGICQIANDNGGGQIVISGEAKAVQA 180

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A      KGAKRA+ LPVSAPFHSSLM P +  MK  L  V    PV+P++ N   +P +
Sbjct: 181 AVKIASEKGAKRAILLPVSAPFHSSLMQPAADAMKDALRIVNLAAPVIPLIANVSVAPEN 240

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
             + I  LLV QVTG+VRWRETI+WF  HGV  ++E+GSGKVLTGLA+RI+K +  ++I 
Sbjct: 241 DPERILTLLVHQVTGQVRWRETIEWFGAHGVDMLFEIGSGKVLTGLARRINKDIKGLTIG 300

Query: 301 KVEDIDLALR 310
             E+I+ AL+
Sbjct: 301 TAEEIEEALK 310


>gi|319408309|emb|CBI81962.1| malonyl CoA-acyl carrier protein transacylase [Bartonella
           schoenbuchensis R1]
          Length = 314

 Score =  360 bits (924), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 173/310 (55%), Positives = 226/310 (72%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M    TFPGQGSQV+GMG+ L + F EAR+VFEEVD  L + LS +++ G ++ L  T N
Sbjct: 1   MVAAFTFPGQGSQVVGMGKVLAEQFVEARMVFEEVDDALGEKLSHIIFEGPEDVLALTAN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
           AQPAL AVS+A IRVMEK GL ++  + +VAGHSLGEY+ALCA +  SL+DT RL+R RG
Sbjct: 61  AQPALMAVSLAIIRVMEKLGLDIESKVKFVAGHSLGEYSALCAVRTLSLADTARLLRIRG 120

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
            +MQ AV  G G M A+IGLD+  V+ IC+     G+C+IANDNGGGQ+VISG   AV+ 
Sbjct: 121 NAMQRAVAVGEGLMAALIGLDEQDVEEICSAVLGEGLCQIANDNGGGQIVISGEAKAVEA 180

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A    L KGAKRA+ LPVSAPFHS+LM P + VMK  L +V K  P++P++ N   +P S
Sbjct: 181 AMKAALEKGAKRALLLPVSAPFHSALMQPAADVMKDALLAVNKVAPIIPVVANISVAPES 240

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
             + I  LLVEQVTGRVRWRET++WF ++GV +++EVGSGKVLTGLA+RI+K +  ++I 
Sbjct: 241 DPERIFMLLVEQVTGRVRWRETVEWFGSNGVDTLFEVGSGKVLTGLARRINKDIKGLTIG 300

Query: 301 KVEDIDLALR 310
             E+I+ AL+
Sbjct: 301 TAEEIESALQ 310


>gi|254703807|ref|ZP_05165635.1| malonyl CoA-acyl carrier protein transacylase [Brucella suis bv. 3
           str. 686]
 gi|261754455|ref|ZP_05998164.1| malonyl CoA-acyl carrier protein transacylase [Brucella suis bv. 3
           str. 686]
 gi|261744208|gb|EEY32134.1| malonyl CoA-acyl carrier protein transacylase [Brucella suis bv. 3
           str. 686]
          Length = 314

 Score =  360 bits (923), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 173/299 (57%), Positives = 221/299 (73%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M+   TFPGQGSQ +GMG+ L + F EAR VF+EVD  L + LS  M+ G ++ LT T N
Sbjct: 1   MAVAFTFPGQGSQAVGMGKALAEQFAEARAVFDEVDEALGEKLSATMFEGPEDVLTLTAN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
           AQPAL AVSMA  R+ME  G  +K  +SYVAGHSLGEY+ALCAA  FSL+DT RL+  RG
Sbjct: 61  AQPALMAVSMAVQRIMEARGFSLKDKVSYVAGHSLGEYSALCAAGTFSLADTARLLCIRG 120

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
            +MQ+AVP G G+M AIIGL+   V+++C +A   G  +IANDNGGGQ+VISG + AV+ 
Sbjct: 121 NAMQKAVPVGEGAMAAIIGLEHGDVEAVCMEAKASGPVQIANDNGGGQLVISGARAAVEL 180

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           AA     KGAKRA+ LPVSAPFHS+LM P +  M+  L +V K DPVVP++ N  A+PV+
Sbjct: 181 AAKLGSEKGAKRAIMLPVSAPFHSTLMAPAADAMREALAAVEKHDPVVPLIANVRAAPVT 240

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
             +EI+ LLVEQVTG+VRWRETI+WF+ +GV ++YEVG GKVLTGLA+RI K +S  ++
Sbjct: 241 DANEIAALLVEQVTGQVRWRETIEWFSANGVTTLYEVGCGKVLTGLARRISKDVSGAAV 299


>gi|49474090|ref|YP_032132.1| acyl-carrier-protein S-malonyltransferase [Bartonella quintana str.
           Toulouse]
 gi|49239594|emb|CAF25951.1| Malonyl CoA-acyl carrier protein transacylase [Bartonella quintana
           str. Toulouse]
          Length = 314

 Score =  357 bits (915), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 174/310 (56%), Positives = 222/310 (71%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M    TFPGQGSQ+IGMG+ L + F  AR+VFEEVD  L + LSD+++ G  + LT T N
Sbjct: 1   MVAAFTFPGQGSQLIGMGKALTEQFVAARMVFEEVDDALGEKLSDIIFEGPADVLTLTAN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
           AQPAL AVS+A IRVME+ GL ++  + +VAGHSLGEY+ALCA   FSL+DT RL+R RG
Sbjct: 61  AQPALMAVSIAVIRVMEQLGLNIETKVKFVAGHSLGEYSALCAVGTFSLTDTARLLRIRG 120

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
            +MQ AV  G GSM A+IGLD+  V+ IC   S  GIC+IANDNGGGQ+VISG   AV+ 
Sbjct: 121 NAMQAAVAIGEGSMAALIGLDEKDVEKICQTVSGEGICQIANDNGGGQIVISGKTKAVEK 180

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A +    KGAKRA+ LPVSAPFHS LM P +  MK  L +V K  P+VP++ N   +P S
Sbjct: 181 AIEVASKKGAKRALLLPVSAPFHSDLMQPAAVAMKNALLTVNKTAPIVPLVANVSVTPES 240

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
             + I  LLV QVTGRVRWRETI+W   +GV +++EVGSGKVLTGLA+RI+K +  +++ 
Sbjct: 241 DPERIVALLVHQVTGRVRWRETIEWIGANGVDTLFEVGSGKVLTGLARRINKDIKGLTVG 300

Query: 301 KVEDIDLALR 310
             E+I+ AL+
Sbjct: 301 TAEEIEAALK 310


>gi|163868017|ref|YP_001609221.1| malonyl CoA-acyl carrier protein transacylase [Bartonella
           tribocorum CIP 105476]
 gi|161017668|emb|CAK01226.1| malonyl CoA-acyl carrier protein transacylase [Bartonella
           tribocorum CIP 105476]
          Length = 314

 Score =  352 bits (904), Expect = 3e-95,   Method: Compositional matrix adjust.
 Identities = 171/309 (55%), Positives = 221/309 (71%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M     FPGQGSQ++GMGR L + F  AR+VFEEVD  L + LS++++ G  + LT T N
Sbjct: 1   MGAAFIFPGQGSQLVGMGRALTEQFFAARMVFEEVDDALGEKLSEIIFEGPADVLTLTAN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
           AQPAL AVSMA IRVME+ GL ++  + +VAGHSLGEY+ALCAA   SL+DT RL+R RG
Sbjct: 61  AQPALMAVSMAVIRVMEQLGLRIEEKVKFVAGHSLGEYSALCAAGTLSLTDTARLLRIRG 120

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
            +MQ AV  G GSM A+IGL++ VV+ IC   S  G+C+IANDNGG Q+VISG   AV+ 
Sbjct: 121 NAMQAAVAVGEGSMAALIGLEEHVVEEICKIVSGEGLCQIANDNGGRQIVISGEAKAVET 180

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A +    KGAKRA+ LPVSAPFHSSLM P +  MK  L +V K  P+VP++ N    P S
Sbjct: 181 AVEIASTKGAKRALLLPVSAPFHSSLMQPAADAMKKALLTVNKNAPIVPLIANVSVEPES 240

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
             + I+ LL++QVTGRVRWRETI+W   +GV +++EVGSGKVLTGL +RI+K +   +I 
Sbjct: 241 DPERIATLLIQQVTGRVRWRETIEWIGANGVDTLFEVGSGKVLTGLTRRINKDIKGGTIG 300

Query: 301 KVEDIDLAL 309
            V++I+ AL
Sbjct: 301 TVDEIESAL 309


>gi|319898720|ref|YP_004158813.1| malonyl CoA-acyl carrier protein transacylase [Bartonella
           clarridgeiae 73]
 gi|319402684|emb|CBI76230.1| malonyl CoA-acyl carrier protein transacylase [Bartonella
           clarridgeiae 73]
          Length = 314

 Score =  352 bits (903), Expect = 4e-95,   Method: Compositional matrix adjust.
 Identities = 170/310 (54%), Positives = 223/310 (71%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M    TFPGQGSQV+GMG+ L + F EAR+VFEEVD  L + LS +++ G QE LT T N
Sbjct: 1   MVAAFTFPGQGSQVVGMGKVLAEQFVEARMVFEEVDDALGEKLSQIIFEGPQEALTLTAN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
           AQPAL AVSMA IRVMEK GL + + + +VAGHSLGEY+ALC+A  FSL+DT RL+R RG
Sbjct: 61  AQPALMAVSMAIIRVMEKLGLDIAKKVKFVAGHSLGEYSALCSAGTFSLADTARLLRIRG 120

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
            +MQ A+  G GSM AIIGL++  V+ IC      G+C+IANDNGGGQ+VISG   AV+ 
Sbjct: 121 NAMQTAIAVGEGSMAAIIGLNEQDVEEICKLVLGEGLCQIANDNGGGQIVISGEAKAVEA 180

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A      KGAKRA+ L VSAPFHS+LM+P +  MK  L  V K+ P+VP++ N   +P S
Sbjct: 181 AIKIASQKGAKRALLLSVSAPFHSALMSPAADAMKNALRLVNKRAPIVPLIANVSVTPES 240

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
             + I  LL++QVTGRVRWRETI+WF  + +  ++EVG GKVLT L +RI+K++++++I 
Sbjct: 241 DPERIFMLLIQQVTGRVRWRETIEWFGANEIDVLFEVGFGKVLTSLTRRINKNINSLTIG 300

Query: 301 KVEDIDLALR 310
             E+I+ AL+
Sbjct: 301 TAEEIEAALQ 310


>gi|319405482|emb|CBI79101.1| malonyl CoA-acyl carrier protein transacylase [Bartonella sp. AR
           15-3]
          Length = 314

 Score =  350 bits (899), Expect = 1e-94,   Method: Compositional matrix adjust.
 Identities = 172/310 (55%), Positives = 221/310 (71%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M    TFPGQGSQV+GMG+ L + F EAR+VFEEVD TL + LS +++ G +E LT T N
Sbjct: 1   MVAAFTFPGQGSQVVGMGKVLAEQFVEARMVFEEVDDTLGEKLSRIIFEGPEEALTLTAN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
           AQPAL  VS+A IRVMEK G  + + + +VAGHSLGEY+ALCAA  FSL+DT +L+R RG
Sbjct: 61  AQPALMVVSIAIIRVMEKLGFNIAKKVKFVAGHSLGEYSALCAAGTFSLADTAKLLRIRG 120

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
            +MQ AV  G G+M AIIGLD+  V+ IC      G+C+IANDNGGGQ+VISG   AV+ 
Sbjct: 121 NAMQTAVAVGEGAMAAIIGLDERTVEEICKLVLGEGVCQIANDNGGGQIVISGEAKAVQL 180

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A      KGAKRA+ L VSAPFHS LM P +  MK  L +V  + PVVP++ N   +P S
Sbjct: 181 AIKIAPQKGAKRALLLSVSAPFHSVLMAPAADAMKDALRAVKIKAPVVPLIANVSVTPES 240

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
             + I  LLV+QVTGRVRWRETI+WF  +GV  ++EVG  KVLTGL +R++K ++A++I 
Sbjct: 241 DPERILMLLVQQVTGRVRWRETIEWFGANGVDVLFEVGFRKVLTGLTRRVNKDINALTIG 300

Query: 301 KVEDIDLALR 310
            VE+I+ AL+
Sbjct: 301 TVEEIEKALQ 310


>gi|319404045|emb|CBI77633.1| malonyl CoA-acyl carrier protein transacylase [Bartonella
           rochalimae ATCC BAA-1498]
          Length = 314

 Score =  348 bits (894), Expect = 5e-94,   Method: Compositional matrix adjust.
 Identities = 172/310 (55%), Positives = 221/310 (71%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M    TFPGQGSQV+GMG+ L + F EAR+VFEEVD  L + LS +++ G +E LT T N
Sbjct: 1   MVAAFTFPGQGSQVVGMGKVLAEQFIEARMVFEEVDDALGEKLSQIIFEGPEEVLTLTAN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
           AQPAL AVSMA IRVMEK G  + + + +VAGHSLGEY+ALCAA  FSL+DT +L+R RG
Sbjct: 61  AQPALMAVSMAIIRVMEKLGFDIAKKVKFVAGHSLGEYSALCAAGTFSLADTAKLLRIRG 120

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
            +MQ AV  G G+M AIIGL++  V+ IC      G+C+IANDNGGGQ+VISG   AV+ 
Sbjct: 121 NAMQTAVAVGEGAMAAIIGLNEQDVEEICKFVLGEGVCQIANDNGGGQIVISGEAKAVES 180

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A      KGAKR + L VSAPFHS LM+  +  MK  L +V K+ PVVP++ N   +P S
Sbjct: 181 AIKIASQKGAKRTLLLSVSAPFHSVLMSSAADAMKDALRAVNKKAPVVPLVANVSVTPES 240

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
             + I  LLV+QVTGRVRWRETI+WF  + V  ++EVGSGKVLTGLA+RI+K ++ ++I 
Sbjct: 241 DPERIFMLLVQQVTGRVRWRETIEWFGANKVDVLFEVGSGKVLTGLARRINKDINGLTIG 300

Query: 301 KVEDIDLALR 310
             E+I+ AL+
Sbjct: 301 TAEEIESALQ 310


>gi|319407057|emb|CBI80694.1| malonyl CoA-acyl carrier protein transacylase [Bartonella sp. 1-1C]
          Length = 314

 Score =  347 bits (890), Expect = 1e-93,   Method: Compositional matrix adjust.
 Identities = 170/310 (54%), Positives = 221/310 (71%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M    TFPGQGSQV+GMG+ L + F EAR+VFEE+D  L + LS +++ G +E LT T N
Sbjct: 1   MVAAFTFPGQGSQVVGMGKVLAEQFIEARMVFEEIDDALGEKLSQIIFEGPEEALTLTAN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
           AQPAL AVSMA IRVMEK G  + + + +VAGHSLGEY+ALCAA  FSL+DT +L+R RG
Sbjct: 61  AQPALMAVSMAIIRVMEKLGFDIVKKVKFVAGHSLGEYSALCAAGTFSLADTAKLLRIRG 120

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
            +MQ AV  G G+M AIIGL++  V+ IC      G+C+IANDNGGGQ+VISG   AV+ 
Sbjct: 121 NAMQTAVAVGEGAMAAIIGLNEQDVEEICKFVLGKGVCQIANDNGGGQIVISGEARAVES 180

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A      KGAKR + L VSAPFHS LM+  +  MK  L +V K+ P+VP++ N   +P S
Sbjct: 181 AIKIASQKGAKRTLLLSVSAPFHSVLMSSAADAMKDALRAVNKKAPIVPLVANVSVTPES 240

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
             + I  LLV+QVTGRVRWRETI+WF  + V  ++EVGSGKVLTGLA+RI+K ++ ++I 
Sbjct: 241 DPERILMLLVQQVTGRVRWRETIEWFGANKVDVLFEVGSGKVLTGLARRINKDINGLTIG 300

Query: 301 KVEDIDLALR 310
             E+I+ AL+
Sbjct: 301 TAEEIESALQ 310


>gi|326408488|gb|ADZ65553.1| malonyl CoA-acyl carrier protein transacylase [Brucella melitensis
           M28]
 gi|326538204|gb|ADZ86419.1| malonyl CoA-acyl carrier protein transacylase [Brucella melitensis
           M5-90]
          Length = 298

 Score =  340 bits (871), Expect = 2e-91,   Method: Compositional matrix adjust.
 Identities = 164/283 (57%), Positives = 210/283 (74%)

Query: 17  MGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPALTAVSMAFIRVM 76
           MG+ L + F EAR VF+EVD  L + LS  M+ G ++ LT T NAQPAL AVSMA  R+M
Sbjct: 1   MGKALAEQFAEARAVFDEVDEALGEKLSATMFEGPEDVLTLTANAQPALMAVSMAVQRIM 60

Query: 77  EKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQEAVPPGLGSMVA 136
           E  G  +K  +SYVAGHSLGEY+ALCAA  FSL+DT RL+R RG +MQ+AVP G G+M A
Sbjct: 61  EARGFSLKDKVSYVAGHSLGEYSALCAAGTFSLADTARLLRIRGNAMQKAVPVGEGAMAA 120

Query: 137 IIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAADTCLNKGAKRAVFL 196
           IIGL+   V+++C +A   G  +IANDNGGGQ+VISG + AV+ AA     KGAKRA+ L
Sbjct: 121 IIGLEHGDVEAVCMEAKASGPVQIANDNGGGQLVISGARAAVELAAKLGSEKGAKRAIML 180

Query: 197 PVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSIDEISRLLVEQVTGR 256
           PVSAPFHS+LM P +  M+  L +V K DPVVP++ N  A+PV+  +EI+ LLVEQVTG+
Sbjct: 181 PVSAPFHSTLMAPAADAMREALAAVEKHDPVVPLIANVRAAPVTDANEIAALLVEQVTGQ 240

Query: 257 VRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
           VRWRETI+WF+ +GV ++YEVG GKVLTGLA+RI K +S  ++
Sbjct: 241 VRWRETIEWFSANGVTTLYEVGCGKVLTGLARRISKDVSGAAV 283


>gi|294851834|ref|ZP_06792507.1| malonyl CoA-acyl carrier protein transacylase [Brucella sp. NVSL
           07-0026]
 gi|294820423|gb|EFG37422.1| malonyl CoA-acyl carrier protein transacylase [Brucella sp. NVSL
           07-0026]
          Length = 298

 Score =  337 bits (863), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 163/283 (57%), Positives = 209/283 (73%)

Query: 17  MGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPALTAVSMAFIRVM 76
           MG+ L + F EAR VF+EVD  L + LS  M+ G ++ LT T NAQPAL AVSMA  R+M
Sbjct: 1   MGKALAEQFAEARAVFDEVDEALGEKLSATMFEGPEDVLTLTANAQPALMAVSMAVQRIM 60

Query: 77  EKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQEAVPPGLGSMVA 136
           E  G  +K  +SYVAGHSLGEY+ALCAA  FSL+DT RL+R RG +MQ+AVP G G+M A
Sbjct: 61  EARGFSLKDKVSYVAGHSLGEYSALCAAGTFSLADTARLLRIRGNAMQKAVPVGEGAMAA 120

Query: 137 IIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAADTCLNKGAKRAVFL 196
           IIGL+   V+++C +A   G  +IANDNGGGQ+VISG + AV+ AA     KGAKRA+ L
Sbjct: 121 IIGLEHGDVEAVCMEAKASGPVQIANDNGGGQLVISGARAAVELAAKLGSEKGAKRAIML 180

Query: 197 PVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSIDEISRLLVEQVTGR 256
           PVSAPFHS+LM P +  M+  L +V K DPVVP++ N  A+ V+  +EI+ LLVEQVTG+
Sbjct: 181 PVSAPFHSTLMAPAADAMREALAAVEKHDPVVPLIANVRAASVTDANEIAALLVEQVTGQ 240

Query: 257 VRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
           VRWRETI+WF+ +GV ++YEVG GKVLTGLA+RI K +S  ++
Sbjct: 241 VRWRETIEWFSANGVTTLYEVGCGKVLTGLARRISKDVSGAAV 283


>gi|163759121|ref|ZP_02166207.1| putative malonyl CoA-acyl carrier protein transacylase [Hoeflea
           phototrophica DFL-43]
 gi|162283525|gb|EDQ33810.1| putative malonyl CoA-acyl carrier protein transacylase [Hoeflea
           phototrophica DFL-43]
          Length = 301

 Score =  333 bits (854), Expect = 2e-89,   Method: Compositional matrix adjust.
 Identities = 171/298 (57%), Positives = 225/298 (75%)

Query: 17  MGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPALTAVSMAFIRVM 76
           MG+DL D++PEAR VF+EVD  L + LS +++ G ++ LT T NAQPAL A+SMA +RV+
Sbjct: 1   MGKDLADAYPEARAVFDEVDEALGEKLSAVIFEGPEDTLTLTANAQPALMAMSMALMRVL 60

Query: 77  EKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQEAVPPGLGSMVA 136
           E  GL ++   S+VAGHSLGEY+ALCAA  FS++DT RL+R RG +MQ AVP G G+M A
Sbjct: 61  EARGLKLENTASHVAGHSLGEYSALCAAGMFSIADTARLLRIRGNAMQAAVPAGEGAMAA 120

Query: 137 IIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAADTCLNKGAKRAVFL 196
           IIGL+   V++ CA++   G  +IANDNGGGQ+VISG++ AV+ AA     KGAKRA+ L
Sbjct: 121 IIGLEIADVEAACAESRAHGAVQIANDNGGGQLVISGIKAAVEAAAAAATEKGAKRALLL 180

Query: 197 PVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSIDEISRLLVEQVTGR 256
            VSAPFHSSLM P ++ M+  L  V K  PVVP++ N  A+PVS  DEI +LLVEQVTG+
Sbjct: 181 SVSAPFHSSLMQPAAEAMREALAGVAKNTPVVPVISNVRATPVSDPDEIVQLLVEQVTGQ 240

Query: 257 VRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVEDIDLALRSIVG 314
           VRWRETI+WFA +GV +V E+G+GKVLTGLA+RID+S+SA++++   DID  L +I G
Sbjct: 241 VRWRETIEWFARNGVTTVAEIGAGKVLTGLARRIDRSVSALNVTGPADIDPFLAAISG 298


>gi|254473422|ref|ZP_05086819.1| malonyl CoA-acyl carrier protein transacylase [Pseudovibrio sp.
           JE062]
 gi|211957538|gb|EEA92741.1| malonyl CoA-acyl carrier protein transacylase [Pseudovibrio sp.
           JE062]
          Length = 317

 Score =  330 bits (845), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 159/306 (51%), Positives = 217/306 (70%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M+   TFPGQGSQ +GMG++L D+FPEAR VFEEVD  L Q+L+ +MW G  +ELT T N
Sbjct: 1   MTIAFTFPGQGSQTVGMGKELADTFPEARAVFEEVDAALGQSLTKIMWEGPADELTLTAN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
            QPAL AVS+A +RV+E  G+ + +  S+VAGHSLGEY+AL AA + S++D  RL+R RG
Sbjct: 61  TQPALMAVSLATMRVLEAKGVDLSKAASFVAGHSLGEYSALAAAGSLSIADAARLLRIRG 120

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
            +MQ+AVP G G+M A++GLD      +  +A++  +C+ ANDN  GQVV+SG + AV+ 
Sbjct: 121 DAMQKAVPVGEGAMAALLGLDFDQAMEVAQEAAQGEVCQAANDNATGQVVVSGHKAAVER 180

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A +    KGA+RAV LPVSAPFH SLM P +  M   L  V  + P VP++ N  A+P++
Sbjct: 181 ACEIAKGKGARRAVLLPVSAPFHCSLMQPAADAMAKALAEVEIKAPAVPLVANVLAAPIT 240

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
             +EI   LVEQVTG VRWRE++ W A++GV ++ E+G+GKVLTG+ +RI KSL  V+++
Sbjct: 241 DPEEIRTRLVEQVTGTVRWRESVSWMADNGVTTLVEIGTGKVLTGMVRRIVKSLEGVAVN 300

Query: 301 KVEDID 306
             EDID
Sbjct: 301 TAEDID 306


>gi|304392017|ref|ZP_07373959.1| malonyl CoA-acyl carrier protein transacylase [Ahrensia sp. R2A130]
 gi|303296246|gb|EFL90604.1| malonyl CoA-acyl carrier protein transacylase [Ahrensia sp. R2A130]
          Length = 312

 Score =  329 bits (843), Expect = 4e-88,   Method: Compositional matrix adjust.
 Identities = 165/306 (53%), Positives = 218/306 (71%), Gaps = 2/306 (0%)

Query: 5   LTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPA 64
           LTFPGQGSQ +GMGR + D++PEA+ VF+EVD  L + LS ++++G  + LT T NAQPA
Sbjct: 4   LTFPGQGSQAVGMGRAIADAYPEAKAVFDEVDDALGEKLSAVIFDGPDDALTLTTNAQPA 63

Query: 65  LTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQ 124
           L AVS+A +R ME  G  V R   YVAGHSLGEY+AL AA+A ++ DT RL+R RG++MQ
Sbjct: 64  LMAVSLAVLRAMESEGFMVTR-ADYVAGHSLGEYSALAAARAITIGDTARLLRIRGEAMQ 122

Query: 125 EAVPPGLGSMVAIIGLDDCVVDSICAQASRVG-ICEIANDNGGGQVVISGLQDAVKCAAD 183
            AVP G G+M AIIGL+   V++ C  AS+     +IANDNGGGQ+VISG   AV+ A +
Sbjct: 123 AAVPVGKGAMAAIIGLEQDAVETACTNASQPDDEVQIANDNGGGQLVISGHAGAVERAME 182

Query: 184 TCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSID 243
            C   GAKRA+ LPVSAPFHS+LM P +  MK  L +V  +  +VP++ N  A P+S  +
Sbjct: 183 ACKEAGAKRALPLPVSAPFHSTLMAPAADRMKDALAAVDIKPTIVPLVCNVLADPISHPE 242

Query: 244 EISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVE 303
           +I + LVEQVTGRVRW E++++ A  GV  ++EVGSGKVLTGLA+RID++L   +I   +
Sbjct: 243 DIRKNLVEQVTGRVRWAESVEYMAEQGVNRIWEVGSGKVLTGLARRIDRTLEGTAIGAPD 302

Query: 304 DIDLAL 309
           DI  AL
Sbjct: 303 DISAAL 308


>gi|254502650|ref|ZP_05114801.1| malonyl CoA-acyl carrier protein transacylase [Labrenzia alexandrii
           DFL-11]
 gi|222438721|gb|EEE45400.1| malonyl CoA-acyl carrier protein transacylase [Labrenzia alexandrii
           DFL-11]
          Length = 314

 Score =  324 bits (830), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 161/312 (51%), Positives = 215/312 (68%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M+T  TFPGQGSQ +GMG+ L D+FPEAR VF+EVD  L+Q LSD+MWNG + +LT T N
Sbjct: 1   MTTAFTFPGQGSQAVGMGKLLADTFPEARAVFDEVDDALDQKLSDIMWNGPEGDLTLTAN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
           AQPAL AVS+A +RV+E  GL +K  +S+VAGHSLGEY+AL AA +  ++   +L+R RG
Sbjct: 61  AQPALMAVSLATMRVLEAKGLDLKASVSFVAGHSLGEYSALAAAGSLDVATAAKLLRVRG 120

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
            +MQ AVP G G+M A++GLD      I   A++  +C+ ANDN  GQVV+SG   AV+ 
Sbjct: 121 NAMQNAVPVGQGAMAALLGLDFEAAAEIAKDAAQGEVCQAANDNAPGQVVVSGHVAAVER 180

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A +    +GA+RAV LPVSAPFH SLM P ++ M   L +   + PVVP++ N  A+P++
Sbjct: 181 AVEIAKARGARRAVLLPVSAPFHCSLMGPAAEAMAEALTNADIKAPVVPLVANVLATPIT 240

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
              +I   LVEQVTG VRWRE+I W A  GV +  EVG+GKVLTG+ KRI K  S ++I+
Sbjct: 241 DPVDIRDRLVEQVTGTVRWRESISWLAGEGVDTFVEVGTGKVLTGMVKRIAKEASGMAIN 300

Query: 301 KVEDIDLALRSI 312
             +DID  +  +
Sbjct: 301 SPDDIDAVIEKL 312


>gi|90419490|ref|ZP_01227400.1| malonyl Coenzyme A-acyl carrier protein transacylase [Aurantimonas
           manganoxydans SI85-9A1]
 gi|90336427|gb|EAS50168.1| malonyl Coenzyme A-acyl carrier protein transacylase [Aurantimonas
           manganoxydans SI85-9A1]
          Length = 310

 Score =  323 bits (829), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 165/305 (54%), Positives = 205/305 (67%), Gaps = 1/305 (0%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M+T L FPGQGSQ +GMGR LYDSF  +R VF+EVD  L + LS+L++ G ++ LT T N
Sbjct: 1   MTTALVFPGQGSQSVGMGRTLYDSFDASRAVFDEVDEALGEKLSELIFEGPEDRLTLTEN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
           AQPAL AVSMA IR +E  G  V+   +YVAGHSLGEY+AL A  A S+  T +L+R RG
Sbjct: 61  AQPALMAVSMAAIRALEAEGFSVE-TAAYVAGHSLGEYSALAAVGALSIGQTAKLLRIRG 119

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
            +MQEAVP G GSM AIIGLD   V  +C  A+   +CE ANDNGGGQ+VISG   A+  
Sbjct: 120 NAMQEAVPSGAGSMAAIIGLDAEAVAKLCEDAAEGEVCEPANDNGGGQIVISGNAAAIDR 179

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A      +GAKRA+ L VSAPFH  LM P +  M   L       P VP++ N  A+P S
Sbjct: 180 AIALAQERGAKRALPLSVSAPFHCRLMQPAADRMAEALADAEILVPRVPVVTNVTAAPTS 239

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
              EI   LV QVTG+VRWRE+I+W A +GV S+ E+GSGKVLTGLA+RID+SL   +I 
Sbjct: 240 DPAEIRERLVRQVTGQVRWRESIEWLAANGVNSLVEIGSGKVLTGLARRIDRSLEGRAIG 299

Query: 301 KVEDI 305
             +D+
Sbjct: 300 TADDV 304


>gi|144899047|emb|CAM75911.1| malonyl CoA-acyl carrier protein transacylase [Magnetospirillum
           gryphiswaldense MSR-1]
          Length = 313

 Score =  323 bits (829), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 163/313 (52%), Positives = 215/313 (68%), Gaps = 1/313 (0%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           MS    FPGQGSQ +GMGR+L ++F EAR VF+EVD  L+QNLS LM+ G ++ LT T N
Sbjct: 1   MSRAFVFPGQGSQAVGMGRELAEAFAEARHVFQEVDEALSQNLSKLMFEGPEDTLTLTEN 60

Query: 61  AQPALTAVSMAFIRVMEKNG-LCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRAR 119
           AQPAL A+S+A +RV+E  G + + +  S+VAGHSLGEY+AL A   FSL+DT RL++ R
Sbjct: 61  AQPALMAMSVAVVRVLEGQGKMDLAKTASFVAGHSLGEYSALAAVGTFSLADTARLLKLR 120

Query: 120 GKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVK 179
           G+SMQ+AVP G+G+M A++G +      I A A+   +CE ANDNG GQVV+SG ++AV+
Sbjct: 121 GQSMQKAVPVGVGAMAALLGSEYEQAKEIAALAAEGQVCEAANDNGAGQVVVSGHKEAVE 180

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            A      KG KRAV LPVSAPFH +LM P +  M   L +VT   P VP++ N  AS V
Sbjct: 181 RAMKIAAEKGIKRAVLLPVSAPFHCALMQPAADAMAEALSNVTMNAPKVPLVANVVASAV 240

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
           +  + I  LLV+QVTG VRWRE + +    GV  + E+G+GKVL+GLAKRIDK LS +++
Sbjct: 241 TDPEVIRDLLVKQVTGTVRWREGVLYMKEQGVSQLVELGAGKVLSGLAKRIDKELSGLAV 300

Query: 300 SKVEDIDLALRSI 312
               DID  L S+
Sbjct: 301 GNPADIDAFLASL 313


>gi|316933694|ref|YP_004108676.1| malonyl CoA-acyl carrier protein transacylase [Rhodopseudomonas
           palustris DX-1]
 gi|315601408|gb|ADU43943.1| malonyl CoA-acyl carrier protein transacylase [Rhodopseudomonas
           palustris DX-1]
          Length = 319

 Score =  320 bits (819), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 160/306 (52%), Positives = 218/306 (71%), Gaps = 1/306 (0%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M+   TFPGQGSQ +GMG+ L D+FP AR VF+EVD  L + L+ ++W+G  E L  T N
Sbjct: 1   MTAAFTFPGQGSQAVGMGKALADAFPAARAVFDEVDAALGEKLTAIIWDGPAETLQLTEN 60

Query: 61  AQPALTAVSMAFIRVME-KNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRAR 119
           AQPAL AVS+A +RV+E + G+ V +D ++VAGHSLGEY+AL AA + S+SDT RL+R R
Sbjct: 61  AQPALMAVSLATMRVLEAEAGVSVGKDAAFVAGHSLGEYSALAAAGSLSVSDTARLLRIR 120

Query: 120 GKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVK 179
           G++MQ+AVP G+G+M A++GLD     ++ A+A++  +C+ ANDNGGGQVV+SG +DAV+
Sbjct: 121 GQAMQKAVPVGVGAMAALLGLDYDTAVAVAAEAAQGQVCQAANDNGGGQVVVSGHKDAVE 180

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            A +    KGAKRA+ LPVSAPFH SLM P ++ M   L  VT + P  P++ N  ASP+
Sbjct: 181 RAVEIAKGKGAKRAMLLPVSAPFHCSLMQPAAEAMAEALAGVTIKAPAAPLVANVLASPI 240

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
           +  DEI R LVEQVTG VRWRE++ + A+ GV    E+G+GKVL+GL KRI    + +S+
Sbjct: 241 TDPDEIRRRLVEQVTGTVRWRESVAFMASQGVNQFLEIGAGKVLSGLVKRIADGATGISV 300

Query: 300 SKVEDI 305
               DI
Sbjct: 301 GGPNDI 306


>gi|148255214|ref|YP_001239799.1| [acyl-carrier-protein] S-malonyltransferase [Bradyrhizobium sp.
           BTAi1]
 gi|146407387|gb|ABQ35893.1| [Acyl-carrier-protein] S-malonyltransferase [Bradyrhizobium sp.
           BTAi1]
          Length = 319

 Score =  319 bits (818), Expect = 3e-85,   Method: Compositional matrix adjust.
 Identities = 159/300 (53%), Positives = 207/300 (69%), Gaps = 1/300 (0%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M+   TFPGQGSQ +GMG+ L D+FP AR VFEEVD  L + L+ ++W G  E L  T N
Sbjct: 1   MTAAFTFPGQGSQAVGMGKALADAFPVARAVFEEVDTALGEKLTAIIWEGPAETLQLTEN 60

Query: 61  AQPALTAVSMAFIRVME-KNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRAR 119
           AQPAL AVSMA +RV+E + G  V RD ++VAGHSLGEY+AL AA + S++DT RL+R R
Sbjct: 61  AQPALMAVSMAALRVLEAEAGFSVGRDAAFVAGHSLGEYSALAAAGSLSIADTARLLRTR 120

Query: 120 GKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVK 179
           G +MQ+AVP G+G+M A++G+D     ++  +A++  +C+ ANDNGGGQVV+SG + AV 
Sbjct: 121 GLAMQKAVPVGVGAMAALLGMDYETAVAVAEEAAQGEVCQAANDNGGGQVVVSGNKAAVD 180

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            A D    KGAKRA+ LPVSAPFH  LM P + VM   L  VT + P  P++ N  A+P+
Sbjct: 181 RAVDIARAKGAKRAMLLPVSAPFHCKLMQPAADVMAEALSKVTIKAPASPLVSNVLAAPI 240

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
           S  DEI R LVEQVTG VRWRE I + A  GV   +E+G+GKVL+GL KRI      V++
Sbjct: 241 SDPDEIRRRLVEQVTGTVRWREAIAYMAGQGVTRFFEIGAGKVLSGLVKRIADGAVGVAV 300


>gi|86749586|ref|YP_486082.1| malonyl CoA-acyl carrier protein transacylase [Rhodopseudomonas
           palustris HaA2]
 gi|86572614|gb|ABD07171.1| [Acyl-carrier-protein] S-malonyltransferase [Rhodopseudomonas
           palustris HaA2]
          Length = 319

 Score =  319 bits (818), Expect = 3e-85,   Method: Compositional matrix adjust.
 Identities = 159/309 (51%), Positives = 216/309 (69%), Gaps = 1/309 (0%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M+   TFPGQGSQ +GMG+ L D+FP A+ VF+EVD  L + L+  +W G  E L  T N
Sbjct: 1   MTAAFTFPGQGSQAVGMGKALADAFPAAKAVFDEVDAALGEKLTATIWEGPAETLQLTEN 60

Query: 61  AQPALTAVSMAFIRVMEKN-GLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRAR 119
           AQPAL AVS+A +RV+E   G+ V RD ++VAGHSLGEY+AL AA A ++SDT RL+R R
Sbjct: 61  AQPALMAVSLAALRVLESEAGISVGRDAAFVAGHSLGEYSALAAAGALTVSDTARLLRIR 120

Query: 120 GKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVK 179
           G++MQ+AVP G+G+M A++GLD     ++ ++A++  +C+ ANDNGGGQVV+SG ++AV+
Sbjct: 121 GRAMQKAVPVGVGAMAALLGLDYEAAVAVASEAAQGQVCQAANDNGGGQVVVSGHKEAVE 180

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            A +    KGAKRA+ LPVSAPFH +LM P ++ M   L  V  Q P VP++ N  A+P+
Sbjct: 181 RAVEIAKGKGAKRAMLLPVSAPFHCALMQPAAEAMAEALAGVAIQSPAVPLVCNVLAAPI 240

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
           +  DEI R L+EQVTG VRWRE++ + A HGV    E+G+GKVL+GL KRI    + V+I
Sbjct: 241 TDPDEIRRRLIEQVTGTVRWRESVAYMAGHGVSRFLEIGAGKVLSGLVKRIADGATGVAI 300

Query: 300 SKVEDIDLA 308
               DI  A
Sbjct: 301 GNPNDIAAA 309


>gi|126735960|ref|ZP_01751704.1| acyl-carrier-protein S-malonyltransferase [Roseobacter sp. CCS2]
 gi|126714517|gb|EBA11384.1| acyl-carrier-protein S-malonyltransferase [Roseobacter sp. CCS2]
          Length = 312

 Score =  319 bits (817), Expect = 3e-85,   Method: Compositional matrix adjust.
 Identities = 156/301 (51%), Positives = 210/301 (69%), Gaps = 1/301 (0%)

Query: 5   LTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPA 64
             FPGQG+Q IGMG+ L +++P AR VF+EVD  L ++LS L+W G  EELT T NAQPA
Sbjct: 4   FVFPGQGAQTIGMGQALAEAYPAARAVFDEVDEALGEDLSGLIWGGDIEELTLTANAQPA 63

Query: 65  LTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQ 124
           L A S+A +R +E  G+ V    S+VAGHSLGEY+AL AA+A SL+DT RL+RARGK+MQ
Sbjct: 64  LMATSIAAMRALEAEGVSVGA-ASFVAGHSLGEYSALAAAEAISLADTARLLRARGKAMQ 122

Query: 125 EAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAADT 184
           +AVP G+G+M A++GLD   V  + AQA++  +CE ANDN   QVV+SG + AV+ A D 
Sbjct: 123 DAVPVGVGAMAAVLGLDLGAVKEVAAQAAQGEVCEAANDNDPAQVVVSGHKAAVERAVDI 182

Query: 185 CLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSIDE 244
              KGAKRA+ LPVSAPFH SLM P +  M   L +V   DP VP++ N  A  V+   +
Sbjct: 183 AKEKGAKRALLLPVSAPFHCSLMQPAADAMAQALANVAIADPKVPVVANVLAEAVTDGAQ 242

Query: 245 ISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVED 304
           I  LL +Q+TG VRWRE++ + A  GV  VYE+G+GK L+G+ KRID+ L++ ++   E+
Sbjct: 243 IKDLLAQQITGAVRWRESVMYMAGQGVTEVYEIGAGKALSGMVKRIDRGLTSAAVGTPEN 302

Query: 305 I 305
           +
Sbjct: 303 V 303


>gi|149203966|ref|ZP_01880934.1| acyl-carrier-protein S-malonyltransferase [Roseovarius sp. TM1035]
 gi|149142408|gb|EDM30453.1| acyl-carrier-protein S-malonyltransferase [Roseovarius sp. TM1035]
          Length = 315

 Score =  317 bits (813), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 154/312 (49%), Positives = 213/312 (68%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           MS    FPGQG+QVIGMG DL  S+P AR VF+EVD  L Q LS L+W G+Q+ELT T N
Sbjct: 1   MSRAFVFPGQGAQVIGMGADLAASYPAARAVFDEVDEALGQKLSALIWEGAQDELTLTEN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
           AQPAL A S+A +R +E  G+ + +  S+VAGHSLGEY+AL AA A S++DT RL+R RG
Sbjct: 61  AQPALMATSIAALRALEAEGVNLAKAASHVAGHSLGEYSALAAAGAISVADTARLLRIRG 120

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           ++MQ+AVP G+G+M A++GLD     ++  +A++  +C+ ANDN   QVV+SG + AV+ 
Sbjct: 121 QAMQQAVPVGVGAMAALLGLDFETARAVAQEAAQGEVCQAANDNDPAQVVVSGHKSAVER 180

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A +    +GAKRA+ LPVSAPFH +LM P ++VM   L  V    P VP++ N  A  V+
Sbjct: 181 AVELAKARGAKRAMLLPVSAPFHCALMAPAAEVMAKALSEVAIHAPAVPLVANVRAQAVT 240

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
              EI  LLVEQVTG VRWRE++Q+    GV  ++E+G+GK L+G+ +RI + LS  +I 
Sbjct: 241 DPAEIRALLVEQVTGSVRWRESVQYMEAQGVTEIWEIGAGKALSGMVRRIARDLSCRTIG 300

Query: 301 KVEDIDLALRSI 312
             +++  A  S+
Sbjct: 301 TPDEVTAAAASL 312


>gi|89068233|ref|ZP_01155643.1| acyl-carrier-protein S-malonyltransferase [Oceanicola granulosus
           HTCC2516]
 gi|89046150|gb|EAR52208.1| acyl-carrier-protein S-malonyltransferase [Oceanicola granulosus
           HTCC2516]
          Length = 312

 Score =  317 bits (813), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 162/310 (52%), Positives = 217/310 (70%), Gaps = 1/310 (0%)

Query: 5   LTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPA 64
             FPGQGSQVIGMGR+L +++PEAR VF+EVD  L Q+LS L W G   +LT T NAQPA
Sbjct: 4   FVFPGQGSQVIGMGRELAEAYPEARAVFDEVDAALGQDLSALTWEGDIADLTLTENAQPA 63

Query: 65  LTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQ 124
           L A SMA +  +   G+ V     YVAGHSLGEYTALCAA A SL+DT RL++ RG++MQ
Sbjct: 64  LMATSMAAMAALASEGVTVSA-ADYVAGHSLGEYTALCAAGALSLADTARLLKVRGQAMQ 122

Query: 125 EAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAADT 184
           EAVP G G+M A++GLD     ++  +A+   +C+ ANDN  GQVV+SG + AV+ A + 
Sbjct: 123 EAVPVGQGAMAALLGLDYETARAVAEEAAGDDVCQAANDNDPGQVVVSGHKAAVERAVEI 182

Query: 185 CLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSIDE 244
              +GAKRAV LPVSAPFHSSLM P ++VM   LD VT + PVVP++ N  A PV++ DE
Sbjct: 183 AKGRGAKRAVILPVSAPFHSSLMAPAAEVMAGALDKVTFEAPVVPVVTNVSARPVTNPDE 242

Query: 245 ISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVED 304
           +   LVEQVTG VRWRE++ W A  GV  V+E+G+GK L+G+ +RID++++  +++   +
Sbjct: 243 LRAQLVEQVTGSVRWRESVAWMAGEGVGEVWEIGAGKALSGMIRRIDRAVATRTVATPHE 302

Query: 305 IDLALRSIVG 314
           +  A  S+ G
Sbjct: 303 VKDAAASLAG 312


>gi|146340287|ref|YP_001205335.1| malonyl CoA-acyl carrier protein transacylase [Bradyrhizobium sp.
           ORS278]
 gi|146193093|emb|CAL77104.1| Malonyl CoA-acyl carrier protein transacylase (MCT) [Bradyrhizobium
           sp. ORS278]
          Length = 319

 Score =  317 bits (812), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 156/306 (50%), Positives = 210/306 (68%), Gaps = 1/306 (0%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M+   TFPGQGSQ +GMG+ L D+FP AR VF+EVD  L + L+ ++W G  E L  T N
Sbjct: 1   MTAAFTFPGQGSQAVGMGKALADAFPAARAVFDEVDAALGEKLTTIIWEGPAETLQLTEN 60

Query: 61  AQPALTAVSMAFIRVME-KNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRAR 119
           AQPAL AVSMA +RV+E + G  V +D ++VAGHSLGEY+AL AA + +++DT RL+R R
Sbjct: 61  AQPALMAVSMATLRVLEAEAGFSVGQDAAFVAGHSLGEYSALAAAGSLTIADTARLLRTR 120

Query: 120 GKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVK 179
           G +MQ+AVP G+G+M A++G+D     ++  +A++  +C+ ANDNGGGQVV+SG + AV 
Sbjct: 121 GLAMQKAVPVGVGAMAALLGMDYEAAVAVAEEAAQGEVCQAANDNGGGQVVVSGNKAAVD 180

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            A +    KGAKRA+ LPVSAPFH  LM P + VM   L  VT + P  P++ N  A+P+
Sbjct: 181 RAVEIARAKGAKRAMLLPVSAPFHCQLMQPAADVMADALSKVTIKAPAAPVVSNVLAAPI 240

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
           +  DEI R LVEQVTG VRWRE+I + A  GV   +E+G+GKVL+GL KRI      V++
Sbjct: 241 TDPDEIRRRLVEQVTGTVRWRESIAYMAGQGVTRFFEIGAGKVLSGLVKRIADGAVGVAV 300

Query: 300 SKVEDI 305
               DI
Sbjct: 301 GGPADI 306


>gi|218528538|ref|YP_002419354.1| malonyl CoA-acyl carrier protein transacylase [Methylobacterium
           chloromethanicum CM4]
 gi|218520841|gb|ACK81426.1| malonyl CoA-acyl carrier protein transacylase [Methylobacterium
           chloromethanicum CM4]
          Length = 310

 Score =  317 bits (812), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 154/306 (50%), Positives = 206/306 (67%), Gaps = 1/306 (0%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M+    FPGQGSQ +GMG+ L ++FP AR VFEEVD  L QNLS LM+ G  +ELT T N
Sbjct: 1   MTRAFIFPGQGSQAVGMGKALSEAFPAARQVFEEVDAALGQNLSRLMFEGPSDELTLTAN 60

Query: 61  AQPALTAVSMAFIRVME-KNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRAR 119
           AQPAL A S+A +R +E + GL + RD ++VAGHSLGEY+AL AA  FS+SDT RL+R R
Sbjct: 61  AQPALMAASLAVLRTLEAERGLDLARDAAFVAGHSLGEYSALAAAGTFSISDTARLLRIR 120

Query: 120 GKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVK 179
           G++MQ AV PG+G+M A+IG D      I  +A+   +C++ANDNGGGQVV+SG ++AV+
Sbjct: 121 GEAMQRAVAPGIGAMAALIGPDLATARDIAGEAAEGLVCDVANDNGGGQVVLSGHREAVE 180

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            A     ++G +RAV L VSAPFH +LM P ++ M+  L  V    P VP+  N  A P+
Sbjct: 181 RAMALAQSRGVRRAVLLNVSAPFHCALMAPAAEAMRRALAEVPMNAPAVPVFANVTAGPL 240

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
           +  D I   L+ QVTG VRW E++   A  GV   +E+G+GKVLTGL KRI  S +A ++
Sbjct: 241 TEPDAIRNALITQVTGTVRWSESVAAMAEAGVDRFFELGAGKVLTGLVKRIAPSATASAV 300

Query: 300 SKVEDI 305
              +D+
Sbjct: 301 GTPDDV 306


>gi|118588142|ref|ZP_01545552.1| acyl-carrier-protein S-malonyltransferase [Stappia aggregata IAM
           12614]
 gi|118439764|gb|EAV46395.1| acyl-carrier-protein S-malonyltransferase [Stappia aggregata IAM
           12614]
          Length = 314

 Score =  317 bits (812), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 157/314 (50%), Positives = 213/314 (67%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M+   TFPGQGSQ +GMG+ L D+FPEA+ VF+EVD  L Q LSD+MW G +E LT T N
Sbjct: 1   MTIAFTFPGQGSQGVGMGKALADAFPEAKAVFDEVDEALGQKLSDVMWTGPEETLTLTAN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
           AQPAL AVS+A +RV+E  GL +   +S+VAGHSLGEY+AL AA +  ++   +L+R RG
Sbjct: 61  AQPALMAVSLAAMRVLEARGLDLAGSVSFVAGHSLGEYSALAAAGSLDIATAAKLLRVRG 120

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
            +MQ AVP G G+M A++GL+  V   +   A++  +C+ ANDN  GQVV+SG   AV+ 
Sbjct: 121 DAMQNAVPVGQGAMAALLGLEFDVAVEVAEAAAQGEVCQAANDNAPGQVVVSGHLAAVER 180

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A +    KGA+RAV LPVSAPFH SLM P ++ M   L +   + P VP++ N  A P++
Sbjct: 181 AVEIAKAKGARRAVMLPVSAPFHCSLMGPAAEKMAEALANAEIRSPAVPLVANVLARPIT 240

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
             +EI   LV+QVTG VRWRE+I W A +GV +  E+G+GKVLTG+ KRI K  + ++++
Sbjct: 241 DANEIRDRLVQQVTGTVRWRESITWLAENGVDTFVEIGTGKVLTGMVKRIAKEATGMAVN 300

Query: 301 KVEDIDLALRSIVG 314
             EDID  +  I G
Sbjct: 301 SPEDIDSLMEKISG 314


>gi|192291856|ref|YP_001992461.1| malonyl CoA-acyl carrier protein transacylase [Rhodopseudomonas
           palustris TIE-1]
 gi|192285605|gb|ACF01986.1| malonyl CoA-acyl carrier protein transacylase [Rhodopseudomonas
           palustris TIE-1]
          Length = 319

 Score =  316 bits (810), Expect = 3e-84,   Method: Compositional matrix adjust.
 Identities = 159/306 (51%), Positives = 216/306 (70%), Gaps = 1/306 (0%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M+   TFPGQGSQ +GMG+ L ++FP AR VF+EVD  L + L+ ++W G  E L  T N
Sbjct: 1   MTAAFTFPGQGSQAVGMGKALAEAFPAARAVFDEVDAALGEKLTSIIWEGPAETLQLTEN 60

Query: 61  AQPALTAVSMAFIRVME-KNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRAR 119
           AQPAL AVS+A +RV+E + G+ V +D ++VAGHSLGEY+AL AA + S+SDT RL+R R
Sbjct: 61  AQPALMAVSLATMRVLETEAGVSVGKDAAFVAGHSLGEYSALAAAGSLSVSDTARLLRIR 120

Query: 120 GKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVK 179
           G++MQ+AVP G+G+M A++GLD     ++ A+A++  +C+ ANDNGGGQVV+SG +DAV+
Sbjct: 121 GQAMQKAVPVGVGAMAALLGLDYDTAVAVAAEAAQGQVCQAANDNGGGQVVVSGHKDAVE 180

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            A +    KGAKRA+ LPVSAPFH SLM P ++ M   L  VT + P  P++ N  ASP+
Sbjct: 181 RAVEIAKGKGAKRAMLLPVSAPFHCSLMQPAAEAMAEALAGVTIKAPAAPLVANVLASPI 240

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
           +  DEI R LVEQVTG VRWRE++ + A+ GV    E+G+GKVL+GL KRI      +S+
Sbjct: 241 TDPDEIRRRLVEQVTGTVRWRESVAFMASQGVNQFLEIGAGKVLSGLVKRIADGAIGISV 300

Query: 300 SKVEDI 305
               DI
Sbjct: 301 GGPNDI 306


>gi|254559143|ref|YP_003066238.1| malonyl-CoA-[acyl-carrier-protein] transacylase [Methylobacterium
           extorquens DM4]
 gi|254266421|emb|CAX22185.1| malonyl-CoA-[acyl-carrier-protein] transacylase [Methylobacterium
           extorquens DM4]
          Length = 310

 Score =  315 bits (808), Expect = 5e-84,   Method: Compositional matrix adjust.
 Identities = 154/306 (50%), Positives = 206/306 (67%), Gaps = 1/306 (0%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M+    FPGQGSQ +GMG+ L ++FP AR VFEEVD  L QNLS LM+ G  +ELT T N
Sbjct: 1   MTRAFIFPGQGSQAVGMGKALSEAFPAARQVFEEVDAALGQNLSRLMFEGPSDELTLTAN 60

Query: 61  AQPALTAVSMAFIRVME-KNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRAR 119
           AQPAL A S+A +R +E + GL + RD ++VAGHSLGEY+AL AA  FS+SDT RL+R R
Sbjct: 61  AQPALMAASLAVLRTLEAERGLDLARDAAFVAGHSLGEYSALAAAGTFSISDTARLLRIR 120

Query: 120 GKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVK 179
           G++MQ AV PG+G+M A+IG D      I  +A+   +C++ANDNGGGQVV+SG ++AV+
Sbjct: 121 GEAMQRAVAPGIGAMAALIGPDLATARDIGGEAAEGLVCDVANDNGGGQVVLSGHREAVE 180

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            A     ++G +RAV L VSAPFH +LM P ++ M+  L  V    P VP+  N  A P+
Sbjct: 181 RAMALAQSRGVRRAVLLNVSAPFHCALMAPAAEAMRRALAEVPMHAPAVPVYANVTAGPL 240

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
           +  D I   L+ QVTG VRW E++   A  GV   +E+G+GKVLTGL KRI  S +A ++
Sbjct: 241 TEPDAIRNALITQVTGTVRWSESVAAMAEAGVDRFFELGAGKVLTGLVKRIAPSATASAV 300

Query: 300 SKVEDI 305
              +D+
Sbjct: 301 GTPDDV 306


>gi|209885491|ref|YP_002289348.1| malonyl CoA-acyl carrier protein transacylase [Oligotropha
           carboxidovorans OM5]
 gi|209873687|gb|ACI93483.1| malonyl CoA-acyl carrier protein transacylase [Oligotropha
           carboxidovorans OM5]
          Length = 318

 Score =  314 bits (804), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 154/300 (51%), Positives = 208/300 (69%), Gaps = 1/300 (0%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M+   TFPGQGSQ +GMG+ L ++FP AR VF+EVD  L + LS ++W G  + L  T N
Sbjct: 1   MTAAFTFPGQGSQAVGMGKALAETFPAARAVFDEVDDALGEKLSTVIWEGPADALQLTEN 60

Query: 61  AQPALTAVSMAFIRVME-KNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRAR 119
            QPAL A+S+A +RV+E + G+ + RD ++VAGHSLGEY+AL AA++ S+ DT RL+R R
Sbjct: 61  TQPALMAMSLATLRVLETEAGIDLARDAAFVAGHSLGEYSALAAARSLSIVDTARLLRIR 120

Query: 120 GKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVK 179
           G +MQ+A P G+G+M A++GLD     ++  +A++  +C+ ANDNGGGQVV+SG + AV+
Sbjct: 121 GTAMQKATPVGVGAMAALLGLDYDTAVAVANEAAQGEVCQAANDNGGGQVVVSGDKAAVE 180

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            A +    KGA+RA+ L VSAPFH SLM P +  M   L  VT   PVVP++ N  ASPV
Sbjct: 181 RAVEIAKAKGARRAMLLQVSAPFHCSLMQPAADAMAEALGKVTVNKPVVPVVANMLASPV 240

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
           +  DEI + LVEQVTG VRWRE+I + A+ GV    E+GSGKVLTGL KRI      V++
Sbjct: 241 TDPDEIRKRLVEQVTGTVRWRESIAYMASQGVTHFLEIGSGKVLTGLVKRIADGAVGVAV 300


>gi|163849999|ref|YP_001638042.1| malonyl CoA-acyl carrier protein transacylase [Methylobacterium
           extorquens PA1]
 gi|163661604|gb|ABY28971.1| malonyl CoA-acyl carrier protein transacylase [Methylobacterium
           extorquens PA1]
          Length = 310

 Score =  314 bits (804), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 152/306 (49%), Positives = 205/306 (66%), Gaps = 1/306 (0%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M+    FPGQGSQ +GMG+ L ++FP AR VFEEVD  L QNLS LM+ G  + LT T N
Sbjct: 1   MTRAFIFPGQGSQAVGMGKALSEAFPAARQVFEEVDAALGQNLSRLMFEGPSDALTLTAN 60

Query: 61  AQPALTAVSMAFIRVME-KNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRAR 119
           AQPAL A S+A +R +E + GL + RD ++VAGHSLGEY+AL AA  FS++DT RL+R R
Sbjct: 61  AQPALMAASLAVLRTLEAERGLDLARDAAFVAGHSLGEYSALAAAGTFSIADTARLLRIR 120

Query: 120 GKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVK 179
           G++MQ AV PG+G+M A+IG D      I  +A+   +C++ANDNGGGQVV+SG ++AV+
Sbjct: 121 GEAMQRAVAPGIGAMAALIGPDLATARDIAGEAAEGLVCDVANDNGGGQVVLSGHREAVE 180

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            A     ++G +RAV L VSAPFH +LM P ++ M+  L  V    P VP+  N  A P+
Sbjct: 181 RAMALAQSRGVRRAVLLNVSAPFHCALMAPAAEAMRRALAEVPMNAPAVPVFANITAGPL 240

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
           +  D I   L+ QVTG VRW E++   A  GV   +E+G+GKVLTGL KRI  S +A ++
Sbjct: 241 TEPDAIRNALITQVTGTVRWSESVAAMAEAGVDRFFELGAGKVLTGLVKRIAPSATASAV 300

Query: 300 SKVEDI 305
              +D+
Sbjct: 301 GTPDDV 306


>gi|92117877|ref|YP_577606.1| malonyl CoA-acyl carrier protein transacylase [Nitrobacter
           hamburgensis X14]
 gi|91800771|gb|ABE63146.1| [Acyl-carrier-protein] S-malonyltransferase [Nitrobacter
           hamburgensis X14]
          Length = 319

 Score =  314 bits (804), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 153/306 (50%), Positives = 210/306 (68%), Gaps = 1/306 (0%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M+   TFPGQGSQ +GMG+ L D+FP A+ VF+EVD  L + L+ ++W G  E L  T N
Sbjct: 1   MTAAFTFPGQGSQTVGMGKALADAFPVAKAVFDEVDAALGEKLTAIIWGGPAETLQLTEN 60

Query: 61  AQPALTAVSMAFIRVME-KNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRAR 119
           AQPAL AVS+A +RV+E + G  V RD ++VAGHSLGEY+AL AA + S++DT RL+R R
Sbjct: 61  AQPALMAVSIATLRVLEVEAGFSVARDAAFVAGHSLGEYSALAAAGSLSIADTARLLRTR 120

Query: 120 GKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVK 179
           G +MQ+AVP G+G+M A++GLD     ++  +A++  +C+ ANDNGGGQVV+SG + AV 
Sbjct: 121 GLAMQKAVPVGVGAMAALLGLDYETAVAVADEAAQGQVCQAANDNGGGQVVVSGDKAAVD 180

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            A +    +GA+RA+ LPVSAPFH  LM P +  M   L +VT   P  P++ N  A+P+
Sbjct: 181 RAVEIAKTRGARRAMLLPVSAPFHCKLMQPAADAMAKALANVTINTPAAPVVSNVLAAPI 240

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
           +  DEI R L+EQVTG VRWRE++ + A HGV   +E+G+GKVL+GL KRI      V++
Sbjct: 241 TDPDEIRRRLIEQVTGTVRWRESVAYMAGHGVTRFFEIGAGKVLSGLVKRIADGAIGVAV 300

Query: 300 SKVEDI 305
               DI
Sbjct: 301 GGPNDI 306


>gi|39936138|ref|NP_948414.1| malonyl CoA-acyl carrier protein transacylase [Rhodopseudomonas
           palustris CGA009]
 gi|39649992|emb|CAE28516.1| putative malonyl CoA-acyl carrier protein transacylase
           [Rhodopseudomonas palustris CGA009]
          Length = 319

 Score =  313 bits (803), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 158/306 (51%), Positives = 215/306 (70%), Gaps = 1/306 (0%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M+   TFPGQGSQ +GMG+ L ++FP AR VF+EVD  L + L+ ++W G  E L  T N
Sbjct: 1   MTAAFTFPGQGSQAVGMGKALAEAFPAARAVFDEVDAALGEKLTSIIWEGPAETLQLTEN 60

Query: 61  AQPALTAVSMAFIRVME-KNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRAR 119
           AQPAL AVS+A +RV+E + G+ V +D ++VAGHSLGEY+AL AA + S+SDT RL+R R
Sbjct: 61  AQPALMAVSLATMRVLETEAGVSVGKDAAFVAGHSLGEYSALAAAGSLSVSDTARLLRIR 120

Query: 120 GKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVK 179
           G++MQ+AVP G+G+M A++GLD     ++ A+A++  +C+ ANDNGGGQVV+SG +DAV+
Sbjct: 121 GQAMQKAVPVGVGAMAALLGLDYDTAVAVAAEAAQGQVCQAANDNGGGQVVVSGHKDAVE 180

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            A +    KGAKRA+ LPVSAPFH SLM P ++ M   L  VT + P  P++ N  ASP+
Sbjct: 181 RAVEIAKGKGAKRAMLLPVSAPFHCSLMQPAAEAMAEALAGVTIKAPAAPLVANVLASPI 240

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
           +   EI R LVEQVTG VRWRE++ + A+ GV    E+G+GKVL+GL KRI      +S+
Sbjct: 241 TDPHEIRRRLVEQVTGTVRWRESVAFMASQGVNQFLEIGAGKVLSGLVKRIADGAIGISV 300

Query: 300 SKVEDI 305
               DI
Sbjct: 301 GGPNDI 306


>gi|126462108|ref|YP_001043222.1| malonyl CoA-acyl carrier protein transacylase [Rhodobacter
           sphaeroides ATCC 17029]
 gi|126103772|gb|ABN76450.1| [Acyl-carrier-protein] S-malonyltransferase [Rhodobacter
           sphaeroides ATCC 17029]
          Length = 310

 Score =  313 bits (803), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 158/308 (51%), Positives = 206/308 (66%), Gaps = 1/308 (0%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           MS    FPGQG+Q IGMGR L +++P AR VFEEVD  L + LS L+W+GS EELT T N
Sbjct: 1   MSRAFVFPGQGAQTIGMGRALAEAYPAARAVFEEVDEALGEKLSALIWDGSIEELTLTQN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
           AQPAL A SMA +  +E  GL +    S+VAGHSLGEY+ALCAAK+  LSDT RL+R RG
Sbjct: 61  AQPALMATSMAALAALEVEGLGIA-TASFVAGHSLGEYSALCAAKSLKLSDTARLLRIRG 119

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           ++MQEAVP G+G+M A++GLD      +  +A++  +C+ ANDN   QVV+SG + AV+ 
Sbjct: 120 QAMQEAVPVGVGAMAALLGLDYDTAVEVAHEAAQGEVCQAANDNDPAQVVVSGHKAAVER 179

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A +    +GAKRA+ LPVSAPFH +LM   + VM   L +V  + PV P++ N  A  VS
Sbjct: 180 AVEIAKGRGAKRAILLPVSAPFHCALMQHAASVMSEALAAVVIEAPVCPVVVNVRAEAVS 239

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
             D I  LLV QVTG VRWRE++ W  N GV   +E+G+GK L+G+ KRI K  +  +I 
Sbjct: 240 EPDRIRALLVAQVTGAVRWRESVMWMENAGVDEFWEIGAGKALSGMIKRIAKGAATRAIG 299

Query: 301 KVEDIDLA 308
             ED+  A
Sbjct: 300 TPEDVAAA 307


>gi|217977081|ref|YP_002361228.1| malonyl CoA-acyl carrier protein transacylase [Methylocella
           silvestris BL2]
 gi|217502457|gb|ACK49866.1| malonyl CoA-acyl carrier protein transacylase [Methylocella
           silvestris BL2]
          Length = 319

 Score =  313 bits (803), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 157/310 (50%), Positives = 209/310 (67%), Gaps = 5/310 (1%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           ++    FPGQGSQ +GM + L + FP+AR + +EVD  L Q LS LM+ G  +ELT T N
Sbjct: 3   LTKAFLFPGQGSQAVGMAKALAERFPQARALLDEVDDALGQRLSALMFEGPLDELTLTAN 62

Query: 61  AQPALTAVSMAFIRVME-KNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRAR 119
           AQPAL A S+A IRV+E + GL +KRD ++VAGHSLGEY+AL AA + S++D  RL+R R
Sbjct: 63  AQPALMAASLAAIRVLEAEAGLELKRDAAFVAGHSLGEYSALAAAGSISVADAARLLRLR 122

Query: 120 GKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRV----GICEIANDNGGGQVVISGLQ 175
           GK+MQ A P G+G+M A++G++      I +QA+       +CE+ANDNGGGQ V+SG  
Sbjct: 123 GKAMQAAAPVGVGAMAALLGVEAEAARDIASQAAAESGADAVCEVANDNGGGQTVVSGST 182

Query: 176 DAVKCAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFC 235
           DAV  A D   +KGA+RA+ LPVSAPFH +LM P +KVM   L  V    PV P++ N  
Sbjct: 183 DAVNRAIDIAKSKGARRAILLPVSAPFHCALMQPAAKVMSAALADVAIAPPVAPLVANVL 242

Query: 236 ASPVSSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLS 295
           A+PVS  +EI RLLV QVTG VRWRE++ + A  GV    E G+GKVL+GL KR+    +
Sbjct: 243 AAPVSDPEEIRRLLVAQVTGAVRWRESLLFMAGTGVSLFVECGAGKVLSGLIKRVCADAA 302

Query: 296 AVSISKVEDI 305
            +S+   +DI
Sbjct: 303 GISVGTPDDI 312


>gi|83311204|ref|YP_421468.1| S-malonyltransferase [Magnetospirillum magneticum AMB-1]
 gi|82946045|dbj|BAE50909.1| S-malonyltransferase [Magnetospirillum magneticum AMB-1]
          Length = 313

 Score =  312 bits (800), Expect = 3e-83,   Method: Compositional matrix adjust.
 Identities = 159/313 (50%), Positives = 214/313 (68%), Gaps = 1/313 (0%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M+    FPGQGSQ +GMGR+L ++FP AR +F+EVD  L+QNLS LM+ G +++LT T N
Sbjct: 1   MTRAFVFPGQGSQAVGMGRELAEAFPVARQLFQEVDDALSQNLSALMFEGPEDQLTLTEN 60

Query: 61  AQPALTAVSMAFIRVMEKNG-LCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRAR 119
           AQPAL AVS+A +RV+E  G   + +  ++VAGHSLGEY+AL AA  FS++DT RL++ R
Sbjct: 61  AQPALMAVSLAVVRVLEAEGTFELAKAATFVAGHSLGEYSALAAAGTFSVADTARLLKIR 120

Query: 120 GKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVK 179
           G++MQ+AVP G+G+M A++G +      I A A+   +CE ANDNGG QVV+SG + AV 
Sbjct: 121 GQAMQKAVPVGVGAMAALLGSELEQAREIAALAAEGEVCEAANDNGGSQVVLSGHKAAVD 180

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            A      KG KRA+ LPVSAPFH +LM P +  M+  L  V  + P VP++ N  A+ V
Sbjct: 181 RAIKIAAEKGIKRAIPLPVSAPFHCALMQPAADAMQDALAEVVMKAPRVPLVANVTAAKV 240

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
           +   +I  LLV QVTG VRWRE++ +    GV S+ E+GSGKVL GLAKRIDK LS  S+
Sbjct: 241 TDPADIRDLLVRQVTGTVRWRESVLFMKAEGVASLVELGSGKVLGGLAKRIDKELSGSSV 300

Query: 300 SKVEDIDLALRSI 312
               DI+  L+S+
Sbjct: 301 GAPADIEAFLKSL 313


>gi|90423801|ref|YP_532171.1| malonyl CoA-acyl carrier protein transacylase [Rhodopseudomonas
           palustris BisB18]
 gi|90105815|gb|ABD87852.1| [Acyl-carrier-protein] S-malonyltransferase [Rhodopseudomonas
           palustris BisB18]
          Length = 319

 Score =  311 bits (798), Expect = 5e-83,   Method: Compositional matrix adjust.
 Identities = 157/313 (50%), Positives = 218/313 (69%), Gaps = 1/313 (0%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M+   TFPGQGSQ +GMG+ L ++FP AR VF+EVD  L + L+  +W+G  E L  T N
Sbjct: 1   MTAAFTFPGQGSQAVGMGKALAEAFPAARAVFDEVDSALGEKLTATIWDGPAETLQLTEN 60

Query: 61  AQPALTAVSMAFIRVME-KNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRAR 119
           AQPAL AVS+A +RV+E + G  V R  ++VAGHSLGEY+AL AA + ++SDT RL+R R
Sbjct: 61  AQPALMAVSLATLRVLETEAGFSVARHAAFVAGHSLGEYSALAAAGSLTISDTARLLRTR 120

Query: 120 GKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVK 179
           G +MQ+AVP G+G+M A++GLD     ++  +A++  +C+ ANDNGGGQVV+SG + AV+
Sbjct: 121 GLAMQKAVPVGVGAMAALLGLDFDTAVAVAQEAAQGEVCQAANDNGGGQVVVSGAKAAVE 180

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            A +    KGAKRA+ LPVSAPFH +LM P ++ M   L  VT   P  P++ N  ASPV
Sbjct: 181 RALEIAKAKGAKRALLLPVSAPFHCTLMQPAAEAMAQALADVTILPPAAPLVANVLASPV 240

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
           ++ DEI RLLVEQVTG VRWRE++ + A+ GV   +E+G+GKVL+GL KRI      +++
Sbjct: 241 TAPDEIRRLLVEQVTGTVRWRESVAFMASQGVTHFFEIGAGKVLSGLVKRIADGAVGIAV 300

Query: 300 SKVEDIDLALRSI 312
               DI+ A +++
Sbjct: 301 GGPNDIEPAKQAL 313


>gi|126728805|ref|ZP_01744620.1| acyl-carrier-protein S-malonyltransferase [Sagittula stellata E-37]
 gi|126710735|gb|EBA09786.1| acyl-carrier-protein S-malonyltransferase [Sagittula stellata E-37]
          Length = 313

 Score =  311 bits (798), Expect = 6e-83,   Method: Compositional matrix adjust.
 Identities = 155/299 (51%), Positives = 203/299 (67%), Gaps = 1/299 (0%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M+    FPGQG+Q IGMGRDL +++P AR VF+EVD  LN+ LS L+W G Q+ LT T N
Sbjct: 1   MTRAFIFPGQGAQTIGMGRDLAEAYPAARAVFDEVDAALNEKLSALIWEGDQDTLTLTEN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
           AQPAL A S+A +R +E  G+ ++   SYVAGHSLGEYTAL AA A ++SD  RL+RARG
Sbjct: 61  AQPALMATSIAALRALEAEGVSIEA-ASYVAGHSLGEYTALTAAGALTVSDAARLLRARG 119

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           K+MQ AVP G G+M AI+GLD   V  + A+A+   +   ANDN   QVVISG + AV+ 
Sbjct: 120 KAMQAAVPVGKGAMAAILGLDLAAVRGVVAEAAEGEVLAAANDNDPSQVVISGAKAAVER 179

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A +    KGAKRAV LPVSAPFH  LM P + +M   LD V   +P VP++ N  AS V+
Sbjct: 180 AVEIAKTKGAKRAVLLPVSAPFHCDLMGPAADIMAEALDDVNIDEPKVPLVANVRASAVT 239

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
            +  I  LLVEQV G VRWRE++++    GV   +E+G+GK L+G+ +RID+S +  +I
Sbjct: 240 DVTLIRNLLVEQVCGAVRWRESVEYMVGKGVTEFWEIGAGKALSGMVRRIDRSAAVRNI 298


>gi|77463234|ref|YP_352738.1| [Acyl-carrier-protein] S-malonyltransferase [Rhodobacter
           sphaeroides 2.4.1]
 gi|77387652|gb|ABA78837.1| [Acyl-carrier-protein] S-malonyltransferase [Rhodobacter
           sphaeroides 2.4.1]
          Length = 310

 Score =  311 bits (798), Expect = 6e-83,   Method: Compositional matrix adjust.
 Identities = 157/308 (50%), Positives = 206/308 (66%), Gaps = 1/308 (0%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           MS    FPGQG+Q IGMGR L +++P AR VF+EVD  L + LS L+W+GS EELT T N
Sbjct: 1   MSRAFVFPGQGAQTIGMGRALAEAYPAARAVFDEVDEALGEKLSALIWDGSIEELTLTQN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
           AQPAL A SMA +  +E  GL +    S+VAGHSLGEY+ALCAAK+  LSDT RL+R RG
Sbjct: 61  AQPALMATSMAALAALEVEGLGIA-TASFVAGHSLGEYSALCAAKSLKLSDTARLLRIRG 119

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           ++MQEAVP G+G+M A++GLD      +  +A++  +C+ ANDN   QVV+SG + AV+ 
Sbjct: 120 QAMQEAVPVGVGAMAALLGLDYDTAVEVAHEAAQGEVCQAANDNDPAQVVVSGHKAAVER 179

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A +    +GAKRA+ LPVSAPFH +LM   + VM   L +V  + PV P++ N  A  VS
Sbjct: 180 AVEIAKGRGAKRAILLPVSAPFHCALMQHAASVMSEALAAVVIEAPVCPVVVNVRAEAVS 239

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
             D I  LLV QVTG VRWRE++ W  N GV   +E+G+GK L+G+ KRI K  +  +I 
Sbjct: 240 EPDRIRALLVAQVTGAVRWRESVMWMENAGVDEFWEIGAGKALSGMIKRIAKGAATRAIG 299

Query: 301 KVEDIDLA 308
             ED+  A
Sbjct: 300 TPEDVAAA 307


>gi|332558112|ref|ZP_08412434.1| malonyl CoA-acyl carrier protein transacylase [Rhodobacter
           sphaeroides WS8N]
 gi|332275824|gb|EGJ21139.1| malonyl CoA-acyl carrier protein transacylase [Rhodobacter
           sphaeroides WS8N]
          Length = 310

 Score =  311 bits (797), Expect = 8e-83,   Method: Compositional matrix adjust.
 Identities = 157/308 (50%), Positives = 206/308 (66%), Gaps = 1/308 (0%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           MS    FPGQG+Q IGMGR L +++P AR VFEEVD  L + LS L+W+GS EELT T N
Sbjct: 1   MSRAFVFPGQGAQTIGMGRALAEAYPAARAVFEEVDEALGEKLSALIWDGSIEELTLTQN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
           AQPAL A SMA +  +E  GL +    S+VAGHSLGEY+ALCAAK+  LSDT RL+R RG
Sbjct: 61  AQPALMATSMAALAALEVEGLGIA-TASFVAGHSLGEYSALCAAKSLKLSDTARLLRIRG 119

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           ++MQEAVP G+G+M A++GLD      +  +A++  +C+ ANDN   QVV+SG + AV+ 
Sbjct: 120 QAMQEAVPVGVGAMAALLGLDYDTAVEVAHEAAQGEVCQAANDNDPAQVVVSGHKAAVER 179

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A +    +GAKRA+ LPVSAPFH +LM   + VM   L +V  + PV P++ N  A  VS
Sbjct: 180 AVEIAKGRGAKRAILLPVSAPFHCALMQHAASVMSEALAAVVIEAPVCPVVVNVRAEAVS 239

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
             D I  LLV QVTG VRWRE++ W  + GV   +E+G+GK L+G+ KRI K  +  +I 
Sbjct: 240 EPDRIRALLVAQVTGAVRWRESVMWMEDAGVDEFWEIGAGKALSGMIKRIAKGAATRAIG 299

Query: 301 KVEDIDLA 308
             ED+  A
Sbjct: 300 TPEDVAAA 307


>gi|188579795|ref|YP_001923240.1| malonyl CoA-acyl carrier protein transacylase [Methylobacterium
           populi BJ001]
 gi|179343293|gb|ACB78705.1| malonyl CoA-acyl carrier protein transacylase [Methylobacterium
           populi BJ001]
          Length = 310

 Score =  310 bits (793), Expect = 3e-82,   Method: Compositional matrix adjust.
 Identities = 152/306 (49%), Positives = 206/306 (67%), Gaps = 1/306 (0%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M+    FPGQGSQ +GMG+ L ++ P AR VFEEVD  L QNLS LM+ G  +ELT T N
Sbjct: 1   MTRAFIFPGQGSQAVGMGKALSEASPAARQVFEEVDAALGQNLSQLMFEGPSDELTLTAN 60

Query: 61  AQPALTAVSMAFIRVME-KNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRAR 119
           AQPAL A S+A +R +E + GL + RD ++VAGHSLGEY+AL AA  FS+SD  RL+R R
Sbjct: 61  AQPALMAASLAVLRTLEAERGLDLARDAAFVAGHSLGEYSALAAAGTFSISDAARLLRIR 120

Query: 120 GKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVK 179
           G++MQ AV PG+G+M A++G D      I  +A++  +C++ANDNG GQVV+SG ++AV+
Sbjct: 121 GEAMQRAVAPGVGAMAALLGPDLATARDIAEEAAQGMVCDVANDNGAGQVVLSGHREAVE 180

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            A      +G +RAV L VSAPFH +LM P ++ M+  L  VT + PVVP+  N  A P+
Sbjct: 181 RAMALAQGRGVRRAVLLNVSAPFHCALMAPAAEAMRRALAEVTMRAPVVPVYANVTAGPL 240

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
           +  D I   LV QVTG VRW E++   A  GV   +E+G+GKVLTGL KRI  + +A ++
Sbjct: 241 TEPDAIRDALVSQVTGTVRWAESVAAMAEAGVDRFHELGAGKVLTGLVKRIAPNATAGAV 300

Query: 300 SKVEDI 305
              +D+
Sbjct: 301 GTPDDV 306


>gi|27379193|ref|NP_770722.1| acyl-carrier-protein S-malonyltransferase [Bradyrhizobium japonicum
           USDA 110]
 gi|27352344|dbj|BAC49347.1| malonyl-CoA:acyl carrier protein transacylase [Bradyrhizobium
           japonicum USDA 110]
          Length = 319

 Score =  309 bits (792), Expect = 3e-82,   Method: Compositional matrix adjust.
 Identities = 155/306 (50%), Positives = 205/306 (66%), Gaps = 1/306 (0%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M+   TFPGQGSQ +GMG+ L D+FP AR VF+EVD  L + L+  +W+G  E L  T N
Sbjct: 1   MTAAFTFPGQGSQAVGMGKALADAFPVARAVFDEVDAALGEKLTATIWDGPAETLQLTEN 60

Query: 61  AQPALTAVSMAFIRVME-KNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRAR 119
           AQPAL AVS+A +RV+E + G  V RD ++VAGHSLGEY+ L AA + ++SDT RL+R R
Sbjct: 61  AQPALMAVSVATLRVLEAEAGFSVGRDAAFVAGHSLGEYSGLAAAGSLTVSDTARLLRTR 120

Query: 120 GKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVK 179
           G +MQ+AVP G G+M A++GLD      +  +A++  +C+ ANDNGGGQVV+SG + AV 
Sbjct: 121 GLAMQKAVPVGAGAMAALLGLDYEAAMEVANEAAQGQVCQAANDNGGGQVVVSGDKAAVD 180

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            A +    KGAKRA+ LPVSAPFH  LM P +  M   L  VT + P  P++ N  A+ +
Sbjct: 181 RAVEIAKTKGAKRAMLLPVSAPFHCKLMQPAADAMAEALAKVTIKAPAAPLVSNVLATAI 240

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
           +  DEI R LVEQVTG VRWRE++ + A  GV   +E+G+GKVLTGL KRI      V++
Sbjct: 241 TDPDEIRRRLVEQVTGTVRWRESVAYMAGQGVTRFFEIGAGKVLTGLVKRIADGAVGVAV 300

Query: 300 SKVEDI 305
               DI
Sbjct: 301 GGPNDI 306


>gi|154247045|ref|YP_001418003.1| malonyl CoA-acyl carrier protein transacylase [Xanthobacter
           autotrophicus Py2]
 gi|154161130|gb|ABS68346.1| malonyl CoA-acyl carrier protein transacylase [Xanthobacter
           autotrophicus Py2]
          Length = 328

 Score =  308 bits (790), Expect = 5e-82,   Method: Compositional matrix adjust.
 Identities = 159/304 (52%), Positives = 214/304 (70%), Gaps = 1/304 (0%)

Query: 3   TVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQ 62
           T   FPGQGSQ +GMG+ L D+FP A+ VF+EVD  LN++L+ +MW+G  + LT T NAQ
Sbjct: 11  TAFIFPGQGSQAVGMGKALADNFPAAKAVFDEVDAALNESLTQVMWDGPIDALTLTANAQ 70

Query: 63  PALTAVSMAFIRVME-KNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           PAL AVS+A +RV+E + GL + R+ ++VAGHSLGEY+AL AA A ++++  RL+R RG+
Sbjct: 71  PALMAVSLAALRVLETEAGLDLAREAAFVAGHSLGEYSALAAAGALTITEAARLLRIRGR 130

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCA 181
           +MQEAVP G G+M A++GLD     ++ A+A+   +CE ANDN  GQVV+SG + AV+ A
Sbjct: 131 AMQEAVPVGEGAMAALLGLDYDQAVAVAAEAAGDDVCEAANDNAPGQVVVSGTKAAVERA 190

Query: 182 ADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSS 241
                 KGA +A+ LPVSAPFH  LM P ++ M+  L   T   P VP++ N  ASPV+ 
Sbjct: 191 IVIAKEKGAMKALLLPVSAPFHCRLMGPAAEAMEVALSGSTVMTPRVPLVANVRASPVTD 250

Query: 242 IDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISK 301
             EI RLLVEQVTG VRWRE++ + A  GV  + EVG+GKVL GL KRIDKS+SA ++  
Sbjct: 251 PAEIVRLLVEQVTGTVRWRESVIYMAGAGVTRMVEVGAGKVLCGLVKRIDKSVSASAVGT 310

Query: 302 VEDI 305
            ED+
Sbjct: 311 PEDV 314


>gi|221639096|ref|YP_002525358.1| malonyl CoA-acyl carrier protein transacylase [Rhodobacter
           sphaeroides KD131]
 gi|221159877|gb|ACM00857.1| malonyl CoA-acyl carrier protein transacylase [Rhodobacter
           sphaeroides KD131]
          Length = 322

 Score =  308 bits (790), Expect = 5e-82,   Method: Compositional matrix adjust.
 Identities = 157/308 (50%), Positives = 205/308 (66%), Gaps = 1/308 (0%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           MS    FPGQG+Q IGMGR L +++P AR VFEEVD  L + LS L+W+GS EELT T N
Sbjct: 13  MSRAFVFPGQGAQTIGMGRALAEAYPAARAVFEEVDEALGEKLSALIWDGSIEELTLTQN 72

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
           AQPAL A SMA +  +E  GL +    S+VAGHSLGEY+ALCAAK+  LSDT RL+R RG
Sbjct: 73  AQPALMATSMAALAALEVEGLGIA-TASFVAGHSLGEYSALCAAKSLKLSDTARLLRIRG 131

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           ++MQEAVP G+G+M A++GLD      +  +A++  +C+ ANDN   QVV+SG + AV+ 
Sbjct: 132 QAMQEAVPVGVGAMAALLGLDYDTAVEVAHEAAQGEVCQAANDNDPAQVVVSGHKAAVER 191

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A +    +GAKRA+ L VSAPFH +LM   + VM   L +V  + PV P++ N  A  VS
Sbjct: 192 AVEIAKGRGAKRAILLSVSAPFHCALMQHAASVMSEALAAVVIEAPVCPVVVNVRAEAVS 251

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
             D I  LLV QVTG VRWRE++ W  N GV   +E+G+GK L+G+ KRI K  +  +I 
Sbjct: 252 EPDRIRALLVAQVTGAVRWRESVMWMENAGVDEFWEIGAGKALSGMIKRIAKGAATRAIG 311

Query: 301 KVEDIDLA 308
             ED+  A
Sbjct: 312 TPEDVAAA 319


>gi|299133699|ref|ZP_07026893.1| malonyl CoA-acyl carrier protein transacylase [Afipia sp. 1NLS2]
 gi|298591535|gb|EFI51736.1| malonyl CoA-acyl carrier protein transacylase [Afipia sp. 1NLS2]
          Length = 318

 Score =  308 bits (789), Expect = 7e-82,   Method: Compositional matrix adjust.
 Identities = 157/306 (51%), Positives = 208/306 (67%), Gaps = 1/306 (0%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M+   TFPGQGSQ +GMG+ L ++FP AR VF+EVD  L Q LS ++W G  E L  T N
Sbjct: 1   MTAAFTFPGQGSQAVGMGKALAEAFPAARAVFDEVDSALGQKLSTVIWEGPAEALQLTEN 60

Query: 61  AQPALTAVSMAFIRVME-KNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRAR 119
            QPAL A+S+A +RV+E + G+ + RD ++VAGHSLGEY+AL AA + S++DT RL+R R
Sbjct: 61  TQPALMAMSLATLRVLEAEAGIDLARDAAFVAGHSLGEYSALAAAGSLSIADTARLLRIR 120

Query: 120 GKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVK 179
           G +MQ+A P G+G+M A++GLD     +   +A++  +C+ ANDNGGGQVV+SG + AV+
Sbjct: 121 GTAMQKATPVGVGAMAALLGLDYETAVAAADEAAQGQVCQAANDNGGGQVVVSGDKAAVE 180

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            A +    KGAKRA+ L VSAPFH  LM P +  M   L  VT   PVVP++ N  A PV
Sbjct: 181 RAVEIAKAKGAKRAMLLQVSAPFHCRLMQPAADAMAEALAKVTVNKPVVPVVANILAGPV 240

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
           +  D+I +LLVEQVTG VRWRE++ + A HGV    E+GSGKVLTGL KRI      V++
Sbjct: 241 TDPDQIRKLLVEQVTGTVRWRESVAYMAAHGVTHFLEIGSGKVLTGLVKRIADGAVGVAV 300

Query: 300 SKVEDI 305
               DI
Sbjct: 301 GGPGDI 306


>gi|159044726|ref|YP_001533520.1| malonyl CoA-acyl carrier protein transacylase [Dinoroseobacter
           shibae DFL 12]
 gi|157912486|gb|ABV93919.1| malonyl CoA-acyl carrier protein transacylase [Dinoroseobacter
           shibae DFL 12]
          Length = 315

 Score =  308 bits (788), Expect = 9e-82,   Method: Compositional matrix adjust.
 Identities = 155/305 (50%), Positives = 214/305 (70%), Gaps = 1/305 (0%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           MS    FPGQG+Q IGMGRDL +++P AR VFEEVD  L + LS L+W G  + LT T N
Sbjct: 1   MSRAFVFPGQGAQTIGMGRDLAEAYPAARAVFEEVDDALGEALSALIWEGEADRLTLTEN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
           AQPAL A S+A +R +E  GL    ++S  AGHSLGEY+AL AA A S+ DT RL+RARG
Sbjct: 61  AQPALMATSLAALRALEAEGLDWA-EVSCAAGHSLGEYSALAAAGALSVGDTARLLRARG 119

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           ++MQEAVP G+G+M A++GL+   V ++  +A++  +CE ANDN  GQVV+SG + AV+ 
Sbjct: 120 RAMQEAVPVGVGAMAALLGLNFETVCAVAEEAAQGEVCEAANDNDPGQVVVSGHKAAVER 179

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A D    +GAKRAV LPVSAPFH +LM P ++ MK  L +V    P VP++ N  A+PV+
Sbjct: 180 AVDLAKARGAKRAVLLPVSAPFHCALMAPAAETMKDALAAVEIATPRVPVIANVLAAPVT 239

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
           + ++I  LL+ Q+TG VRWRE++ W A +GV  ++E+G+GK L G+ +RID+S++  +I 
Sbjct: 240 APEQIRDLLIRQITGSVRWRESVGWMAQNGVTEIWEIGAGKALIGMVRRIDRSIATQAIG 299

Query: 301 KVEDI 305
             ED+
Sbjct: 300 TSEDV 304


>gi|75675882|ref|YP_318303.1| acyl-carrier-protein S-malonyltransferase [Nitrobacter winogradskyi
           Nb-255]
 gi|74420752|gb|ABA04951.1| [Acyl-carrier-protein] S-malonyltransferase [Nitrobacter
           winogradskyi Nb-255]
          Length = 317

 Score =  308 bits (788), Expect = 9e-82,   Method: Compositional matrix adjust.
 Identities = 157/305 (51%), Positives = 208/305 (68%), Gaps = 1/305 (0%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M+   TFPGQGSQ +GMG+ L D+FP A+ VF EVD  L + L+ ++W+G  E L  T N
Sbjct: 1   MTAAFTFPGQGSQTVGMGKALADAFPVAKAVFAEVDAALGEKLTAIIWDGPAETLQLTEN 60

Query: 61  AQPALTAVSMAFIRVME-KNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRAR 119
            QPAL AVS+A +RV+E + GL V RD ++VAGHSLGEY+AL AA + S++DT RL+R R
Sbjct: 61  TQPALMAVSIAALRVLEAEAGLSVARDAAFVAGHSLGEYSALAAAGSLSIADTARLLRTR 120

Query: 120 GKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVK 179
           G +MQ+AVP G G+M A++GLD  V  ++  +A++  +CE ANDNGGGQ+V+SG + AV 
Sbjct: 121 GLAMQKAVPVGDGAMAALLGLDYEVAVAVADEAAQGQVCEAANDNGGGQIVVSGDKAAVD 180

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            A +    KGA+RA+ L VSAPFH  LM P +  M   L  VT   PV P++ N  A+PV
Sbjct: 181 RAVEIAKAKGARRAMLLAVSAPFHCRLMQPAADTMAEALARVTINKPVAPVVANVIAAPV 240

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
           S  D I +LLV+QVTG VRWRE++ + A  GV    EVG+GKVLTGL KRI K  + V++
Sbjct: 241 SDPDAIRKLLVKQVTGTVRWRESVAYMAAQGVTHFLEVGAGKVLTGLLKRIVKDAAGVAV 300

Query: 300 SKVED 304
               D
Sbjct: 301 GGPGD 305


>gi|91977451|ref|YP_570110.1| malonyl CoA-acyl carrier protein transacylase [Rhodopseudomonas
           palustris BisB5]
 gi|91683907|gb|ABE40209.1| [Acyl-carrier-protein] S-malonyltransferase [Rhodopseudomonas
           palustris BisB5]
          Length = 317

 Score =  307 bits (786), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 153/307 (49%), Positives = 213/307 (69%), Gaps = 1/307 (0%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M+   TFPGQGSQ +GMG+ L D+FP A+ VF+EVD  L + L+ ++W G  E L  T N
Sbjct: 1   MTAAFTFPGQGSQAVGMGKALADAFPAAKAVFDEVDAALGEKLTAIIWEGPAETLQLTEN 60

Query: 61  AQPALTAVSMAFIRVMEKN-GLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRAR 119
           AQPAL AVS+A +RV+E   G+ + RD ++VAGHSLGEY+AL AA + +LSDT RL+R R
Sbjct: 61  AQPALMAVSLAALRVLESEAGVVIGRDAAFVAGHSLGEYSALAAAGSLTLSDTARLLRIR 120

Query: 120 GKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVK 179
           G++MQ+AVP G+G+M A++GLD     ++ ++A++  +C+ ANDNGGGQVV+SG ++AV+
Sbjct: 121 GRAMQKAVPVGVGAMAALLGLDYDAAVAVASEAAQGQVCQAANDNGGGQVVVSGHKEAVE 180

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            A +    KGAKRA+ LPVSAPFH +LM P ++ M   L  V  + P  P++ N  A+P+
Sbjct: 181 RAVEIAKAKGAKRAMLLPVSAPFHCALMQPAAEAMAEALAGVAIKAPAAPLVCNVLAAPI 240

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
           +  DEI   LVEQVTG VRWRE++ + A  GV   +E+G+GKVL+GL KRI      + +
Sbjct: 241 TDPDEIRSRLVEQVTGTVRWRESVAYMAGQGVTQFFEIGAGKVLSGLVKRIADGAVGMPV 300

Query: 300 SKVEDID 306
               DID
Sbjct: 301 GGPGDID 307


>gi|84503438|ref|ZP_01001498.1| acyl-carrier-protein S-malonyltransferase [Oceanicola batsensis
           HTCC2597]
 gi|84388225|gb|EAQ01177.1| acyl-carrier-protein S-malonyltransferase [Oceanicola batsensis
           HTCC2597]
          Length = 313

 Score =  306 bits (783), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 155/311 (49%), Positives = 207/311 (66%), Gaps = 1/311 (0%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           MS    FPGQG+Q IGMG+ L +++P AR VF+EVD  L + LS L+W G QE LT T N
Sbjct: 1   MSRAFVFPGQGAQTIGMGKALAEAYPAARAVFDEVDDALGEKLSSLIWEGDQETLTLTRN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
           AQPAL A S+A IR +E  G+ +  D ++VAGHSLGEY+AL AA + S++D  RL+R RG
Sbjct: 61  AQPALMATSLAAIRALEAEGVEIT-DAAFVAGHSLGEYSALAAAGSLSIADAARLLRTRG 119

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
            +MQEAVP G G+M A++GLD     ++  +A++  +C+ ANDN   QVV+SG + AV+ 
Sbjct: 120 AAMQEAVPVGEGAMAALLGLDFDTAQAVAEEAAQGDVCQAANDNDPSQVVVSGHRAAVER 179

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A D    KGAKRA+ LPVSAPFH +LM P + VM   LD V    P VP++ N  A  V 
Sbjct: 180 AVDIAKEKGAKRAMLLPVSAPFHCALMAPAADVMAQALDEVPIAAPAVPLVANVRAEAVD 239

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
               I  LLV+QVTG VRWRE++ W A  GV  V+E+G+GK L+G+ +RIDK+L+  ++ 
Sbjct: 240 DPATIRALLVDQVTGSVRWRESVLWMAGQGVSEVWEIGAGKALSGMIRRIDKTLACRAVG 299

Query: 301 KVEDIDLALRS 311
             ED+  A  S
Sbjct: 300 TPEDVAAAAES 310


>gi|83591755|ref|YP_425507.1| [Acyl-carrier-protein] S-malonyltransferase [Rhodospirillum rubrum
           ATCC 11170]
 gi|83574669|gb|ABC21220.1| [Acyl-carrier-protein] S-malonyltransferase [Rhodospirillum rubrum
           ATCC 11170]
          Length = 312

 Score =  305 bits (782), Expect = 5e-81,   Method: Compositional matrix adjust.
 Identities = 168/312 (53%), Positives = 211/312 (67%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M+    FPGQGSQ +GMG++L D+FP AR VF+EVD  L+Q L  LM  G  +ELT T N
Sbjct: 1   MTRAFVFPGQGSQAVGMGKELADAFPAARDVFQEVDDALSQKLFALMVEGPADELTLTQN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
           AQPAL AVSMA +RV+E  G+ +      VAGHSLGEY+AL AA A  L+DT RL+R RG
Sbjct: 61  AQPALMAVSMAVVRVLETGGVRLAAHADLVAGHSLGEYSALAAAGALGLADTARLLRIRG 120

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           ++MQ+AVP GLG+M A+IGL      S+ A+A+   ICE ANDN  GQVVISG + A++ 
Sbjct: 121 EAMQKAVPVGLGAMAALIGLSLEDARSVAAEAAEGEICEAANDNAPGQVVISGHRTAIER 180

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A      KG KRA+ LPVSAPFH +LM P ++VM   L+ VT + P VP++ N  AS VS
Sbjct: 181 AIVLAKAKGCKRALPLPVSAPFHCALMAPAAEVMAEALERVTFKAPAVPLVANVTASAVS 240

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
              EI RLLVEQVTG VRWRE++ +  + GV  + E+G+GKVL GLAKRI   L A SI 
Sbjct: 241 DPLEIRRLLVEQVTGAVRWRESVLYMVDAGVSELVELGAGKVLGGLAKRIHGDLGARSIQ 300

Query: 301 KVEDIDLALRSI 312
              DID  ++ I
Sbjct: 301 GPADIDAFIKGI 312


>gi|163746683|ref|ZP_02154040.1| malonyl CoA-acyl carrier protein transacylase [Oceanibulbus
           indolifex HEL-45]
 gi|161379797|gb|EDQ04209.1| malonyl CoA-acyl carrier protein transacylase [Oceanibulbus
           indolifex HEL-45]
          Length = 310

 Score =  305 bits (780), Expect = 7e-81,   Method: Compositional matrix adjust.
 Identities = 160/308 (51%), Positives = 208/308 (67%), Gaps = 1/308 (0%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           MS    FPGQG+Q IGMGRDL D++PEAR VF+EVD  L + LS+L+W G  E LT T N
Sbjct: 1   MSIAFVFPGQGAQTIGMGRDLADAYPEARAVFDEVDAALGEKLSELIWEGDIETLTLTQN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
           AQPAL A SMA +  ++  G+ V +  +YVAGHSLGEY+ALCAA + SLSDT RL+R RG
Sbjct: 61  AQPALMATSMAAMAALKAEGITVDK-AAYVAGHSLGEYSALCAAGSLSLSDTARLLRIRG 119

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           K+MQ AVP G G+M AI+GL     + +   A+   +C++AN+N   Q V+SG + AV+ 
Sbjct: 120 KAMQAAVPVGEGAMAAILGLGIEETEKLAEAAAEGEVCQVANENDPSQNVLSGHKAAVER 179

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A     + GAKRA+ LPVSAPFH  LM P ++ M   L  VT  DP VP++ N  A  VS
Sbjct: 180 AVAMAKDAGAKRALLLPVSAPFHCPLMGPAAEEMAKALGEVTFNDPTVPLVANVTAEAVS 239

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
              +IS LLVEQVTGRVRWR +++W A  GV  V+E+G+GK LTG+ +RIDKSL   +I 
Sbjct: 240 DAQKISDLLVEQVTGRVRWRSSVEWMAAQGVTEVWEIGAGKALTGMIRRIDKSLVTRNIG 299

Query: 301 KVEDIDLA 308
             +++  A
Sbjct: 300 TPDEVKAA 307


>gi|154253797|ref|YP_001414621.1| malonyl CoA-acyl carrier protein transacylase [Parvibaculum
           lavamentivorans DS-1]
 gi|154157747|gb|ABS64964.1| malonyl CoA-acyl carrier protein transacylase [Parvibaculum
           lavamentivorans DS-1]
          Length = 313

 Score =  304 bits (779), Expect = 9e-81,   Method: Compositional matrix adjust.
 Identities = 157/313 (50%), Positives = 212/313 (67%), Gaps = 1/313 (0%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           MS   TFPGQGSQ +GMGR+L ++F  AR VF+EV+  L +NLS LMW G QEELT T N
Sbjct: 1   MSRAFTFPGQGSQAVGMGRELAEAFAPAREVFDEVNDALGENLSKLMWEGPQEELTLTEN 60

Query: 61  AQPALTAVSMAFIRVMEKNG-LCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRAR 119
           AQPA+ AVS+A IR +E+ G   +    ++VAGHSLGEY+AL AA AF+L+DT RL++ R
Sbjct: 61  AQPAIMAVSLAVIRTLEREGGFSLAGKAAFVAGHSLGEYSALAAAGAFTLADTARLLKRR 120

Query: 120 GKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVK 179
           G +MQ AVP G G+M A++GL+      + A+A++  +C  ANDNGGGQVV+SG + AV+
Sbjct: 121 GLAMQRAVPVGEGAMAALLGLEFEQAAEVAAEAAQGEVCAAANDNGGGQVVVSGAKAAVE 180

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            A +    KGAKR++ LPVSAPFH SLM P +  M   L +V  + P VP++ N  AS V
Sbjct: 181 RAIEIAKTKGAKRSMLLPVSAPFHCSLMQPAADEMAEALAAVDIKAPSVPLVANVTASRV 240

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
           +    I  LLV+QVTG VRWRE++ +    GV +  EVG+GK L+G+ KRI K    VS+
Sbjct: 241 ADPATIRDLLVQQVTGMVRWRESVLYMEAQGVVNFVEVGAGKALSGMVKRIVKEADLVSV 300

Query: 300 SKVEDIDLALRSI 312
               D++  L+++
Sbjct: 301 GTPADVEAFLKTL 313


>gi|114768972|ref|ZP_01446598.1| acyl-carrier-protein S-malonyltransferase [alpha proteobacterium
           HTCC2255]
 gi|114549889|gb|EAU52770.1| acyl-carrier-protein S-malonyltransferase [alpha proteobacterium
           HTCC2255]
          Length = 311

 Score =  304 bits (779), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 149/289 (51%), Positives = 204/289 (70%), Gaps = 1/289 (0%)

Query: 7   FPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPALT 66
           FPGQG+Q IGMG+DL ++F  A+ VFEEV+  LNQ+LS L+W+G  E LT T NAQPAL 
Sbjct: 6   FPGQGAQAIGMGKDLAENFLVAKNVFEEVNDALNQDLSALIWDGDIETLTLTENAQPALM 65

Query: 67  AVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQEA 126
           A S+A I+ +E  G+   +  SY+AGHSLGEY+ALCAA + SL DT +L+R RGK+MQ+A
Sbjct: 66  ATSIAAIKSLESEGIDFGQ-ASYIAGHSLGEYSALCAAGSLSLMDTAKLLRTRGKAMQDA 124

Query: 127 VPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAADTCL 186
           VP G+G+M AI+GLD   V  +    +   +C+ ANDN  GQVVISG ++AV+   +   
Sbjct: 125 VPFGVGAMAAILGLDFETVSQLTNSIANDQVCQAANDNDPGQVVISGHKNAVEETIELAK 184

Query: 187 NKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSIDEIS 246
           N GAKRA+ LPVSAPFH SLM P +  M   L  +  +DP+VP++ N  A+   + + I 
Sbjct: 185 NAGAKRAILLPVSAPFHCSLMQPAADTMAKALSKIILKDPIVPLVANVKANKEVNGETIK 244

Query: 247 RLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLS 295
            LLVEQVTG VRWRE+I++ ++ GV  VYE+G+GK L+G+ +RID+ ++
Sbjct: 245 DLLVEQVTGSVRWRESIEFISSEGVSEVYEIGAGKALSGMVRRIDREIN 293


>gi|323135850|ref|ZP_08070933.1| malonyl CoA-acyl carrier protein transacylase [Methylocystis sp.
           ATCC 49242]
 gi|322398941|gb|EFY01460.1| malonyl CoA-acyl carrier protein transacylase [Methylocystis sp.
           ATCC 49242]
          Length = 315

 Score =  304 bits (778), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 167/316 (52%), Positives = 209/316 (66%), Gaps = 4/316 (1%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           MS    FPGQGSQ +GMG+ L D F  AR VFEEVD  L+Q LS LM+ G + ELT T N
Sbjct: 1   MSKAFIFPGQGSQAVGMGKALADQFAAARGVFEEVDSALSQPLSGLMFEGPEAELTLTAN 60

Query: 61  AQPALTAVSMAFIRVMEKN-GLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRAR 119
           AQPAL AVS+A IRV+E   GL ++RD ++VAGHSLGEY+AL AA A +++DT +L+R R
Sbjct: 61  AQPALMAVSLAAIRVLEAECGLDLRRDAAFVAGHSLGEYSALAAAGALTIADTAKLLRIR 120

Query: 120 GKSMQEAVPPGLGSMVAIIG--LDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDA 177
           G +MQ+AVP G G+M A++G  LD     +  A A+R   C++ANDNGGGQVVISG + A
Sbjct: 121 GDAMQKAVPVGEGAMAALLGAELDQAREIAGAAAAARSACCQVANDNGGGQVVISGAKAA 180

Query: 178 VKCAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCAS 237
           V+ A D    KG KRAV LPVSAPFH +LM P +  M   L       P VP++ N  A+
Sbjct: 181 VEKAMDIAKEKGIKRAVLLPVSAPFHCALMQPAADAMAEALAGAKIAAPCVPVVANVTAA 240

Query: 238 PVSSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAV 297
           PVS  + I +LLVEQVTG VRWRE + + A  GV    E GSGKVL GL KRI    + +
Sbjct: 241 PVSDPELIRKLLVEQVTGAVRWRECVAFIAGQGVTKFVECGSGKVLAGLLKRIAPQAAGI 300

Query: 298 SISKVEDIDLALRSIV 313
           S+    D+D A R+ V
Sbjct: 301 SVGAPADLD-AYRAFV 315


>gi|119384507|ref|YP_915563.1| malonyl CoA-acyl carrier protein transacylase [Paracoccus
           denitrificans PD1222]
 gi|119374274|gb|ABL69867.1| [Acyl-carrier-protein] S-malonyltransferase [Paracoccus
           denitrificans PD1222]
          Length = 308

 Score =  303 bits (777), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 161/301 (53%), Positives = 203/301 (67%), Gaps = 1/301 (0%)

Query: 5   LTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPA 64
             FPGQG+QV+GMGR+L +++P AR VF EVD  L ++LSDL+WNG  E LT T NAQPA
Sbjct: 4   FVFPGQGAQVVGMGRELAEAYPAAREVFAEVDEALGESLSDLIWNGDIETLTLTQNAQPA 63

Query: 65  LTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQ 124
           L A S+A  R +E  G  ++ D  +VAGHSLGEY+ALCAA A SL DT RL+R RG++MQ
Sbjct: 64  LMATSIAAFRALEAEGFGIQ-DADFVAGHSLGEYSALCAAGALSLGDTARLLRLRGQAMQ 122

Query: 125 EAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAADT 184
           EAVP G G+M AI+GLD   VD I   A+   +C+ ANDN   QVVISG + AV+ AA  
Sbjct: 123 EAVPVGQGAMAAILGLDFAAVDQIARDAAEGEVCQAANDNDPAQVVISGHKAAVERAAAL 182

Query: 185 CLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSIDE 244
              +GAKRA+ LPVSAPFHS+LM P + VM   L +V    P VP++ N  A PV+    
Sbjct: 183 AKERGAKRALMLPVSAPFHSALMQPAAAVMAEALAAVEIAAPAVPLVANVRAEPVTEPGA 242

Query: 245 ISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVED 304
           I RLLVEQVTG VRWRE++ + A  GV   +E+G+GK L+G+ KRI K     +I    D
Sbjct: 243 IRRLLVEQVTGAVRWRESVAFLAGAGVTEFWEIGAGKALSGMIKRIAKDAVVRNIGAPAD 302

Query: 305 I 305
           I
Sbjct: 303 I 303


>gi|85703382|ref|ZP_01034486.1| acyl-carrier-protein S-malonyltransferase [Roseovarius sp. 217]
 gi|85672310|gb|EAQ27167.1| acyl-carrier-protein S-malonyltransferase [Roseovarius sp. 217]
          Length = 327

 Score =  303 bits (777), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 154/305 (50%), Positives = 211/305 (69%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           MS    FPGQG+QVIGMG DL  ++P AR VF+EVD  L Q LS L+W G QE LT T N
Sbjct: 13  MSRAFVFPGQGAQVIGMGADLAANYPAARAVFDEVDEALGQKLSALIWEGEQEALTLTEN 72

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
           AQPAL A S+A +R +E  G+ + +   +VAGHSLGEY+AL AA A S++DT RL+R RG
Sbjct: 73  AQPALMATSLAALRALEAEGVDLAQVAGHVAGHSLGEYSALAAAGAISVADTARLLRIRG 132

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           ++MQ+AVP G+G+M A++GLD      +  +A++  +C+ ANDN  GQVV+SG + AV+ 
Sbjct: 133 QAMQQAVPVGVGAMAALLGLDFETARDVAQEAAQGEVCQAANDNDPGQVVVSGHKGAVER 192

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A D    +GAKRA+ LPVSAPFH +LM P ++VM   L  VT   PVVP++ N  AS V+
Sbjct: 193 ALDLAKARGAKRAMLLPVSAPFHCALMAPAAEVMAAALADVTIHAPVVPLVANVRASAVT 252

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
              EI  LLVEQVTG VRWRE++ + A  GV  ++E+G+GK L+G+ +RI++ ++  +I 
Sbjct: 253 DPAEIRALLVEQVTGSVRWRESVIYMAAQGVTEIWEIGAGKALSGMIRRIEREITCRAIG 312

Query: 301 KVEDI 305
             E++
Sbjct: 313 TSEEV 317


>gi|163736665|ref|ZP_02144084.1| malonyl CoA-acyl carrier protein transacylase [Phaeobacter
           gallaeciensis BS107]
 gi|161390535|gb|EDQ14885.1| malonyl CoA-acyl carrier protein transacylase [Phaeobacter
           gallaeciensis BS107]
          Length = 310

 Score =  303 bits (775), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 151/305 (49%), Positives = 209/305 (68%), Gaps = 1/305 (0%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M+    FPGQG+Q IGMG+ L +++P A+ VF+EVD  L + LS L+W G  E LT T N
Sbjct: 1   MTIAFVFPGQGAQTIGMGKALAEAYPAAKAVFDEVDAALGEALSQLIWEGDIETLTLTQN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
           AQPAL A S+A +R +E  G+ + +  ++VAGHSLGEY+AL AA A S++DT RL+R RG
Sbjct: 61  AQPALMATSLAAMRALEAEGVSIDKP-AFVAGHSLGEYSALAAAGAISVADTARLLRTRG 119

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           ++MQ AVP G G+M AI+GLD   V ++  +A++  +C+ ANDN   QVV+SG + AV+ 
Sbjct: 120 QAMQSAVPVGEGAMAAILGLDLEAVRAVAEEAAQGEVCQAANDNDPTQVVVSGAKAAVER 179

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           AA+    KGAKRAV LPVSAPFH +LM P + VM   L  V    P VP++ N  A  V+
Sbjct: 180 AAEIAKEKGAKRAVMLPVSAPFHCALMQPAADVMAEALADVAITSPAVPLIANVRADAVT 239

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
             DEI +LLVEQVTG VRWRE++Q  A  GV   +E+G+GK L+G+ ++ID++L++  + 
Sbjct: 240 DPDEIRKLLVEQVTGSVRWRESVQSMAAKGVTEFWEIGAGKALSGMIRKIDRNLTSRQVG 299

Query: 301 KVEDI 305
             ED+
Sbjct: 300 TAEDV 304


>gi|163742698|ref|ZP_02150083.1| acyl-carrier-protein S-malonyltransferase [Phaeobacter
           gallaeciensis 2.10]
 gi|161383953|gb|EDQ08337.1| acyl-carrier-protein S-malonyltransferase [Phaeobacter
           gallaeciensis 2.10]
          Length = 310

 Score =  302 bits (774), Expect = 4e-80,   Method: Compositional matrix adjust.
 Identities = 151/305 (49%), Positives = 209/305 (68%), Gaps = 1/305 (0%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M+    FPGQG+Q IGMG+ L +++P A+ VF+EVD  L + LS L+W G  E LT T N
Sbjct: 1   MTIAFVFPGQGAQTIGMGKALAEAYPVAKAVFDEVDAALGEALSQLIWEGDIETLTLTQN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
           AQPAL A S+A +R +E  G+ + +  ++VAGHSLGEY+AL AA A S++DT RL+R RG
Sbjct: 61  AQPALMATSLAAMRALEAEGVSIDK-AAFVAGHSLGEYSALAAAGAISVADTARLLRTRG 119

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           ++MQ AVP G G+M AI+GLD   V ++  +A++  +C+ ANDN   QVV+SG + AV+ 
Sbjct: 120 QAMQSAVPVGEGAMAAILGLDLEAVRAVAEEAAQGEVCQAANDNDPTQVVVSGAKAAVER 179

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           AA+    KGAKRAV LPVSAPFH +LM P + VM   L  V    P VP++ N  A  V+
Sbjct: 180 AAEIAKEKGAKRAVMLPVSAPFHCALMQPAADVMAEALADVAITSPAVPLIANVRADAVT 239

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
             DEI +LLVEQVTG VRWRE++Q  A  GV   +E+G+GK L+G+ ++ID++L++  + 
Sbjct: 240 DPDEIRKLLVEQVTGSVRWRESVQSMAAKGVTEFWEIGAGKALSGMIRKIDRNLTSRQVG 299

Query: 301 KVEDI 305
             ED+
Sbjct: 300 TAEDV 304


>gi|328544023|ref|YP_004304132.1| Malonyl CoA-acyl carrier protein transacylase (MCT) [polymorphum
           gilvum SL003B-26A1]
 gi|326413767|gb|ADZ70830.1| Malonyl CoA-acyl carrier protein transacylase (MCT) [Polymorphum
           gilvum SL003B-26A1]
          Length = 337

 Score =  302 bits (774), Expect = 4e-80,   Method: Compositional matrix adjust.
 Identities = 156/314 (49%), Positives = 213/314 (67%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           MS    FPGQGSQV+GMG+   ++ PEAR VF EVD  L ++LS++MWNG ++ LT T N
Sbjct: 24  MSVAFLFPGQGSQVVGMGKVFAETCPEARAVFAEVDEALGESLSEIMWNGPEDSLTLTAN 83

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
           AQPAL AVS+A +RV+E  G+ +K   S+VAGHSLGEY+AL AA +  ++D  RL+R RG
Sbjct: 84  AQPALMAVSLASMRVLEARGVELKASASFVAGHSLGEYSALAAAGSLKIADAARLLRIRG 143

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           ++MQ AVP G G+M A++GLD      + A+A++  +CE ANDN  GQVV+SG + AV+ 
Sbjct: 144 EAMQAAVPVGQGAMAALLGLDFEAARDVAAEAAQGEVCEAANDNAPGQVVVSGHRAAVER 203

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A +    +GA+RAV LPVSAPFH SLM P +  M   L  V    P VP++ N  A+P++
Sbjct: 204 AVEIAKGRGARRAVLLPVSAPFHCSLMAPAADAMAEALAKVEIVPPAVPLVCNVLAAPIT 263

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
             DEI + LVEQVTG VRWRE++ W A  GV +  E+G+GKVLTG+ KRI    + ++++
Sbjct: 264 DPDEIRKRLVEQVTGTVRWRESVGWLAGQGVDTFVEIGAGKVLTGMVKRIAADGTGLAVN 323

Query: 301 KVEDIDLALRSIVG 314
              D+D  L  + G
Sbjct: 324 APADVDALLERLNG 337


>gi|254475062|ref|ZP_05088448.1| malonyl CoA-acyl carrier protein transacylase [Ruegeria sp. R11]
 gi|214029305|gb|EEB70140.1| malonyl CoA-acyl carrier protein transacylase [Ruegeria sp. R11]
          Length = 311

 Score =  301 bits (770), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 154/308 (50%), Positives = 208/308 (67%), Gaps = 1/308 (0%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M+    FPGQG+Q IGMG+ L +++P A+ VF+EVD  L + LS L+W G  E LT T N
Sbjct: 1   MTIAFVFPGQGAQTIGMGKALAEAYPAAKAVFDEVDTALGEALSQLIWEGDIETLTLTQN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
           AQPAL A S+A +R +E  G+ + +   YVAGHSLGEY+AL AA A S++DT RL+R RG
Sbjct: 61  AQPALMATSLAAMRALEAEGVSIDK-AGYVAGHSLGEYSALAAAGAISVADTARLLRTRG 119

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           ++MQ AVP G G+M AI+GLD   V ++  +A++  +C+ ANDN   QVV+SG + AV+ 
Sbjct: 120 QAMQSAVPVGEGAMAAILGLDLEAVRAVAEEAAQGEVCQAANDNDPTQVVVSGAKAAVER 179

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           AA+    KGAKRAV LPVSAPFH +LM P + VM   L  V  + P VP++ N  A  VS
Sbjct: 180 AAEIAKAKGAKRAVMLPVSAPFHCALMQPAADVMAEALAGVDIKSPAVPLIANVRADAVS 239

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
              EI +LLVEQVTG VRWRE++Q  A  GV   +E+G+GK L+G+ ++ID+SL+   + 
Sbjct: 240 DPAEIRQLLVEQVTGSVRWRESVQTMAAKGVSEFWEIGAGKALSGMIRKIDRSLTCRQVG 299

Query: 301 KVEDIDLA 308
             ED+  A
Sbjct: 300 TPEDVAAA 307


>gi|260433340|ref|ZP_05787311.1| malonyl CoA-acyl carrier protein transacylase [Silicibacter
           lacuscaerulensis ITI-1157]
 gi|260417168|gb|EEX10427.1| malonyl CoA-acyl carrier protein transacylase [Silicibacter
           lacuscaerulensis ITI-1157]
          Length = 334

 Score =  300 bits (769), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 155/311 (49%), Positives = 216/311 (69%), Gaps = 1/311 (0%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M+    FPGQG+Q IGMG+ L D++P A+ VF+EVD  L ++LS L+W+G  E LT T N
Sbjct: 23  MTLAFVFPGQGAQTIGMGKALADAYPAAKAVFDEVDEALGESLSSLIWDGDIETLTLTQN 82

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
           AQPAL A SMA +R +E  G+ V R  ++VAGHSLGEY+AL AA A S++DT RL+R RG
Sbjct: 83  AQPALMATSMAAMRALEAEGVDVTR-AAFVAGHSLGEYSALAAAGALSVADTARLLRTRG 141

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           ++MQ AVP G G+M AI+GLD   V  +  +A++  +C+ ANDN   QVV+SG + AV+ 
Sbjct: 142 QAMQSAVPVGEGAMAAILGLDLDAVRDVAEEAAQGEVCQAANDNDPMQVVVSGAKAAVER 201

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           AA+    KGAKRAV LPVSAPFH +LM P ++VM   L SV  + P VP++ N  A  V+
Sbjct: 202 AAEIAKAKGAKRAVMLPVSAPFHCALMQPAAEVMAEALASVEIKAPAVPLVANVRAEAVT 261

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
             D I +LLVEQVTG VRWRE++Q+    GV   +E+G+GK L+G+ ++ID++++  +I 
Sbjct: 262 DPDLIRQLLVEQVTGSVRWRESVQYMVAQGVTEAWEIGAGKALSGMIRKIDRAVACTAIG 321

Query: 301 KVEDIDLALRS 311
             ED+  A+++
Sbjct: 322 SPEDVQKAIQA 332


>gi|254437480|ref|ZP_05050974.1| malonyl CoA-acyl carrier protein transacylase [Octadecabacter
           antarcticus 307]
 gi|198252926|gb|EDY77240.1| malonyl CoA-acyl carrier protein transacylase [Octadecabacter
           antarcticus 307]
          Length = 312

 Score =  299 bits (766), Expect = 3e-79,   Method: Compositional matrix adjust.
 Identities = 149/301 (49%), Positives = 211/301 (70%), Gaps = 2/301 (0%)

Query: 5   LTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPA 64
             FPGQG+Q IGMG+ +  ++P AR VF+EVD  L++ LSDL+W+G   +LT T NAQPA
Sbjct: 4   FVFPGQGAQTIGMGQAMAQAYPAARAVFDEVDDALSEKLSDLIWSGDIADLTLTRNAQPA 63

Query: 65  LTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQ 124
           L A S+A +R +E  G+ +    S+VAGHSLGEY+AL A+ A S++DT RL+R RG++MQ
Sbjct: 64  LMATSLAAMRALEAEGVTIAA-ASFVAGHSLGEYSALAASGALSVADTARLLRIRGEAMQ 122

Query: 125 EAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAADT 184
           +AVP G+G+M  ++GLD     ++ A+A++  +C+ ANDN   QVV+SG + AV+ A + 
Sbjct: 123 DAVPVGIGAMAVLLGLDFAAAQAVAAEAAQGEVCQAANDNDPSQVVVSGHRSAVERAVEI 182

Query: 185 CLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSIDE 244
               GAKRA+ LPVSAPFHSSLM P + VM   L+ VT   P VP++ N  A  V  +D+
Sbjct: 183 AKAHGAKRAMLLPVSAPFHSSLMGPAADVMAQALEDVTINAPAVPLIANVRAVAV-GVDD 241

Query: 245 ISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVED 304
           I  LLVEQVTG VRWRE++ W A+ GV  V+E+G+GK L+G+ KR+D+S++  +I   +D
Sbjct: 242 IKALLVEQVTGSVRWRESVMWMADAGVTEVWEIGAGKALSGMIKRVDRSIATRAIGAPDD 301

Query: 305 I 305
           +
Sbjct: 302 V 302


>gi|89054115|ref|YP_509566.1| [Acyl-carrier-protein] S-malonyltransferase [Jannaschia sp. CCS1]
 gi|88863664|gb|ABD54541.1| [Acyl-carrier-protein] S-malonyltransferase [Jannaschia sp. CCS1]
          Length = 313

 Score =  298 bits (762), Expect = 8e-79,   Method: Compositional matrix adjust.
 Identities = 158/312 (50%), Positives = 210/312 (67%), Gaps = 1/312 (0%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M+    FPGQG+Q IGMGR L D++P AR VF EVD  L ++LS L+W G  E+LT T N
Sbjct: 1   MTRAFIFPGQGAQTIGMGRALADAYPAARAVFAEVDDALGESLSSLIWEGEIEDLTLTRN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
           AQPAL A S+A +  +   G+ V    SYVAGHSLGEY+AL AA A SL+DT RL+R RG
Sbjct: 61  AQPALMATSLAAMAALGAEGVEVTA-ASYVAGHSLGEYSALAAAGALSLADTARLLRLRG 119

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           ++MQ AVP G G+M AI+GLD   V+ + A+A++  +CE ANDN   QVVISG + AV+ 
Sbjct: 120 EAMQAAVPAGEGAMAAILGLDLANVEEVAAEAAQGDVCEAANDNDPAQVVISGTKAAVER 179

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A D    +GAKRA+ LPVSAPFH +LM P +  M   L  V  + PVVP++ N  A   S
Sbjct: 180 ACDIAKARGAKRALLLPVSAPFHCALMQPAADAMAQALSEVDMEAPVVPLVGNVIAQAES 239

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
           S   I   LV+QVTGRVRWRE++ W A  GV  V+E+G+GK L+G+ KRID++++  ++ 
Sbjct: 240 SAMVIRNNLVDQVTGRVRWRESVLWMAAEGVTEVFEIGAGKALSGMVKRIDRAVTPHAVG 299

Query: 301 KVEDIDLALRSI 312
             ED+  A+ ++
Sbjct: 300 TPEDVTKAVEAL 311


>gi|209964873|ref|YP_002297788.1| malonyl CoA-acyl carrier protein transacylase [Rhodospirillum
           centenum SW]
 gi|209958339|gb|ACI98975.1| malonyl CoA-acyl carrier protein transacylase [Rhodospirillum
           centenum SW]
          Length = 311

 Score =  298 bits (762), Expect = 9e-79,   Method: Compositional matrix adjust.
 Identities = 155/311 (49%), Positives = 205/311 (65%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M+    FPGQGSQ +GMGR+L  +F  AR  F+EVD  L Q LS LM+ G +++LT T N
Sbjct: 1   MTRAFVFPGQGSQAVGMGRELAGAFEIARDTFQEVDEALGQKLSALMFEGPEDQLTLTEN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
           AQPAL AVS+A +RV+E  G+ + R  ++VAGHSLGEY+ALCAA   SL+DT RL++ RG
Sbjct: 61  AQPALMAVSVAVLRVLEAGGVDLARSAAFVAGHSLGEYSALCAAGTLSLADTARLLKLRG 120

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           +SMQ+AVP G+G+M AI+G D      I A A+   +C  ANDN  GQVV+SG + AV+ 
Sbjct: 121 RSMQKAVPVGVGAMAAILGADLEAAQEIAAAAAEGEVCTTANDNAPGQVVVSGHKGAVER 180

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A      +G KRAV LPVSAPFH  LM P +  M   L  VT + P VP++ N  A+ V+
Sbjct: 181 AIRLAAERGFKRAVLLPVSAPFHCPLMQPAADAMAEALAGVTLKAPRVPLVANVTAAAVT 240

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
             + I  LLV+QVTG VRWRE++ +    GV    E+G+GKVL GL KRIDK ++A S+ 
Sbjct: 241 DPEAIRGLLVQQVTGMVRWRESVAYMKQQGVTEAVELGAGKVLAGLVKRIDKEIAATSVG 300

Query: 301 KVEDIDLALRS 311
              D++  L +
Sbjct: 301 TPADVETFLNA 311


>gi|114766137|ref|ZP_01445141.1| acyl-carrier-protein S-malonyltransferase [Pelagibaca bermudensis
           HTCC2601]
 gi|114541597|gb|EAU44639.1| acyl-carrier-protein S-malonyltransferase [Roseovarius sp.
           HTCC2601]
          Length = 313

 Score =  298 bits (762), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 153/306 (50%), Positives = 199/306 (65%), Gaps = 2/306 (0%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           MS    FPGQG+Q IGMG+ L +++P AR VFEEVD  L + LS L+W G  E LT T N
Sbjct: 1   MSRAFIFPGQGAQAIGMGKALAEAYPAARAVFEEVDEALGEKLSTLIWEGEAETLTLTEN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
           AQPAL A S+A +R +E  G+ V    S+VAGHSLGEY+AL AA A S++D  RL+R RG
Sbjct: 61  AQPALMATSLAAMRALEAEGIAVG-AASFVAGHSLGEYSALTAAGALSVADAARLLRTRG 119

Query: 121 KSMQEAVPPGLGSMVAIIGLD-DCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVK 179
           ++MQ+AVP G G+M A++GLD           A   G+C  ANDN   QVVISG +DAV+
Sbjct: 120 RAMQQAVPVGEGAMAALLGLDLATAQAVAAEAAEGGGVCAAANDNDPAQVVISGSKDAVE 179

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            A +    KGAKRAV LPVSAPFH  LM P ++VM   L +V    P VP++ N  AS V
Sbjct: 180 RAVEIAKEKGAKRAVMLPVSAPFHCELMAPAAEVMAEALAAVEIAAPSVPLVANVRASAV 239

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
           +   EI  LLVEQVTG VRWRE++++    GV + +E+G+GK LTG+ +RI +     ++
Sbjct: 240 TDPTEIRALLVEQVTGSVRWRESVEYMVAQGVTAFWEIGAGKALTGMVRRIHRPAGVQTV 299

Query: 300 SKVEDI 305
              ED+
Sbjct: 300 GTPEDV 305


>gi|258542270|ref|YP_003187703.1| malonyl-CoA-[acyl-carrier-protein (ACP)] transacylase [Acetobacter
           pasteurianus IFO 3283-01]
 gi|256633348|dbj|BAH99323.1| malonyl-CoA-[acyl-carrier-protein (ACP)] transacylase [Acetobacter
           pasteurianus IFO 3283-01]
 gi|256636407|dbj|BAI02376.1| malonyl-CoA-[acyl-carrier-protein (ACP)] transacylase [Acetobacter
           pasteurianus IFO 3283-03]
 gi|256639460|dbj|BAI05422.1| malonyl-CoA-[acyl-carrier-protein (ACP)] transacylase [Acetobacter
           pasteurianus IFO 3283-07]
 gi|256642516|dbj|BAI08471.1| malonyl-CoA-[acyl-carrier-protein (ACP)] transacylase [Acetobacter
           pasteurianus IFO 3283-22]
 gi|256645571|dbj|BAI11519.1| malonyl-CoA-[acyl-carrier-protein (ACP)] transacylase [Acetobacter
           pasteurianus IFO 3283-26]
 gi|256648624|dbj|BAI14565.1| malonyl-CoA-[acyl-carrier-protein (ACP)] transacylase [Acetobacter
           pasteurianus IFO 3283-32]
 gi|256651677|dbj|BAI17611.1| malonyl-CoA-[acyl-carrier-protein (ACP)] transacylase [Acetobacter
           pasteurianus IFO 3283-01-42C]
 gi|256654668|dbj|BAI20595.1| malonyl-CoA-[acyl-carrier-protein (ACP)] transacylase [Acetobacter
           pasteurianus IFO 3283-12]
          Length = 314

 Score =  297 bits (761), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 149/307 (48%), Positives = 203/307 (66%), Gaps = 1/307 (0%)

Query: 7   FPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPALT 66
           FPGQGSQ +GMG++L ++FP AR VFEEVD  L + LS +++ G  E LT+T NAQPAL 
Sbjct: 8   FPGQGSQSVGMGQELAEAFPAARSVFEEVDDALGEKLSKIIFEGPMESLTSTENAQPALM 67

Query: 67  AVSMAFIRVMEKNG-LCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQE 125
           AVSMA +RV+E++G L +   ++ +AGHSLGEY+AL A +AF +++  RL+R RG++MQ+
Sbjct: 68  AVSMAVLRVLEQDGGLDLAGKVTLLAGHSLGEYSALAAGRAFGVAEAARLLRLRGQAMQK 127

Query: 126 AVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAADTC 185
           AVP G G M A+IG+     + IC +AS  G  EIANDNGGGQ+VISG    +  A    
Sbjct: 128 AVPAGEGGMAALIGVTLVQAEDICTKASAKGDVEIANDNGGGQIVISGKSAGIDEAIAIA 187

Query: 186 LNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSIDEI 245
                KRA+ LPVSAPFHSSLM P   VM   L       P+VP++ N  A   +  D I
Sbjct: 188 KEMKIKRALKLPVSAPFHSSLMKPAEDVMAEALAKAEITAPIVPVIANVTAERETDADTI 247

Query: 246 SRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVEDI 305
            + LV QVTGRVRWRE++      GV +  E+G+GKVL+GL +RID  ++ +S+    DI
Sbjct: 248 RQNLVRQVTGRVRWRESVAAMVGMGVDTFVEIGAGKVLSGLVRRIDSEVTGLSVGTPADI 307

Query: 306 DLALRSI 312
           +  L+++
Sbjct: 308 ESFLKTL 314


>gi|146277268|ref|YP_001167427.1| malonyl CoA-acyl carrier protein transacylase [Rhodobacter
           sphaeroides ATCC 17025]
 gi|145555509|gb|ABP70122.1| [Acyl-carrier-protein] S-malonyltransferase [Rhodobacter
           sphaeroides ATCC 17025]
          Length = 310

 Score =  297 bits (760), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 154/308 (50%), Positives = 205/308 (66%), Gaps = 1/308 (0%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           MS    FPGQG+Q IGMGR L +++P AR VFEEVD  L + LS L+W GS +ELT T N
Sbjct: 1   MSRAFVFPGQGAQTIGMGRALAEAYPAARAVFEEVDEALGEKLSALIWEGSIDELTLTQN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
           AQPAL A SMA +  +E  GL +    S+VAGHSLGEY+ALCAA++  L+DT RL+R RG
Sbjct: 61  AQPALMATSMAALAALEAEGLGIA-TASFVAGHSLGEYSALCAARSLKLADTARLLRIRG 119

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           ++MQEAVP G+G+M A++GLD      +  +A++  +C+ ANDN   QVV+SG + AV+ 
Sbjct: 120 QAMQEAVPVGVGAMAALLGLDYETAVEVAHEAAQGEVCQAANDNDPAQVVVSGHKAAVER 179

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A +    +GAKRA+ LPVSAPFH +LM   + VM   L +V  + PV P++ N  A  VS
Sbjct: 180 AVEIAKGRGAKRAILLPVSAPFHCALMQHAASVMSEALAAVVIEAPVCPVVVNVRAEAVS 239

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
             D I  LLV QVTG VRWRE++ W  N GV   +E+G+GK L+G+ KRI K  +  +I 
Sbjct: 240 EPDRIRALLVAQVTGAVRWRESVMWMENAGVTEFWEIGAGKALSGMIKRIAKGAATRAIG 299

Query: 301 KVEDIDLA 308
             +D+  A
Sbjct: 300 TPDDVTAA 307


>gi|255264146|ref|ZP_05343488.1| malonyl CoA-acyl carrier protein transacylase [Thalassiobium sp.
           R2A62]
 gi|255106481|gb|EET49155.1| malonyl CoA-acyl carrier protein transacylase [Thalassiobium sp.
           R2A62]
          Length = 312

 Score =  296 bits (759), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 153/308 (49%), Positives = 209/308 (67%), Gaps = 1/308 (0%)

Query: 5   LTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPA 64
             FPGQG+Q IGMG DL  + PEA+ VF+EVD  L +NLS L+W G   ELT T NAQPA
Sbjct: 4   FVFPGQGAQAIGMGHDLATTVPEAQAVFQEVDDALGENLSKLIWGGDIAELTLTQNAQPA 63

Query: 65  LTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQ 124
           L A S+A +R +E  G+ +    S+VAGHSLGEY+AL AA A SL+DT RL+R RGK+MQ
Sbjct: 64  LMATSIAAMRALEARGVSIDA-ASFVAGHSLGEYSALAAAGAISLADTARLLRIRGKAMQ 122

Query: 125 EAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAADT 184
           +AVP G+G+M A++GLD     ++ A+A++  +C+ ANDN   QVV+SG + A++ A D 
Sbjct: 123 DAVPVGVGAMAALLGLDFEAAQAVAAEAAQGDVCQAANDNDPSQVVVSGHKAAIERAVDI 182

Query: 185 CLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSIDE 244
              +GAKRAV LPVSAPFH +LM P +  M   L  V    P VP++ N  A+ VS  DE
Sbjct: 183 AKERGAKRAVLLPVSAPFHCALMQPAADAMATALAEVQISTPAVPVIANVRAAAVSDPDE 242

Query: 245 ISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVED 304
           I  LLVEQVTG VRWRE++Q     GV  ++E+G+GK L+G+ +RI++ ++  ++    D
Sbjct: 243 IRALLVEQVTGSVRWRESVQQMDAEGVTKIWEIGAGKALSGMVRRINRDITCRAVGTSAD 302

Query: 305 IDLALRSI 312
           +D A+ S+
Sbjct: 303 VDAAVASL 310


>gi|329113436|ref|ZP_08242217.1| Malonyl CoA-acyl carrier protein transacylase [Acetobacter pomorum
           DM001]
 gi|326697261|gb|EGE48921.1| Malonyl CoA-acyl carrier protein transacylase [Acetobacter pomorum
           DM001]
          Length = 317

 Score =  296 bits (757), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 151/313 (48%), Positives = 208/313 (66%), Gaps = 9/313 (2%)

Query: 5   LTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPA 64
             FPGQGSQ +GMG++L ++FP AR VFEEVD  L + LS +++ G  E LT+T NAQPA
Sbjct: 9   FVFPGQGSQSVGMGQELAEAFPAARSVFEEVDDALGEKLSKIIFEGPIESLTSTENAQPA 68

Query: 65  LTAVSMAFIRVMEKNG-LCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSM 123
           L AVSMA +RV+E++G L +   ++ +AGHSLGEY+AL A +AF +++  RL+R RG++M
Sbjct: 69  LMAVSMAVLRVLEQDGGLDLAGKVTLLAGHSLGEYSALAAGRAFGVAEAARLLRLRGQAM 128

Query: 124 QEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISG----LQDAVK 179
           Q+AVP G G M A+IG+     + IC +AS  G  EIANDNGGGQ+VISG    + +A+ 
Sbjct: 129 QKAVPAGEGGMAALIGVTLAQAEDICTKASAKGDVEIANDNGGGQIVISGKIAGIDEAIA 188

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            A +  +    KRA+ LPVSAPFHSSLM P   VM   L       P+VP++ N  A   
Sbjct: 189 IAKELKI----KRALKLPVSAPFHSSLMKPAEDVMAEALAKADITAPIVPVIANVTAERE 244

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
           +  D I + LV QVTGRVRWRE++      GV +  E+G+GKVL+GL +RID  +S +S+
Sbjct: 245 TDTDTIRQNLVRQVTGRVRWRESVAAMVGMGVDTFVEIGAGKVLSGLVRRIDAEVSGLSV 304

Query: 300 SKVEDIDLALRSI 312
               DI+  L+++
Sbjct: 305 GTPADIESFLKTL 317


>gi|288958516|ref|YP_003448857.1| [acyl-carrier-protein] S-malonyltransferase [Azospirillum sp. B510]
 gi|288910824|dbj|BAI72313.1| [acyl-carrier-protein] S-malonyltransferase [Azospirillum sp. B510]
          Length = 313

 Score =  295 bits (756), Expect = 4e-78,   Method: Compositional matrix adjust.
 Identities = 168/313 (53%), Positives = 215/313 (68%), Gaps = 1/313 (0%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M+    FPGQGSQ +GMGR+L ++F  AR  FEEVD  LNQ LS LM  G + +LT T N
Sbjct: 1   MTRAFVFPGQGSQAVGMGRELAEAFEVARHTFEEVDDALNQRLSRLMVEGPEADLTLTEN 60

Query: 61  AQPALTAVSMAFIRVM-EKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRAR 119
           AQPAL AVS+A +RV+  + G+ + R  S+VAGHSLGEY+ALCAA AFSL+DT RL++ R
Sbjct: 61  AQPALMAVSVAVMRVLASEGGVDLSRHASFVAGHSLGEYSALCAAGAFSLADTARLLKLR 120

Query: 120 GKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVK 179
           G++MQ+AVP G G+M A++G D     +I A A++  +C IANDN  GQVVISG  DA+ 
Sbjct: 121 GQAMQKAVPVGKGAMAALLGADLEQARAIAADAAQGEVCSIANDNSVGQVVISGGADAID 180

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            A      +G KR+V LPVSAPFH +LM P +  M   L +VT   PVVP++ N  AS V
Sbjct: 181 RAIVLAAERGLKRSVRLPVSAPFHCALMQPAADAMAEALGNVTISAPVVPVVANVTASAV 240

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
           S  + I RLLVEQVTG VRWRE +      GV+ + EVGSGKVL GLAKRIDK L+AVS+
Sbjct: 241 SDPNAIRRLLVEQVTGMVRWRECVLSMKEQGVERLVEVGSGKVLAGLAKRIDKDLAAVSV 300

Query: 300 SKVEDIDLALRSI 312
               D++  L+++
Sbjct: 301 GTPADVESFLKTL 313


>gi|84684852|ref|ZP_01012752.1| acyl-carrier-protein S-malonyltransferase [Maritimibacter
           alkaliphilus HTCC2654]
 gi|84667187|gb|EAQ13657.1| acyl-carrier-protein S-malonyltransferase [Rhodobacterales
           bacterium HTCC2654]
          Length = 297

 Score =  295 bits (756), Expect = 4e-78,   Method: Compositional matrix adjust.
 Identities = 147/298 (49%), Positives = 204/298 (68%), Gaps = 1/298 (0%)

Query: 17  MGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPALTAVSMAFIRVM 76
           MGRDL +++P AR VF+EVD  L   LS+++WNG Q+ELT T NAQPAL A S+A +R +
Sbjct: 1   MGRDLAEAYPAARAVFDEVDEALGIKLSNIIWNGEQDELTLTQNAQPALMATSLAAMRAL 60

Query: 77  EKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQEAVPPGLGSMVA 136
           E  G+ +     +VAGHSLGEY+AL AA A ++SDT RL+R RG++MQ+AVP G+G+M A
Sbjct: 61  EAEGVTMDA-AGFVAGHSLGEYSALAAAGALTVSDTARLLRTRGEAMQKAVPVGVGAMAA 119

Query: 137 IIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAADTCLNKGAKRAVFL 196
           ++GLD     ++  +A++  +C+ ANDN   QVV+SG + AV+ A +    KGA+RAV L
Sbjct: 120 LLGLDFEAAKAVAEEAAQGEVCQAANDNDPAQVVVSGHKAAVERAVEIAKEKGARRAVML 179

Query: 197 PVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSIDEISRLLVEQVTGR 256
           PVSAPFH +LM P + VM   L  VT   P VP++ N  A  VS  D I  LL+EQVTG 
Sbjct: 180 PVSAPFHCALMQPAADVMAEALAGVTINAPAVPVVANVRAEAVSDPDTIRALLIEQVTGS 239

Query: 257 VRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVEDIDLALRSIVG 314
           VRWRE++ W A +GV   +E+G+GK LTG+ +RIDKSL+ ++I   +++ +A     G
Sbjct: 240 VRWRESVAWMAANGVTETWEIGAGKALTGMIRRIDKSLNTLTIGAPDEVKVAAEQAAG 297


>gi|254467339|ref|ZP_05080750.1| malonyl CoA-acyl carrier protein transacylase [Rhodobacterales
           bacterium Y4I]
 gi|206688247|gb|EDZ48729.1| malonyl CoA-acyl carrier protein transacylase [Rhodobacterales
           bacterium Y4I]
          Length = 312

 Score =  295 bits (755), Expect = 5e-78,   Method: Compositional matrix adjust.
 Identities = 154/311 (49%), Positives = 209/311 (67%), Gaps = 1/311 (0%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M+    FPGQG+Q IGMG+ L D++P A+ +F+EVD  L ++LS L+W G  E LT T N
Sbjct: 1   MTIAFVFPGQGAQTIGMGKALADAYPAAKAIFDEVDEALGESLSQLIWAGDIETLTLTQN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
           AQPAL A SMA +R +E  G+ + +  ++VAGHSLGEY+AL AA A S++DT RL+R RG
Sbjct: 61  AQPALMATSMAAMRALEAEGVTIGK-AAFVAGHSLGEYSALAAAGAVSVTDTARLLRTRG 119

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
            +MQ AVP G G+M AI+GLD   V ++  +A++  +C+ ANDN   QVV+SG + AV+ 
Sbjct: 120 LAMQSAVPVGEGAMAAILGLDLDAVRAVAEEAAQGEVCQAANDNDPTQVVVSGAKAAVER 179

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           AA+    KGAKRAV LPVSAPFH +LM P +  M   L  V  + P VP++ N  A  V+
Sbjct: 180 AAEIAKEKGAKRAVMLPVSAPFHCALMQPAADAMAEALAGVEIKSPAVPLIANVRADAVT 239

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
           S DEI  LLVEQVTG VRWRE++Q  A  GV   +E+G+GK L+G+ ++ID++L+   + 
Sbjct: 240 SPDEIRALLVEQVTGSVRWRESVQAMAAKGVTEFWEIGAGKALSGMIRKIDRNLACRQVG 299

Query: 301 KVEDIDLALRS 311
             ED   A  S
Sbjct: 300 TPEDAKAAAES 310


>gi|182679256|ref|YP_001833402.1| malonyl CoA-acyl carrier protein transacylase [Beijerinckia indica
           subsp. indica ATCC 9039]
 gi|182635139|gb|ACB95913.1| malonyl CoA-acyl carrier protein transacylase [Beijerinckia indica
           subsp. indica ATCC 9039]
          Length = 324

 Score =  295 bits (754), Expect = 7e-78,   Method: Compositional matrix adjust.
 Identities = 160/316 (50%), Positives = 208/316 (65%), Gaps = 6/316 (1%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           MS    FPGQGSQ +GMG+ LY+SF  AR VF+EVD  L + LS L++ G + +LT T N
Sbjct: 5   MSKAFVFPGQGSQAVGMGKALYESFAPARAVFDEVDEALGERLSTLIFEGPEADLTLTAN 64

Query: 61  AQPALTAVSMAFIRVMEKNG-LCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRAR 119
           AQPAL AVS+A +RV+E    L + RD +YVAGHSLGEY+AL AA + +L+ T RL+R R
Sbjct: 65  AQPALMAVSLAVVRVLEAEADLDLARDATYVAGHSLGEYSALAAAGSLTLATTARLLRQR 124

Query: 120 GKSMQEAVPPGLGSMVAIIGLDD----CVVDSICAQASRVGICEIANDNGGGQVVISGLQ 175
           G +MQ AVP G+G+M A++GLD      V     A+     +C IANDNGGGQVV SG +
Sbjct: 125 GAAMQSAVPVGVGAMAALLGLDYETGLAVTKQAEAETGENAVCAIANDNGGGQVVASGSK 184

Query: 176 DAVKCAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFC 235
            AV  A +    KGAKR++ LPVSAPFH  LM P + VM   L  V+ + P VP++ N  
Sbjct: 185 AAVMRAMEIAKEKGAKRSMLLPVSAPFHCPLMAPAAAVMAEALAEVSIRPPCVPLVANVI 244

Query: 236 ASPVSSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLS 295
           A+PV+  ++I  LLV QVTG VRWRE++ + A  GV    E GSGKVLTGL KRI     
Sbjct: 245 AAPVTDPEKIRSLLVSQVTGTVRWRESVAFMAAEGVDLFIECGSGKVLTGLLKRIAPQAR 304

Query: 296 AVSISKVEDIDLALRS 311
            ++I +  D++ ALR+
Sbjct: 305 GLTIGQPADLE-ALRA 319


>gi|240137132|ref|YP_002961601.1| malonyl-CoA-[acyl-carrier-protein] transacylase [Methylobacterium
           extorquens AM1]
 gi|240007098|gb|ACS38324.1| malonyl-CoA-[acyl-carrier-protein] transacylase [Methylobacterium
           extorquens AM1]
          Length = 294

 Score =  295 bits (754), Expect = 8e-78,   Method: Compositional matrix adjust.
 Identities = 145/290 (50%), Positives = 195/290 (67%), Gaps = 1/290 (0%)

Query: 17  MGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPALTAVSMAFIRVM 76
           MG+ L ++FP AR VFEEVD  L QNLS LM+ G  +ELT T NAQPAL A S+A +R +
Sbjct: 1   MGKALSEAFPAARQVFEEVDAALGQNLSRLMFEGPSDELTLTANAQPALMAASLAVLRTL 60

Query: 77  E-KNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQEAVPPGLGSMV 135
           E + GL + RD ++VAGHSLGEY+AL AA  FS+SDT RL+R RG++MQ AV PG+G+M 
Sbjct: 61  EAERGLDLARDAAFVAGHSLGEYSALAAAGTFSISDTARLLRIRGEAMQRAVAPGIGAMA 120

Query: 136 AIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAADTCLNKGAKRAVF 195
           A+IG D      I  +A+   +C++ANDNGGGQVV+SG ++AV+ A     ++G +RAV 
Sbjct: 121 ALIGPDLATARDIAGEAAEGLVCDVANDNGGGQVVLSGHREAVERAMALAQSRGVRRAVL 180

Query: 196 LPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSIDEISRLLVEQVTG 255
           L VSAPFH +LM P ++ M+  L  V    P VP+  N  A P++  D I   L+ QVTG
Sbjct: 181 LNVSAPFHCALMAPAAEAMRRALAEVPMHAPAVPVYANVTAGPLTEPDAIRNALITQVTG 240

Query: 256 RVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVEDI 305
            VRW E++   A  GV   +E+G+GKVLTGL KRI  S +A ++   +D+
Sbjct: 241 TVRWSESVAAMAEAGVDRFFELGAGKVLTGLVKRIAPSATASAVGTPDDV 290


>gi|126739368|ref|ZP_01755061.1| malonyl CoA-acyl carrier protein transacylase [Roseobacter sp.
           SK209-2-6]
 gi|126719468|gb|EBA16177.1| malonyl CoA-acyl carrier protein transacylase [Roseobacter sp.
           SK209-2-6]
          Length = 319

 Score =  295 bits (754), Expect = 8e-78,   Method: Compositional matrix adjust.
 Identities = 152/312 (48%), Positives = 209/312 (66%), Gaps = 2/312 (0%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M+    FPGQG+Q IGMG+ L ++FP A+ VFEEVD  L + LSDL+W G  E LT T N
Sbjct: 9   MTIAFVFPGQGAQTIGMGKALAEAFPAAKSVFEEVDDALGEKLSDLIWEGEIETLTLTQN 68

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
           AQPAL A S+A ++ +E  G+ +++   +VAGHSLGEY+AL AA A SL+DT RL+R RG
Sbjct: 69  AQPALMATSIAAMKALEAEGITIEK-AGFVAGHSLGEYSALAAAGAISLADTARLLRTRG 127

Query: 121 KSMQEAVPPGLGSMVAIIGLD-DCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVK 179
           ++MQ AVP G+G+M A++GLD   V +     A+   + + ANDN   QVV+SG + AV+
Sbjct: 128 QAMQSAVPVGVGAMAALLGLDFATVKEVAAEAAAEGEVVQAANDNDPTQVVVSGHKAAVE 187

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            AA+   ++GAKRAV LPVSAPFH +LM P + VM   L +V  Q P VP++ N  A  V
Sbjct: 188 RAAEIAKSRGAKRAVMLPVSAPFHCALMQPAADVMAEALTAVEIQAPKVPLIANVRADEV 247

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
           +    I  LLVEQVTG VRWRE++Q  A  GV   +E+G+GK L+G+ ++ID+SL++  +
Sbjct: 248 TDPALIRELLVEQVTGSVRWRESVQAMAAKGVTEFWEIGAGKALSGMIRKIDRSLASRQV 307

Query: 300 SKVEDIDLALRS 311
               D+  AL +
Sbjct: 308 GTDADVKAALEA 319


>gi|84517313|ref|ZP_01004667.1| acyl-carrier-protein S-malonyltransferase [Loktanella vestfoldensis
           SKA53]
 gi|84508793|gb|EAQ05256.1| acyl-carrier-protein S-malonyltransferase [Loktanella vestfoldensis
           SKA53]
          Length = 312

 Score =  294 bits (753), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 153/301 (50%), Positives = 206/301 (68%), Gaps = 1/301 (0%)

Query: 5   LTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPA 64
             FPGQG+Q IGMGR L  ++P A+ VF+EVD  L +NLS L+W G  + LT T NAQPA
Sbjct: 4   FVFPGQGAQTIGMGRALAMAYPAAKAVFDEVDDALGENLSALIWEGDIDTLTLTQNAQPA 63

Query: 65  LTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQ 124
           L A S+A IR +E  G+ V     +VAGHSLGEY AL AA+A +++DT RL+R RG++MQ
Sbjct: 64  LMATSLATIRALEAEGVDVTA-ARFVAGHSLGEYAALAAARALTIADTARLLRVRGRAMQ 122

Query: 125 EAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAADT 184
           +AVP G+G+M  ++GLD     ++  +A++  +CE ANDN  GQVV+SG + AV+ A + 
Sbjct: 123 DAVPVGVGAMAVLLGLDFDQARAVAEEAAQGEVCEAANDNDPGQVVVSGHKAAVERALEI 182

Query: 185 CLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSIDE 244
              KGAKRA+ LPVSAPFH SLM P + VM   LD V+   PVV ++ N  A  VS   +
Sbjct: 183 AKLKGAKRAMLLPVSAPFHCSLMAPAADVMAQALDGVSITPPVVGLVANVLADVVSDPAQ 242

Query: 245 ISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVED 304
           I +LLV QVTG VRWRE++ + A  GV  VYE+G+GK L+G+ KRI++ L+A +I   ED
Sbjct: 243 IRKLLVAQVTGSVRWRESVAFMAAQGVTHVYEIGAGKALSGMVKRINRDLAATAIGTPED 302

Query: 305 I 305
           +
Sbjct: 303 V 303


>gi|300023229|ref|YP_003755840.1| malonyl CoA-acyl carrier protein transacylase [Hyphomicrobium
           denitrificans ATCC 51888]
 gi|299525050|gb|ADJ23519.1| malonyl CoA-acyl carrier protein transacylase [Hyphomicrobium
           denitrificans ATCC 51888]
          Length = 315

 Score =  294 bits (752), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 152/300 (50%), Positives = 205/300 (68%), Gaps = 1/300 (0%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M+    FPGQGSQ +GMG+ L ++FP A+ VF+EVD  L Q LS ++W G +E LT T N
Sbjct: 1   MARAFVFPGQGSQDVGMGKALAEAFPSAKAVFDEVDDALGQKLSAIIWEGPKETLTLTEN 60

Query: 61  AQPALTAVSMAFIRVMEK-NGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRAR 119
           AQPAL AVSMA +RV+EK  G  +   + +VAGHSLGEY+AL AA AFSL+D  RL++ R
Sbjct: 61  AQPALMAVSMAVMRVLEKEKGFSLADKVKFVAGHSLGEYSALAAAGAFSLADAARLLKLR 120

Query: 120 GKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVK 179
           G++MQ+AVP G+G+M A++G+     + + A+A++  +C++ANDN   Q+V+SG + A+ 
Sbjct: 121 GQAMQKAVPVGVGAMAALLGVGAEAAEKVAAEAAQGDVCQVANDNDPTQIVLSGHKTAID 180

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
             A+     G +RAV LPVSAPFH +LM P +  M   L +VT   PVVP++ N  A+P+
Sbjct: 181 RVAEIGKKYGVRRAVPLPVSAPFHCALMQPAADAMAEALATVTVNKPVVPVVANVLAAPI 240

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
           S  DEI + LVEQVTG VRWRE +   A  GV   YE+G+GKVL GL KR   S SAVS+
Sbjct: 241 SDPDEIRKRLVEQVTGTVRWRECVAAMAADGVTEFYEIGAGKVLAGLVKRTAASASAVSL 300


>gi|110680232|ref|YP_683239.1| malonyl CoA-acyl carrier protein transacylase [Roseobacter
           denitrificans OCh 114]
 gi|109456348|gb|ABG32553.1| malonyl CoA-acyl carrier protein transacylase [Roseobacter
           denitrificans OCh 114]
          Length = 310

 Score =  294 bits (752), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 146/311 (46%), Positives = 204/311 (65%), Gaps = 1/311 (0%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           MS    FPGQG+Q +GMGR L +++P+A+ VF+EVD  L + LS L+W G  E LT T N
Sbjct: 1   MSIAFVFPGQGAQTVGMGRALAEAYPDAQAVFDEVDDALGEKLSALIWEGDIETLTLTQN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
           AQPAL A SMA IR +   G+ ++R +S+VAGHSLGEY+AL AA  FS++DT RL+R RG
Sbjct: 61  AQPALMATSMAAIRALAAEGVGMER-LSFVAGHSLGEYSALAAAGTFSIADTARLLRTRG 119

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
            +MQ AVP G G+M A++GLD      + A+A++  +C+IAN+N   Q V+SG + AV+ 
Sbjct: 120 LAMQRAVPVGEGAMAAVLGLDFDTATDVAARAAQGQVCQIANENDPAQNVVSGEKGAVER 179

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A       GAKRA+ LPVSAPFH +LM P +K M   L+ V    P VP++ N   + V 
Sbjct: 180 AIVLAKEAGAKRALMLPVSAPFHCALMAPAAKEMAQALEEVEMSAPQVPLVANVLGTAVE 239

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
               I  LL++QVTG+VRW+ +++W A  GV   +E+G+GK L+G+ +RI K   + +I 
Sbjct: 240 DPARIKELLIDQVTGQVRWKTSVEWMAAQGVTEFWEIGAGKALSGMIRRIAKDSVSRAIG 299

Query: 301 KVEDIDLALRS 311
             EDI  A+ +
Sbjct: 300 TPEDIKAAVNA 310


>gi|326403717|ref|YP_004283799.1| malonyl CoA-acyl carrier protein transacylase [Acidiphilium
           multivorum AIU301]
 gi|325050579|dbj|BAJ80917.1| malonyl CoA-acyl carrier protein transacylase [Acidiphilium
           multivorum AIU301]
          Length = 319

 Score =  293 bits (750), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 153/297 (51%), Positives = 198/297 (66%), Gaps = 5/297 (1%)

Query: 7   FPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPALT 66
           FPGQGSQV+GMGRDL  +F  AR VFEEVD  L Q LS LM+ G  EELT T NAQPAL 
Sbjct: 8   FPGQGSQVVGMGRDLAAAFAPAREVFEEVDEVLKQKLSRLMFEGPAEELTLTENAQPALM 67

Query: 67  AVSMAFIRVMEKN-GLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQE 125
           A+S+A +R +EK  G+ +    + VAGHSLGEY+AL AA  F+L+D  RL+R RG +MQ+
Sbjct: 68  AMSIAVLRCLEKEAGIRIADRAAVVAGHSLGEYSALAAAGTFALADAARLLRIRGNAMQK 127

Query: 126 AVPPGLGSMVAIIGLDDCVVDSICAQASR----VGICEIANDNGGGQVVISGLQDAVKCA 181
           AVPPGLG+M A++G++    +SIC +A+       +  +ANDNGGGQVVISG   AV  A
Sbjct: 128 AVPPGLGAMAALLGVELDAAESICTEAAEGPDGHEVVSVANDNGGGQVVISGTATAVDRA 187

Query: 182 ADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSS 241
            +    +G KRA+ LPVSAPFH +LM P ++ M+  L  V    PVVP++ N  A+ V+ 
Sbjct: 188 IEIARGRGVKRALKLPVSAPFHCALMAPAAEAMREALAGVAVNAPVVPLIANVTAAKVTD 247

Query: 242 IDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVS 298
             +I   LVEQVT  VRWRE++      GV    E+G+GKVL+GLA+RI     A+S
Sbjct: 248 PADIVAKLVEQVTAPVRWRESVATMTALGVTRFIELGAGKVLSGLARRIAPDAEALS 304


>gi|259418798|ref|ZP_05742715.1| malonyl CoA-acyl carrier protein transacylase [Silicibacter sp.
           TrichCH4B]
 gi|259345020|gb|EEW56874.1| malonyl CoA-acyl carrier protein transacylase [Silicibacter sp.
           TrichCH4B]
          Length = 311

 Score =  293 bits (749), Expect = 3e-77,   Method: Compositional matrix adjust.
 Identities = 151/315 (47%), Positives = 210/315 (66%), Gaps = 6/315 (1%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           MS    FPGQG+Q IGMG+ L D++P A+ VF+EVD  L ++LS L+W G  E LT T N
Sbjct: 1   MSIAFVFPGQGAQTIGMGKALADAYPAAKAVFDEVDAALGESLSSLIWEGDIETLTLTQN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
           AQPAL A SMA +R +E  G+ + +  ++VAGHSLGEY+AL A+ A S++DT RL+R RG
Sbjct: 61  AQPALMATSMAAMRALEAEGVSIDK-AAFVAGHSLGEYSALAASGALSIADTARLLRTRG 119

Query: 121 KSMQEAVPPGLGSMVAIIGLD-DCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVK 179
           ++MQ AVP G+G+M A++GLD + V       A+   + + ANDN   QVV+SG + AV+
Sbjct: 120 QAMQSAVPVGVGAMAALLGLDFETVKAVAAEAAAEGEVVQAANDNDPTQVVVSGHKAAVE 179

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            AA+    KGAKRAV LPVSAPFH +LM P + VM   L  V  + P VP++ N  A  V
Sbjct: 180 RAAEIAKEKGAKRAVMLPVSAPFHCALMQPAADVMAEALAGVEIKAPAVPLIANVRADAV 239

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
           +  D I +LLVEQVTG VRWRE+++  A  GV   +E+G+GK L+G+ ++ID++L    +
Sbjct: 240 TDPDTIRQLLVEQVTGSVRWRESVEAMAAKGVIEFWEIGAGKALSGMIRKIDRAL----V 295

Query: 300 SKVEDIDLALRSIVG 314
           SK    D  ++++ G
Sbjct: 296 SKQVGTDADVKAVSG 310


>gi|85716343|ref|ZP_01047316.1| acyl-carrier-protein S-malonyltransferase [Nitrobacter sp. Nb-311A]
 gi|85696859|gb|EAQ34744.1| acyl-carrier-protein S-malonyltransferase [Nitrobacter sp. Nb-311A]
          Length = 303

 Score =  292 bits (747), Expect = 5e-77,   Method: Compositional matrix adjust.
 Identities = 146/290 (50%), Positives = 202/290 (69%), Gaps = 1/290 (0%)

Query: 17  MGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPALTAVSMAFIRVM 76
           MG+ L ++FP A++VF+EVD  L + L+  +W+G  E L  T NAQPAL AVS+A +RV+
Sbjct: 1   MGKALAEAFPVAKVVFDEVDAALGEKLTATIWDGPAETLQLTENAQPALMAVSIAALRVL 60

Query: 77  E-KNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQEAVPPGLGSMV 135
           E + G  V+RD ++VAGHSLGEY+AL AA + S++DT RL+R RG +MQ+AVP G G+M 
Sbjct: 61  EAEAGFSVERDAAFVAGHSLGEYSALAAAGSLSIADTARLLRTRGLAMQKAVPVGAGAMA 120

Query: 136 AIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAADTCLNKGAKRAVF 195
           A++GLD     ++  +A++  +C+ ANDNGGGQVV+SG + AV  A +    KGA+RA+ 
Sbjct: 121 ALLGLDYEAAMAVADEAAQGQVCQAANDNGGGQVVVSGDKAAVDRAVEIAKAKGARRAML 180

Query: 196 LPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSIDEISRLLVEQVTG 255
           LPVSAPFH  LM P + VM   L  VT   PVVP++ N  A+P+++ DEI + L+EQVTG
Sbjct: 181 LPVSAPFHCRLMQPAADVMAKALADVTISTPVVPVISNVLAAPITNPDEIRQRLIEQVTG 240

Query: 256 RVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVEDI 305
            VRWRE+I + A HGV   +E+G+GKVL+GL KRI      V++    DI
Sbjct: 241 TVRWRESIAYMAEHGVTRFFEIGAGKVLSGLVKRIADGAIGVAVGGPNDI 290


>gi|254486565|ref|ZP_05099770.1| malonyl CoA-acyl carrier protein transacylase [Roseobacter sp.
           GAI101]
 gi|214043434|gb|EEB84072.1| malonyl CoA-acyl carrier protein transacylase [Roseobacter sp.
           GAI101]
          Length = 310

 Score =  292 bits (747), Expect = 6e-77,   Method: Compositional matrix adjust.
 Identities = 147/299 (49%), Positives = 202/299 (67%), Gaps = 1/299 (0%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           MS    +PGQG+Q IGMGRDL D++P A+ VF+EVD  L + LS L+W G  E LT T N
Sbjct: 1   MSIAFVYPGQGAQTIGMGRDLADAYPAAKAVFDEVDEALGEKLSTLIWEGDAEALTLTQN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
           AQPAL A SMA +  +   G+ + +  ++VAGHSLGEY ALCAA  FSL+DT RL+R RG
Sbjct: 61  AQPALMATSMAAMAALNAEGITIDK-AAFVAGHSLGEYAALCAAGTFSLADTARLLRIRG 119

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           ++MQ AVP G G+M A++GL     + + A A++  +C++AN N   Q V+SG + AV+ 
Sbjct: 120 RAMQAAVPVGQGAMAALLGLSFEQAEQVAADAAQGDVCQVANQNDPAQNVVSGSKAAVER 179

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A D     GAKRA+ LPVSAPFH +LM P ++ M   L  VT   P VP++ N  A  VS
Sbjct: 180 AVDLAKAAGAKRALLLPVSAPFHCALMAPAAEEMAGALADVTMHAPSVPVVANVIAQAVS 239

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
             D+I +LLVEQVTG+VRW  +++W A  GV  ++E+G+GK L+G+ +RI+K ++ V+I
Sbjct: 240 DPDQIRKLLVEQVTGQVRWLSSVEWMAAQGVTEIWEIGAGKALSGMIRRINKEITCVNI 298


>gi|148260525|ref|YP_001234652.1| malonyl CoA-acyl carrier protein transacylase [Acidiphilium cryptum
           JF-5]
 gi|146402206|gb|ABQ30733.1| malonyl CoA-acyl carrier protein transacylase [Acidiphilium cryptum
           JF-5]
          Length = 319

 Score =  291 bits (746), Expect = 6e-77,   Method: Compositional matrix adjust.
 Identities = 152/297 (51%), Positives = 197/297 (66%), Gaps = 5/297 (1%)

Query: 7   FPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPALT 66
           FPGQGSQV+GMGRDL  +F  AR VFEEVD  L Q LS LM+ G  EELT T NAQPAL 
Sbjct: 8   FPGQGSQVVGMGRDLAAAFAPAREVFEEVDEVLKQKLSRLMFEGPAEELTLTENAQPALM 67

Query: 67  AVSMAFIRVMEKN-GLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQE 125
           A+S+A +R +EK  G+ +    + VAGHSLGEY+AL AA  F+L+D  RL+R RG +MQ+
Sbjct: 68  AMSIAVLRCLEKEAGIRIADRAAVVAGHSLGEYSALAAAGTFALADAARLLRIRGNAMQK 127

Query: 126 AVPPGLGSMVAIIGLDDCVVDSICAQASR----VGICEIANDNGGGQVVISGLQDAVKCA 181
           AVPPGLG+M A++G++    +SIC +A+       +  +ANDNGGGQVVISG   AV  A
Sbjct: 128 AVPPGLGAMAALLGVELDAAESICTEAAEGPDGHEVVSVANDNGGGQVVISGTATAVDRA 187

Query: 182 ADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSS 241
            +    +G KRA+ LPVSAPFH +LM P ++ M+  L  V    PVVP++ N  A+  + 
Sbjct: 188 IEIARGRGVKRALKLPVSAPFHCALMAPAAEAMREALAGVAVNAPVVPLIANVTAAKATD 247

Query: 242 IDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVS 298
             +I   LVEQVT  VRWRE++      GV    E+G+GKVL+GLA+RI     A+S
Sbjct: 248 PADIVAKLVEQVTAPVRWRESVATMTALGVTRFIELGAGKVLSGLARRIAPDAEALS 304


>gi|254510229|ref|ZP_05122296.1| malonyl CoA-acyl carrier protein transacylase [Rhodobacteraceae
           bacterium KLH11]
 gi|221533940|gb|EEE36928.1| malonyl CoA-acyl carrier protein transacylase [Rhodobacteraceae
           bacterium KLH11]
          Length = 317

 Score =  291 bits (746), Expect = 6e-77,   Method: Compositional matrix adjust.
 Identities = 155/309 (50%), Positives = 213/309 (68%), Gaps = 1/309 (0%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M+    FPGQG+Q IGMG+ L +++P AR VF+EVD  L + LSDL+W+G   +LT T N
Sbjct: 6   MTRAFVFPGQGAQTIGMGKALAEAYPAARAVFDEVDEALGEKLSDLIWDGDIADLTLTQN 65

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
           AQPAL A S+A +R +E  G  +    SYVAGHSLGEY+AL AA A S++DT RL+R RG
Sbjct: 66  AQPALMATSIAALRALEAEGASISM-ASYVAGHSLGEYSALAAAGALSVADTARLLRTRG 124

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           ++MQ AVP G G+M AI+GLD   V ++ A+A++  +C+ ANDN   QVV+SG + AV+ 
Sbjct: 125 QAMQSAVPVGEGAMAAILGLDLEAVRAVAAEAAQGEVCQAANDNDPTQVVVSGDKAAVER 184

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           AA+    KGAKRA+ LPVSAPFH +LM P + VM   L +V  + P VP++ N  A  VS
Sbjct: 185 AAEIAKEKGAKRAIMLPVSAPFHCALMQPAADVMAEALAAVEIKAPAVPLVANVRAEAVS 244

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
             D I +LLVEQVTG VRWRE++Q+    GV   +E+G+GK L+G+ ++ID++LS  ++ 
Sbjct: 245 DPDTIRQLLVEQVTGAVRWRESVQYMVAQGVTEAWEIGAGKALSGMIRKIDRALSFQAVG 304

Query: 301 KVEDIDLAL 309
             ED+  A+
Sbjct: 305 SPEDVQKAV 313


>gi|114328876|ref|YP_746033.1| malonyl-CoA-[acyl-carrier-protein] transacylase [Granulibacter
           bethesdensis CGDNIH1]
 gi|114317050|gb|ABI63110.1| malonyl-CoA-[acyl-carrier-protein] transacylase [Granulibacter
           bethesdensis CGDNIH1]
          Length = 323

 Score =  291 bits (746), Expect = 7e-77,   Method: Compositional matrix adjust.
 Identities = 155/313 (49%), Positives = 201/313 (64%), Gaps = 7/313 (2%)

Query: 7   FPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPALT 66
           FPGQGSQ +GMGRDL D+FP AR VFEEVD TL Q LS LM++G  E+LT T N QPAL 
Sbjct: 11  FPGQGSQFVGMGRDLADAFPIAREVFEEVDDTLGQKLSRLMFDGPAEDLTLTENTQPALM 70

Query: 67  AVSMAFIRVMEKNG-LCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQE 125
           A+SMA +RV+EK G   +    + VAGHSLGEY+AL AA A S+++   L+R RG++MQ 
Sbjct: 71  AMSMAVLRVLEKEGGFILPARAAVVAGHSLGEYSALSAANALSVAEAALLLRLRGQAMQN 130

Query: 126 AVPPGLGSMVAIIGLDDCVVDSICAQAS------RVGICEIANDNGGGQVVISGLQDAVK 179
           AVPPG G M A+IG+D     SIC +A+      R  + + ANDNGGGQVVISG + A+ 
Sbjct: 131 AVPPGEGGMAALIGVDMDQAASICEEATTDPETGRHEVIQPANDNGGGQVVISGHRGAID 190

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            A +    +G KRAV LPVSAPFHS+LM P + VM   L       P+VP++ N  A+  
Sbjct: 191 RAIEVARARGVKRAVLLPVSAPFHSALMAPAADVMAQALAEHPLHAPLVPVIANVTAAKA 250

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
           +   E+  LLV QVTG VRWRE +      GV +  E+G+GKVL GL +RI    + +S 
Sbjct: 251 TDPAELRDLLVRQVTGTVRWRECVATMLELGVDTFVELGAGKVLGGLIRRIAPDATTLSA 310

Query: 300 SKVEDIDLALRSI 312
               +I+  L++ 
Sbjct: 311 GTPAEIEALLKTF 323


>gi|114704791|ref|ZP_01437699.1| acyl-carrier-protein S-malonyltransferase [Fulvimarina pelagi
           HTCC2506]
 gi|114539576|gb|EAU42696.1| acyl-carrier-protein S-malonyltransferase [Fulvimarina pelagi
           HTCC2506]
          Length = 296

 Score =  290 bits (743), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 146/297 (49%), Positives = 196/297 (65%), Gaps = 1/297 (0%)

Query: 17  MGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPALTAVSMAFIRVM 76
           MG+ L+D++PE+R VF EVD  L + LS L++ G  E LT T NAQPAL AVS+A IR +
Sbjct: 1   MGKALHDAYPESRDVFAEVDEALGEKLSSLIFQGPIETLTLTANAQPALMAVSLATIRAL 60

Query: 77  EKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQEAVPPGLGSMVA 136
           E  G  V  D +Y AGHSLGEY+AL A +A +++DT +L+R RG +MQ AVP G G+M A
Sbjct: 61  ESEGFSVT-DAAYAAGHSLGEYSALAATRALTVTDTAKLLRVRGDAMQAAVPEGAGAMAA 119

Query: 137 IIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAADTCLNKGAKRAVFL 196
           I+GLD   V  IC  A+   +CE ANDNGGGQ+VISG + AV+ A      +GAKRA+ L
Sbjct: 120 ILGLDMDAVKGICGAAADGEVCEPANDNGGGQIVISGTKAAVERAIALAPERGAKRAIPL 179

Query: 197 PVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSIDEISRLLVEQVTGR 256
           PVSAPFH +LM P ++ M   L       P +P++ N  A   +  + I + LVEQVTG 
Sbjct: 180 PVSAPFHCALMLPAAETMAEALKEANISAPAIPVISNIAADATTDPEAIRKRLVEQVTGA 239

Query: 257 VRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVEDIDLALRSIV 313
           VRW E++ + A++GV  + E+G+GKVL+GL +RIDK LSA  +   +DI   L+  V
Sbjct: 240 VRWNESMLYAADNGVTDLAEIGAGKVLSGLTRRIDKRLSAKPLGTPDDIATFLKERV 296


>gi|170741385|ref|YP_001770040.1| malonyl CoA-acyl carrier protein transacylase [Methylobacterium sp.
           4-46]
 gi|168195659|gb|ACA17606.1| malonyl CoA-acyl carrier protein transacylase [Methylobacterium sp.
           4-46]
          Length = 311

 Score =  290 bits (742), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 160/307 (52%), Positives = 200/307 (65%), Gaps = 1/307 (0%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           MS    FPGQGSQ +GMG  L  S   AR VF EVD  L Q+LS LM+ G  EELT T N
Sbjct: 1   MSRAFIFPGQGSQAVGMGAALGQSHAAARAVFAEVDEALGQSLSRLMFEGPAEELTLTAN 60

Query: 61  AQPALTAVSMAFIRVME-KNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRAR 119
           AQPAL A S+A +RV+E + GL + RD+++VAGHSLGEY+AL AA A S++DT RL+R R
Sbjct: 61  AQPALMAASLAVLRVLEAERGLDLARDVAFVAGHSLGEYSALAAAGALSVADTARLLRLR 120

Query: 120 GKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVK 179
           G++MQ AVP G G+M A++GL    V+ I  +A +  +C++ANDNG GQVV+SG   AV+
Sbjct: 121 GEAMQRAVPVGTGAMAALLGLPIETVEEIAGEAEQGEVCDVANDNGAGQVVVSGHVAAVE 180

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            A      +GAKRAV L VSAPFH  LM+P ++ M+  LD V      VP++ N  A+P+
Sbjct: 181 RAVALAQARGAKRAVMLNVSAPFHCRLMSPAAETMRAALDQVQLGAAKVPVVANILAAPI 240

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
                I   LV QVTG VRWRE +   A  GV +  EVGSGKVLTGL KRI     AV+I
Sbjct: 241 REPAAIRDALVRQVTGTVRWRECVAAMAASGVDAFCEVGSGKVLTGLVKRIAPGAGAVAI 300

Query: 300 SKVEDID 306
               DID
Sbjct: 301 GAPADID 307


>gi|86138741|ref|ZP_01057313.1| acyl-carrier-protein S-malonyltransferase [Roseobacter sp. MED193]
 gi|85824388|gb|EAQ44591.1| acyl-carrier-protein S-malonyltransferase [Roseobacter sp. MED193]
          Length = 311

 Score =  289 bits (740), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 148/296 (50%), Positives = 200/296 (67%), Gaps = 2/296 (0%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M+    FPGQG+Q IGMG+ L +++P A+ VFEEVD  L +NLS L+W G  E LT T N
Sbjct: 1   MTIAFVFPGQGAQAIGMGQALAETYPAAKAVFEEVDAALEENLSTLIWEGDIETLTLTQN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
           AQPAL A S+A +R +E  G+ +     +VAGHSLGEY+AL A+ A S++DT RL+R RG
Sbjct: 61  AQPALMATSLAAMRALEAEGIAIDH-AKFVAGHSLGEYSALAASGAISIADTARLLRTRG 119

Query: 121 KSMQEAVPPGLGSMVAIIGLD-DCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVK 179
           ++MQ AVP G+G+M A++GLD   V +     A+   + + ANDN   QVV+SG + AV+
Sbjct: 120 EAMQSAVPVGVGAMAALLGLDFATVKEVAAEAAAPGEVVQAANDNDPTQVVVSGHKAAVE 179

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            AA+    +GAKRAV LPVSAPFH +LM P + VM   L  V  + P VP++ N  A  V
Sbjct: 180 RAAEIAKGRGAKRAVMLPVSAPFHCALMQPAADVMAEALAEVEIKAPAVPLIANVRADAV 239

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLS 295
           S   EI +LLVEQVTG VRWRE++Q  A  GV   +E+GSGK L+G+ ++I++SL+
Sbjct: 240 SDPAEIRQLLVEQVTGSVRWRESVQVMAAKGVTEFWEIGSGKALSGMIRKIERSLT 295


>gi|170748314|ref|YP_001754574.1| malonyl CoA-acyl carrier protein transacylase [Methylobacterium
           radiotolerans JCM 2831]
 gi|170654836|gb|ACB23891.1| malonyl CoA-acyl carrier protein transacylase [Methylobacterium
           radiotolerans JCM 2831]
          Length = 314

 Score =  288 bits (738), Expect = 6e-76,   Method: Compositional matrix adjust.
 Identities = 156/306 (50%), Positives = 202/306 (66%), Gaps = 5/306 (1%)

Query: 5   LTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPA 64
           L FPGQGSQ +GM RDL ++FP+AR V +EVD  L QNLS LM+ G  EELT T NAQPA
Sbjct: 4   LIFPGQGSQAVGMARDLAEAFPQARAVLDEVDAALGQNLSRLMFAGPVEELTLTTNAQPA 63

Query: 65  LTAVSMAFIRVME-KNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSM 123
           L A S+A +RV+E + GL + RD++ VAGHSLGEY AL AA + +++D  +L+R RG++M
Sbjct: 64  LMAASLAVLRVLEAERGLDLARDVACVAGHSLGEYAALAAAGSLTVADAAKLLRLRGEAM 123

Query: 124 QEAVPPGLGSMVAIIGLD----DCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVK 179
           Q AV PG G+M A+IG D      V ++   +A    +C++ANDNGGGQVV+SG + AV+
Sbjct: 124 QAAVAPGAGAMAALIGTDLEAARSVAEAAADEAGDGAVCDVANDNGGGQVVLSGDRPAVE 183

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            A      +G KRAV L VSAPFH  LM P ++ M   L +VT   P V +  N  A+PV
Sbjct: 184 RAVGIATGRGIKRAVMLNVSAPFHCRLMAPAAEAMARALSAVTLAAPRVTLYANVAAAPV 243

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
           +  + I   LVEQVTG VRWRE++   A  GV   YE+G+GKVLTGL KRI    SA +I
Sbjct: 244 TDPEAIRAALVEQVTGTVRWRESVAAMAASGVDRFYELGAGKVLTGLVKRIAPQASAAAI 303

Query: 300 SKVEDI 305
               D+
Sbjct: 304 GTPADV 309


>gi|296444332|ref|ZP_06886297.1| malonyl CoA-acyl carrier protein transacylase [Methylosinus
           trichosporium OB3b]
 gi|296257979|gb|EFH05041.1| malonyl CoA-acyl carrier protein transacylase [Methylosinus
           trichosporium OB3b]
          Length = 313

 Score =  288 bits (738), Expect = 6e-76,   Method: Compositional matrix adjust.
 Identities = 162/313 (51%), Positives = 212/313 (67%), Gaps = 2/313 (0%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M+    FPGQGSQ IGMG+ L ++F EAR VF EVD  L  +LS +M+ G + ELT T N
Sbjct: 1   MARAFVFPGQGSQAIGMGKALGEAFAEARAVFAEVDDALGASLSRVMFEGPEAELTLTAN 60

Query: 61  AQPALTAVSMAFIRVME-KNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRAR 119
           AQPAL AVS+A IRV+E + GL + RD ++VAGHSLGEY+AL AA A SL+DT RL+R R
Sbjct: 61  AQPALMAVSLAAIRVLEAQAGLDLSRDAAFVAGHSLGEYSALAAAGALSLADTARLLRLR 120

Query: 120 GKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVK 179
           G++MQ AVP G G+M A++G++      I A+A +  +C++ANDNGGGQ+V+SG + AV+
Sbjct: 121 GEAMQAAVPVGAGAMAALLGVEMAAAREIAAEAEQGSVCQVANDNGGGQIVVSGAKAAVE 180

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            A +    +G KRAV LPVSAPFH +LM P ++ M+  L + T   P V ++ N  ASPV
Sbjct: 181 RAIEIAKGRGVKRAVALPVSAPFHCALMQPAAEAMRAALATTTIHAPRVAVVANVTASPV 240

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
              +EI RLLVEQVTG VRWRE + + A  G     E G+GKVLTGL KRI    + +S+
Sbjct: 241 MQPEEIRRLLVEQVTGTVRWRECVAYMAEQGTGKFVECGAGKVLTGLLKRIAPQAAGISV 300

Query: 300 SKVEDIDLALRSI 312
               D+D A RS 
Sbjct: 301 GAPADLD-AYRSF 312


>gi|58040467|ref|YP_192431.1| acyl-carrier-protein S-malonyltransferase [Gluconobacter oxydans
           621H]
 gi|58002881|gb|AAW61775.1| Malonyl-CoA-[acyl-carrier-protein] transacylase [Gluconobacter
           oxydans 621H]
          Length = 333

 Score =  288 bits (738), Expect = 6e-76,   Method: Compositional matrix adjust.
 Identities = 146/309 (47%), Positives = 204/309 (66%), Gaps = 1/309 (0%)

Query: 5   LTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPA 64
             FPGQGSQ +GMG+ L ++F  +R VF+EVD  L  +LS LM++G  +ELT T NAQPA
Sbjct: 25  FVFPGQGSQSVGMGQALNEAFASSRAVFQEVDEALGDHLSRLMFSGDADELTRTENAQPA 84

Query: 65  LTAVSMAFIRVME-KNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSM 123
           L AVS+A +R +E + G  +    + VAGHSLGEY+AL AA    +++  RL+R RG++M
Sbjct: 85  LFAVSLAAVRALESEGGFKLADKAALVAGHSLGEYSALAAASTLGIAEGARLLRLRGQAM 144

Query: 124 QEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAAD 183
           Q AVP G G M A++G+D     SIC +AS+    EIANDNGGGQ+V+SG+  A+  A  
Sbjct: 145 QRAVPAGEGGMAALLGVDAAQARSICDEASQGETLEIANDNGGGQIVVSGVMSAIDRAIV 204

Query: 184 TCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSID 243
                G KRAV LPVSAPFHSSLM P ++ M+  L + T   P +P++ N  A+ V+   
Sbjct: 205 VAKEHGIKRAVKLPVSAPFHSSLMAPAAREMEEALATATLNPPSIPVIANVTAAKVTDPA 264

Query: 244 EISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVE 303
            I  LLV+QVTG+VRWRE++Q     GV +++E+G+GKVL GLA+RI   L+  +     
Sbjct: 265 VIRDLLVKQVTGKVRWRESVQTMVAMGVTNMHELGAGKVLCGLARRIAPELATSNAGTPA 324

Query: 304 DIDLALRSI 312
           +I+  L+++
Sbjct: 325 EIEALLKAL 333


>gi|115525309|ref|YP_782220.1| malonyl CoA-acyl carrier protein transacylase [Rhodopseudomonas
           palustris BisA53]
 gi|115519256|gb|ABJ07240.1| [Acyl-carrier-protein] S-malonyltransferase [Rhodopseudomonas
           palustris BisA53]
          Length = 319

 Score =  288 bits (737), Expect = 6e-76,   Method: Compositional matrix adjust.
 Identities = 155/306 (50%), Positives = 209/306 (68%), Gaps = 1/306 (0%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M+   TFPGQGSQ +GMG+ L ++FP AR VF+EVD  L + L+ ++W+G  E L  T N
Sbjct: 1   MTAAFTFPGQGSQAVGMGKALAEAFPVARAVFDEVDAALGEKLTAIIWDGPAETLQLTEN 60

Query: 61  AQPALTAVSMAFIRVME-KNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRAR 119
           AQPAL AVS+A +RV+E + G  V RD ++VAGHSLGEY+AL AA + S+SDT RL+R R
Sbjct: 61  AQPALMAVSLATLRVLETEAGFDVGRDAAFVAGHSLGEYSALAAAGSLSISDTARLLRTR 120

Query: 120 GKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVK 179
           G +MQ+AVP G+G+M A++GLD     ++  +A++  +C+ ANDNGGGQVV+SG + AV 
Sbjct: 121 GLAMQKAVPVGVGAMAALLGLDFEAAVAVAEEAAQGEVCQAANDNGGGQVVVSGDKAAVD 180

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            A +    KGAKRA+ LPVSAPFH  LM P +  M   L  VT + P   ++ N  A  V
Sbjct: 181 RALEIAKAKGAKRALLLPVSAPFHCRLMQPAADAMAEALAGVTIKAPAAALVANVVAGAV 240

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
           +S +EI RLLVEQVTG VRWRE++ + A  GV   +E+G+GKVL+GL KRI      +++
Sbjct: 241 TSPEEIRRLLVEQVTGTVRWRESVAFMAGQGVSHFFEIGAGKVLSGLVKRIADGAVGIAV 300

Query: 300 SKVEDI 305
               DI
Sbjct: 301 GGPNDI 306


>gi|220922740|ref|YP_002498042.1| malonyl CoA-acyl carrier protein transacylase [Methylobacterium
           nodulans ORS 2060]
 gi|219947347|gb|ACL57739.1| malonyl CoA-acyl carrier protein transacylase [Methylobacterium
           nodulans ORS 2060]
          Length = 311

 Score =  288 bits (736), Expect = 9e-76,   Method: Compositional matrix adjust.
 Identities = 157/306 (51%), Positives = 203/306 (66%), Gaps = 1/306 (0%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           MS    FPGQGSQ +GMG  L  +   AR VF EVD  L+QNLS LM+ G  +ELT T N
Sbjct: 1   MSRAFIFPGQGSQAVGMGAGLSQNHAAAREVFAEVDEALSQNLSRLMFEGPADELTLTAN 60

Query: 61  AQPALTAVSMAFIRVME-KNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRAR 119
           AQPAL A S+A +RV+E + GL + RD+++VAGHSLGEY+AL AA A +L+DT RL+R R
Sbjct: 61  AQPALMAASLAVLRVLEAERGLELARDVAFVAGHSLGEYSALAAAGALNLADTARLLRLR 120

Query: 120 GKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVK 179
           G++MQ AVP G G+M A++GL+    + I  +A +  +C++ANDNG GQVV+SG + AV+
Sbjct: 121 GEAMQRAVPVGTGAMAALLGLEVEAAEEIAGEAEQGEVCDVANDNGAGQVVVSGHRSAVE 180

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            A      +GAKRAV L VSAPFH +LM+P ++ M+  LD VT     VP++ N  ASP+
Sbjct: 181 RAVALAQTRGAKRAVMLNVSAPFHCALMSPAAETMRAALDQVTLVAAKVPVMANILASPI 240

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
                I   LV QVTG VRWRE +   A  GV + YE+G+GKVL+GL KRI    SA  I
Sbjct: 241 REPAAIRDALVRQVTGTVRWRECVAAMAGAGVDAFYEIGTGKVLSGLVKRIAPGASATPI 300

Query: 300 SKVEDI 305
               DI
Sbjct: 301 GTPADI 306


>gi|196018168|ref|XP_002118753.1| hypothetical protein TRIADDRAFT_34669 [Trichoplax adhaerens]
 gi|190578292|gb|EDV18756.1| hypothetical protein TRIADDRAFT_34669 [Trichoplax adhaerens]
          Length = 312

 Score =  286 bits (732), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 143/317 (45%), Positives = 203/317 (64%), Gaps = 12/317 (3%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M+T   +PGQGSQ +GMG+DLYD+F EA+ VFE V+  LNQNLSD+++NG  ++L  T N
Sbjct: 1   MNTAFIYPGQGSQYVGMGKDLYDNFFEAKEVFEIVNDALNQNLSDIIFNGDSDDLKITSN 60

Query: 61  AQPALTAVSMAFIRVM------EKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIR 114
            QPA+ A SMA  +V+      +   LC     S  AGHSLGEY+ALCA ++  + +T +
Sbjct: 61  TQPAIMATSMAVFKVLISLSNKKITELC-----SISAGHSLGEYSALCATESIHMKNTAK 115

Query: 115 LVRARGKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGL 174
           ++RARG +MQ+AVP G G+M A+IG D+   + +C   S  G+CEIANDNGGGQ+++SG 
Sbjct: 116 ILRARGNAMQKAVPIGKGAMYALIGGDEVAAEEVCKILSENGVCEIANDNGGGQIILSGD 175

Query: 175 QDAVKCAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNF 234
           +DA K   +   N   ++A+ LPVSAPFHSSLM   ++VM   L     + P + ++ N+
Sbjct: 176 KDAFKDINEVVKNFKIRKAIPLPVSAPFHSSLMKEATEVMSQELAKYNFEAPKIDVIANY 235

Query: 235 CASPVSSIDEISRLLVEQVTGRVRWRETI-QWFANHGVKSVYEVGSGKVLTGLAKRIDKS 293
            A+   S +EI  LLV+Q+ G+VRWRETI + +    ++   EVG G VLT L KR  K 
Sbjct: 236 SANVYQSKEEIKDLLVKQIEGKVRWRETIAKMYNEFSIRKFVEVGPGNVLTNLIKREYKD 295

Query: 294 LSAVSISKVEDIDLALR 310
           +   S+    DI+  L+
Sbjct: 296 VEVYSLQTANDIENFLK 312


>gi|307946731|ref|ZP_07662066.1| malonyl CoA-acyl carrier protein transacylase [Roseibium sp.
           TrichSKD4]
 gi|307770395|gb|EFO29621.1| malonyl CoA-acyl carrier protein transacylase [Roseibium sp.
           TrichSKD4]
          Length = 314

 Score =  283 bits (724), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 150/306 (49%), Positives = 201/306 (65%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M+   TFPGQGSQ + MG++L D+F EA+ VF+EVD  L+Q LS LMW G + +LT T N
Sbjct: 1   MTIAFTFPGQGSQAVSMGKELADTFAEAKAVFDEVDDALDQKLSTLMWEGPEADLTLTAN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
           AQPAL AVS+A +RV+E  GL + + +S+VAGHSLGEY+AL AA +  ++   RL+R RG
Sbjct: 61  AQPALMAVSLATMRVLEARGLDLAKSVSFVAGHSLGEYSALAAAGSLDVATAARLLRVRG 120

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
            +MQ AVP G G M A++GLD      +  +A++  +C+ ANDN  GQVV+SG   AV+ 
Sbjct: 121 NAMQTAVPVGQGGMAALLGLDFAEAAKVAEEAAQGEVCQAANDNAPGQVVVSGNMSAVER 180

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A +    KGAKRA+ L VSAPFH +LM P +  M   L       P VP++ N  AS ++
Sbjct: 181 AVEIAKAKGAKRAMMLSVSAPFHCALMAPAADAMAEALAGAEIVAPKVPLVANVLASAIT 240

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
              EI   LVEQVTG VRWRE++ W   +GV +  EVGSGKVL+G+ KRI++S     ++
Sbjct: 241 DPAEIRNHLVEQVTGTVRWRESMGWLVENGVDTFVEVGSGKVLSGMMKRIERSAKVQPVN 300

Query: 301 KVEDID 306
              DID
Sbjct: 301 TPTDID 306


>gi|158425936|ref|YP_001527228.1| malonyl CoA-acyl carrier protein transacylase [Azorhizobium
           caulinodans ORS 571]
 gi|158332825|dbj|BAF90310.1| malonyl CoA-acyl carrier protein transacylase [Azorhizobium
           caulinodans ORS 571]
          Length = 318

 Score =  283 bits (723), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 159/306 (51%), Positives = 210/306 (68%), Gaps = 1/306 (0%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           MST   FPGQGSQ +GMG+ L ++F  AR VF EVD  L ++L+ +MW G  +ELT T N
Sbjct: 1   MSTAFIFPGQGSQAVGMGKALAENFAAARDVFTEVDAALGEHLTRIMWEGPADELTLTAN 60

Query: 61  AQPALTAVSMAFIRVME-KNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRAR 119
           AQPAL A S+A +RV+E + GL + RD ++VAGHSLGEY+AL AA  F++SD  RL+R R
Sbjct: 61  AQPALMATSLAALRVLEAEAGLNLARDAAFVAGHSLGEYSALAAAGTFTISDAARLLRIR 120

Query: 120 GKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVK 179
           G++MQ+AVP G G+M A++GLD     ++ A+A+   +CE ANDN GGQVV+SG   AV+
Sbjct: 121 GRAMQDAVPAGAGAMAALLGLDYEQAVAVAAEAAGDDVCEAANDNAGGQVVVSGSLKAVE 180

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            A +    KGA RA+ LPVSAPFH  LM P ++ M   L  V  + PVVP++ N  ASPV
Sbjct: 181 RAIEIAKAKGASRAILLPVSAPFHCRLMEPAAEAMAAALAEVEVKAPVVPVISNVRASPV 240

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
           +   EI RLLVEQVTG VRWRE++ + A  GV    EVG+GKVL+GL +RI K +   ++
Sbjct: 241 TDPAEIVRLLVEQVTGTVRWRESVVYMAGAGVSRAVEVGAGKVLSGLVRRIAKEIQVSAV 300

Query: 300 SKVEDI 305
              ED+
Sbjct: 301 GTPEDV 306


>gi|254294298|ref|YP_003060321.1| malonyl CoA-acyl carrier protein transacylase [Hirschia baltica
           ATCC 49814]
 gi|254042829|gb|ACT59624.1| malonyl CoA-acyl carrier protein transacylase [Hirschia baltica
           ATCC 49814]
          Length = 319

 Score =  282 bits (722), Expect = 4e-74,   Method: Compositional matrix adjust.
 Identities = 142/309 (45%), Positives = 198/309 (64%), Gaps = 3/309 (0%)

Query: 7   FPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPALT 66
           FPGQG+Q +GMG++L ++FP A+ VF+EVD  L +N SDL+WNGS+E+LT T N QPAL 
Sbjct: 8   FPGQGAQSVGMGQELANTFPAAKAVFDEVDSALGENFSDLIWNGSEEQLTMTANTQPALM 67

Query: 67  AVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQEA 126
           AVS+A +R +E        D  +VAGHSLGEY+AL A  A  L+D  +L+R RG++MQEA
Sbjct: 68  AVSIAVMRTLENEFNVKPADAKFVAGHSLGEYSALAAVGAIKLADAAKLLRLRGEAMQEA 127

Query: 127 VPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAADTCL 186
           V PG G+M A++G D    +++     + G C+IANDN  GQ+VISG + A+  A     
Sbjct: 128 VAPGEGAMAALLGADQAQAEAMIEIGRKHGACDIANDNAPGQIVISGSKAAIDAACAAAG 187

Query: 187 NKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSIDEIS 246
           + G K+AV L VSAPFH SLM P    M+  L       P+ P++ N  A P    + I 
Sbjct: 188 DLGIKKAVPLAVSAPFHCSLMQPAQDKMQAALSETKIIAPMAPLVANVTARPTEDPEAIR 247

Query: 247 RLLVEQVTGRVRWRETIQWFANH---GVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVE 303
           + LVEQVTGRVRWRE+++W A+     +    E G+GKVLT + KRI +SL  V+++   
Sbjct: 248 KQLVEQVTGRVRWRESVEWMASEDGGALDLTVEAGAGKVLTTMNKRIARSLKGVALNAPA 307

Query: 304 DIDLALRSI 312
           D++   +S+
Sbjct: 308 DLEAFAKSL 316


>gi|163797517|ref|ZP_02191468.1| S-malonyltransferase [alpha proteobacterium BAL199]
 gi|159177266|gb|EDP61825.1| S-malonyltransferase [alpha proteobacterium BAL199]
          Length = 319

 Score =  282 bits (721), Expect = 5e-74,   Method: Compositional matrix adjust.
 Identities = 160/310 (51%), Positives = 212/310 (68%), Gaps = 1/310 (0%)

Query: 5   LTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPA 64
             FPGQGSQ +GMG+DL D++P AR VF+EVD  L ++LS L+W+G +E L  T NAQPA
Sbjct: 10  FVFPGQGSQAVGMGKDLADAYPAARAVFQEVDDALGESLSQLIWDGPEERLVLTANAQPA 69

Query: 65  LTAVSMAFIRVME-KNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSM 123
           L AVS+A  RV+E ++G    +   +VAGHSLGEY+AL AA  F ++   RL+R RG++M
Sbjct: 70  LMAVSLAVARVLEAESGRSFAQLCDFVAGHSLGEYSALAAAGTFDVATAARLLRLRGEAM 129

Query: 124 QEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAAD 183
           Q+AVP G+G+M A+IG +  V  ++ A A+   +C+IANDNGGGQVV+SG   A+     
Sbjct: 130 QQAVPVGVGAMAALIGAELEVAQALAAAAAEGEVCDIANDNGGGQVVLSGHAGAIDRVLA 189

Query: 184 TCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSID 243
              + G KRAV L VSAPFH +LM P +  M   L     + PVVP++ N  A P +  D
Sbjct: 190 LAADHGIKRAVKLTVSAPFHCALMAPAADAMADALALADPRPPVVPVVANVTAMPTTDPD 249

Query: 244 EISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVE 303
            I R LVEQVTGRVRWRE++  FA  GV+S+ EVG+GKVLTGLA+RIDK L+A +I+   
Sbjct: 250 AIRRQLVEQVTGRVRWRESVASFAGLGVRSMVEVGAGKVLTGLARRIDKDLAATTINGPA 309

Query: 304 DIDLALRSIV 313
           D+D  L S+V
Sbjct: 310 DVDAFLASLV 319


>gi|260427621|ref|ZP_05781600.1| malonyl CoA-acyl carrier protein transacylase [Citreicella sp.
           SE45]
 gi|260422113|gb|EEX15364.1| malonyl CoA-acyl carrier protein transacylase [Citreicella sp.
           SE45]
          Length = 314

 Score =  281 bits (718), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 152/306 (49%), Positives = 204/306 (66%), Gaps = 2/306 (0%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           MS    FPGQG+Q IGMG+ L ++FP AR +++EVD  L + LS L+W G  + LT T N
Sbjct: 1   MSRAFIFPGQGAQAIGMGKALAEAFPAARAIYDEVDEALGEKLSALIWEGDADTLTLTEN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
           AQPAL A SMA +R +E  G+ V  D S+VAGHSLGEY+AL AA A S++D  RL+R RG
Sbjct: 61  AQPALMATSMAALRALEAEGVSVT-DASFVAGHSLGEYSALTAAGALSVADAARLLRTRG 119

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVG-ICEIANDNGGGQVVISGLQDAVK 179
           ++MQ AVP G+G+M A++GLD     ++ A+A+  G +C  ANDN  GQVVISG + AV 
Sbjct: 120 RAMQNAVPVGVGAMAALLGLDLVRAKAVAAEAASDGEVCAAANDNDPGQVVISGHKAAVA 179

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            A +     GAKRAV LPVSAPFH +LM P ++ M   L  V+   P VP++ N     V
Sbjct: 180 RAVELAKALGAKRAVMLPVSAPFHCALMAPAAEAMAEALAEVSISAPKVPLVANVSVEAV 239

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
           +  D I  LLVEQVTG VRWRE++++   +GV   +E+G+GK L+G+ +RID+S S  +I
Sbjct: 240 TDPDTIRALLVEQVTGAVRWRESVEYMIGNGVSEFWEIGAGKALSGMVRRIDRSASVAAI 299

Query: 300 SKVEDI 305
              ED+
Sbjct: 300 GTPEDV 305


>gi|312113716|ref|YP_004011312.1| malonyl CoA-acyl carrier protein transacylase [Rhodomicrobium
           vannielii ATCC 17100]
 gi|311218845|gb|ADP70213.1| malonyl CoA-acyl carrier protein transacylase [Rhodomicrobium
           vannielii ATCC 17100]
          Length = 318

 Score =  280 bits (717), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 148/305 (48%), Positives = 199/305 (65%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M+   TFPGQGSQ +GMG++L  +F  AR VF+EVD  L + LS +MW G +  LT T N
Sbjct: 1   MTFAFTFPGQGSQTVGMGQNLAQNFAVARAVFDEVDEALGEKLSAVMWEGPEATLTLTFN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
           AQPAL AVS+A   V++           YVAGHSLGEY+AL A   FS++D  RL+R RG
Sbjct: 61  AQPALMAVSLAAFAVIKNEYGWEAIKPVYVAGHSLGEYSALAAVGVFSVADAARLLRLRG 120

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
            +MQEAVP G G+M+A++G +      + A A+   + ++ANDN  GQ+VISG + A+  
Sbjct: 121 TAMQEAVPQGQGAMLALLGAEIDSAKKLAAAAAEGEVAQVANDNAPGQIVISGSKAAMDR 180

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           AA      G +RAV LPVSAPFH +LM+P ++ M   L ++  + P VP++ N  A+PVS
Sbjct: 181 AAKLAPEYGIRRAVPLPVSAPFHCALMSPAAERMATALAALDLKIPEVPVVTNVTAAPVS 240

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
               I  LLVEQVTG VRWRE++ +  +HGV +++EVG+GKVLTGLAKRI     A S+ 
Sbjct: 241 DPSLIRSLLVEQVTGVVRWRESVAYMVDHGVATLFEVGAGKVLTGLAKRIRSEADARSVG 300

Query: 301 KVEDI 305
             +DI
Sbjct: 301 TADDI 305


>gi|148553014|ref|YP_001260596.1| [acyl-carrier-protein] S-malonyltransferase [Sphingomonas wittichii
           RW1]
 gi|148498204|gb|ABQ66458.1| [Acyl-carrier-protein] S-malonyltransferase [Sphingomonas wittichii
           RW1]
          Length = 311

 Score =  280 bits (717), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 147/301 (48%), Positives = 199/301 (66%), Gaps = 2/301 (0%)

Query: 7   FPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPALT 66
           FPGQGSQ +GMG+ L D+   AR VF+EVD  L+Q L  LM  G  +ELT T NAQPA+ 
Sbjct: 6   FPGQGSQAVGMGQALADASTVAREVFQEVDDALSQKLFKLMVEGPADELTLTENAQPAIM 65

Query: 67  AVSMAFIRVMEKNG-LCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQE 125
           A ++A +RV++K G + +    ++VAGHSLGEYTALCAA+A  L+ T RL++ RG+SMQ 
Sbjct: 66  ANAIATLRVLQKEGGISLADKAAFVAGHSLGEYTALCAAEAIDLATTARLLKLRGRSMQA 125

Query: 126 AVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAADTC 185
           AVP G+G+M   +GLD     ++  +A++  +C+ ANDN   QVV+SG +DAV+ A +  
Sbjct: 126 AVPVGVGAMAVFLGLDFEGAKAVAEEAAQGEVCQAANDNSNRQVVVSGHKDAVERAIEIA 185

Query: 186 LNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSIDEI 245
             KGA+RA+ LPVSAPFH SLM P +  M   L     Q P+VP+  N  A+PVS   EI
Sbjct: 186 KAKGARRAMLLPVSAPFHCSLMQPAADAMAEALGRTAVQAPLVPVYANVLAAPVSDPAEI 245

Query: 246 SRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVEDI 305
            RLLVEQVTG VRWRE++   A+ GV+   E+G GKV+  + K I    +A S+  + DI
Sbjct: 246 IRLLVEQVTGTVRWRESVAAMADAGVEQFVELG-GKVVGPMVKDITDRATATSVVTMADI 304

Query: 306 D 306
           +
Sbjct: 305 E 305


>gi|304321797|ref|YP_003855440.1| acyl-carrier-protein S-malonyltransferase [Parvularcula bermudensis
           HTCC2503]
 gi|303300699|gb|ADM10298.1| acyl-carrier-protein S-malonyltransferase [Parvularcula bermudensis
           HTCC2503]
          Length = 314

 Score =  280 bits (716), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 155/308 (50%), Positives = 195/308 (63%), Gaps = 6/308 (1%)

Query: 7   FPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPALT 66
           FPGQGSQ +GMG  L D FP A  VFEE D  L +NLS LM+ G  EELT T NAQPAL 
Sbjct: 12  FPGQGSQSVGMGVALRDHFPAAATVFEEADEALGRNLSRLMFEGPSEELTLTENAQPALL 71

Query: 67  AVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQEA 126
            VS+A +R +E  G  +   +  +AGHSLGEYTA CAA A  L+D +RLVR RG++MQ A
Sbjct: 72  VVSIAALRALEAEGFGLG-AVRSMAGHSLGEYTAYCAAGAIELADAVRLVRLRGEAMQAA 130

Query: 127 VPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAADTCL 186
           VP G G M A++GLD   +++  A A+  G+ EIANDN   Q+V+SG   A+        
Sbjct: 131 VPVGEGKMAAVLGLD---IETAAALAAEAGV-EIANDNAPSQIVLSGRAAAIDAVCARAK 186

Query: 187 NKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSIDEIS 246
             GAKRA+ L VSAPFHSSLM P ++ M   L     Q P VP+  N   +P +  + I 
Sbjct: 187 EAGAKRAMLLAVSAPFHSSLMAPAAERMAEALAKTFFQPPKVPVYSNVLTTPPAGEEAIK 246

Query: 247 RLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVEDID 306
           R LV+QVTGRVRW ETI   A  G ++  EVG GKVL+GL KRI KS +A+S  + +DI+
Sbjct: 247 RSLVDQVTGRVRWVETISQMAEDGTETFIEVGPGKVLSGLVKRIAKSATALSFGEPDDIE 306

Query: 307 LALRSIVG 314
             LR  +G
Sbjct: 307 -TLRDRLG 313


>gi|254462783|ref|ZP_05076199.1| malonyl CoA-acyl carrier protein transacylase [Rhodobacterales
           bacterium HTCC2083]
 gi|206679372|gb|EDZ43859.1| malonyl CoA-acyl carrier protein transacylase [Rhodobacteraceae
           bacterium HTCC2083]
          Length = 293

 Score =  280 bits (716), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 141/289 (48%), Positives = 192/289 (66%), Gaps = 1/289 (0%)

Query: 17  MGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPALTAVSMAFIRVM 76
           MG+ L D++P A+ VF EVD  L + LS L+W G Q+ LT T NAQPAL A S+A +R +
Sbjct: 1   MGKALADAYPAAKAVFGEVDEALGEKLSALIWEGEQDTLTLTQNAQPALMATSLAAMRAL 60

Query: 77  EKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQEAVPPGLGSMVA 136
           E  G+ +  D S+VAGHSLGEY+AL A  A S++DT RL+R RG +MQEAVP G+G+M A
Sbjct: 61  EAEGVAIT-DASFVAGHSLGEYSALAATGALSIADTARLLRTRGTAMQEAVPVGVGAMAA 119

Query: 137 IIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAADTCLNKGAKRAVFL 196
           ++GLD      + ++A++  +C+ ANDN   QVV+SG   AV+ A      KGAKRAV L
Sbjct: 120 LLGLDFETAQEVASEAAQGDVCQAANDNDPSQVVVSGHLGAVERALVIAKEKGAKRAVLL 179

Query: 197 PVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSIDEISRLLVEQVTGR 256
           PVSAPFH +LM P ++VM   L +V    P VP++ N  A  VS    I  LLVEQVTG 
Sbjct: 180 PVSAPFHCALMEPAARVMADALGAVEINTPAVPVVANVRADAVSDPAAIRTLLVEQVTGS 239

Query: 257 VRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVEDI 305
           VRWRE++ + A  GV +++EVG+GK L+G+ +RI + ++   +   EDI
Sbjct: 240 VRWRESVGFMAAQGVDTIWEVGAGKALSGMIRRIAREIACSPVGTPEDI 288


>gi|197105020|ref|YP_002130397.1| malonyl CoA-acyl carrier protein transacylase [Phenylobacterium
           zucineum HLK1]
 gi|196478440|gb|ACG77968.1| malonyl CoA-acyl carrier protein transacylase [Phenylobacterium
           zucineum HLK1]
          Length = 314

 Score =  280 bits (715), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 154/310 (49%), Positives = 198/310 (63%), Gaps = 6/310 (1%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           MS    FPGQGSQ +GMG DL D+F  AR VF+EVD  L Q L  LM  G +++LT T N
Sbjct: 1   MSLAFIFPGQGSQAVGMGADLADAFGAAREVFQEVDEALGQKLFALMREGPEDQLTLTEN 60

Query: 61  AQPALTAVSMAFIRVMEKN-GLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRAR 119
           AQPAL AVS+A +RV+E+  G+ V+R  ++VAGHSLGEY+AL AA A SLSDT RL++ R
Sbjct: 61  AQPALMAVSVAVMRVLEREFGVGVER-AAFVAGHSLGEYSALAAAGAISLSDTARLLKLR 119

Query: 120 GKSMQEAVPPGLGSMVAIIG--LDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDA 177
           G++MQ AVP G G+M ++IG   D  + +      S  G+C +ANDN  G VVISG + A
Sbjct: 120 GQAMQRAVPVGQGAMASLIGPKTDLALAEEAAKAGSEAGVCVVANDNNQGNVVISGAKAA 179

Query: 178 VKCAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCAS 237
           V  A +     GA RA+ L VSAPFH  LM P +  M   L + T   P  P++ N  A 
Sbjct: 180 VDRAIEKAKELGA-RAIPLNVSAPFHCPLMQPAADEMAQALTAATIVTPKAPVVANVTAR 238

Query: 238 PVSSIDEISRLLVEQVTGRVRWRETIQWFANH-GVKSVYEVGSGKVLTGLAKRIDKSLSA 296
           P +  + I RLLVEQVTGRVRWRE++QW A   GV    E G+GKVL+G+ KRI     A
Sbjct: 239 PTNDPEAIRRLLVEQVTGRVRWRESVQWMAGEGGVTRFAEAGAGKVLSGMVKRIAPDAEA 298

Query: 297 VSISKVEDID 306
           V ++   D++
Sbjct: 299 VPLNAPADLE 308


>gi|56697137|ref|YP_167500.1| acyl-carrier-protein S-malonyltransferase [Ruegeria pomeroyi DSS-3]
 gi|56678874|gb|AAV95540.1| malonyl CoA-acyl carrier protein transacylase [Ruegeria pomeroyi
           DSS-3]
          Length = 312

 Score =  278 bits (711), Expect = 7e-73,   Method: Compositional matrix adjust.
 Identities = 150/306 (49%), Positives = 208/306 (67%), Gaps = 1/306 (0%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M+T   FPGQG+Q IGMG+ L +++P A+ VF+EVD  L + LS L+W G  E LT T N
Sbjct: 1   MTTAFVFPGQGAQTIGMGKALAEAYPAAQAVFDEVDAALGEKLSALIWEGDIETLTLTQN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
           AQPAL A SMA +R +E  G+ + +  ++VAGHSLGEY+AL AA A S+ DT RL+R RG
Sbjct: 61  AQPALMATSMAAMRALEAEGVAITQ-AAFVAGHSLGEYSALAAAGALSVGDTARLLRTRG 119

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           ++MQ AVP G G+M AI+GLD   V  + A+A++  +C+ ANDN   QVV+SG + AV+ 
Sbjct: 120 QAMQSAVPVGQGAMAAILGLDLAAVREVAAEAAQGEVCQAANDNDPTQVVVSGAKAAVER 179

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           AA+    KGAKRAV LPVSAPFH +LM P +  M   L +V  + P VP++ N  A  VS
Sbjct: 180 AAEIAKAKGAKRAVMLPVSAPFHCALMQPAADAMAEALAAVEIKAPAVPLVANVRAEAVS 239

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
             D I +LLVEQVTG VRWRE++++ A  GV  ++E+G+GK L+G+ ++I++ ++     
Sbjct: 240 DPDLIRQLLVEQVTGSVRWRESVEYMAAQGVTEIWEIGAGKALSGMVRKINREIACKPAG 299

Query: 301 KVEDID 306
             ED+ 
Sbjct: 300 TPEDVQ 305


>gi|99080891|ref|YP_613045.1| [Acyl-carrier-protein] S-malonyltransferase [Ruegeria sp. TM1040]
 gi|99037171|gb|ABF63783.1| [Acyl-carrier-protein] S-malonyltransferase [Ruegeria sp. TM1040]
          Length = 311

 Score =  278 bits (710), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 152/315 (48%), Positives = 207/315 (65%), Gaps = 6/315 (1%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           MS    FPGQG+Q IGMG+ L +++P A+ VF EVD  L ++LS L+W G  E LT T N
Sbjct: 1   MSIAFVFPGQGAQTIGMGKALAEAYPAAKAVFNEVDEALGESLSHLIWEGDIETLTLTQN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
           AQPAL A SMA +R +E  G+ + +  ++VAGHSLGEY+AL AA A S++DT RL+R RG
Sbjct: 61  AQPALMATSMAAMRALEAEGVSIDK-AAFVAGHSLGEYSALAAAGALSIADTARLLRTRG 119

Query: 121 KSMQEAVPPGLGSMVAIIGLD-DCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVK 179
           ++MQ AVP G+G+M A++GLD + V       A+   + + ANDN   QVV+SG + AV+
Sbjct: 120 QAMQSAVPVGVGAMAALLGLDFETVKAVAAEAAAEGEVVQAANDNDPTQVVVSGHKAAVE 179

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            AA+    KGAKRAV LPVSAPFH +LM P + VM   L  V  + P VP++ N  A  V
Sbjct: 180 RAAEIAKEKGAKRAVMLPVSAPFHCALMQPAADVMAEALAGVEIKAPAVPLIANVRADAV 239

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
           +  D I  LLVEQVTG VRWRE++   A  GV   +E+G+GK L+G+ ++ID+SL    +
Sbjct: 240 TDPDTIRALLVEQVTGSVRWRESVAAMAAKGVTEFWEIGAGKALSGMIRKIDRSL----V 295

Query: 300 SKVEDIDLALRSIVG 314
           SK    D  ++++ G
Sbjct: 296 SKQVGTDADVKAVTG 310


>gi|241762066|ref|ZP_04760150.1| malonyl CoA-acyl carrier protein transacylase [Zymomonas mobilis
           subsp. mobilis ATCC 10988]
 gi|241373532|gb|EER63119.1| malonyl CoA-acyl carrier protein transacylase [Zymomonas mobilis
           subsp. mobilis ATCC 10988]
          Length = 311

 Score =  278 bits (710), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 155/303 (51%), Positives = 191/303 (63%), Gaps = 2/303 (0%)

Query: 5   LTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPA 64
             FPGQGSQ +GMG+ L D+   AR VFEEVD  L QNL  LM  G +EEL  T NAQPA
Sbjct: 4   FIFPGQGSQSVGMGQALADASLAARHVFEEVDEALKQNLFRLMSQGPEEELRLTENAQPA 63

Query: 65  LTAVSMAFIRVMEKNGLCVKRDI-SYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSM 123
           + A SMA + ++EK G     D  S+VAGHSLGEY+AL AA AF+L  T RL++ RG++M
Sbjct: 64  IMAHSMAVLAMLEKEGNIRLTDAASFVAGHSLGEYSALAAADAFNLPTTARLLKKRGQAM 123

Query: 124 QEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAAD 183
           Q AVP G G M AI+GLD   V+SI  +A+   IC+ ANDN  GQVVISG   A++ A  
Sbjct: 124 QAAVPVGEGGMAAILGLDFETVESIAQEAAENDICQAANDNAPGQVVISGSLAAIERAVA 183

Query: 184 TCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSID 243
              +KGA+RAV L VSAPFH SLM P + VM   L     + P+VP+  N  A+  +   
Sbjct: 184 LAKDKGARRAVMLDVSAPFHCSLMQPAADVMAKALQENRPRQPIVPVFANVSATAETDPT 243

Query: 244 EISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVE 303
           +I  LLVEQVTGRVRWRE+I   A  GV+   E G GKVL  + KRI     A S+    
Sbjct: 244 KIMNLLVEQVTGRVRWRESIAAMAAAGVEEFVEFG-GKVLAPMIKRIAPDCKATSLIAPA 302

Query: 304 DID 306
           DI+
Sbjct: 303 DIE 305


>gi|296532307|ref|ZP_06895046.1| malonyl-CoA-[acyl-carrier-protein] transacylase [Roseomonas
           cervicalis ATCC 49957]
 gi|296267383|gb|EFH13269.1| malonyl-CoA-[acyl-carrier-protein] transacylase [Roseomonas
           cervicalis ATCC 49957]
          Length = 318

 Score =  276 bits (705), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 151/318 (47%), Positives = 203/318 (63%), Gaps = 6/318 (1%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           MS    FPGQGSQ +GMGR+L ++F  AR VFE VD TL QNLS LM+ G  EELT T N
Sbjct: 1   MSIAFVFPGQGSQAVGMGRELAEAFAPAREVFEAVDETLKQNLSRLMFEGPIEELTLTAN 60

Query: 61  AQPALTAVSMAFIRVMEKNG-LCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRAR 119
           AQPAL A+S+A +RV+E+ G   +K  ++ VAGHSLGEY+AL AA++F ++   RL+R R
Sbjct: 61  AQPALMAMSLAVMRVLEQEGGFDLKAKVAVVAGHSLGEYSALAAAQSFDVATAARLLRLR 120

Query: 120 GKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRV-----GICEIANDNGGGQVVISGL 174
           G++MQ+AVP G G+M A++G +      IC +A+        + E ANDNGGGQVVISG 
Sbjct: 121 GEAMQKAVPAGQGAMAALLGAEMAQAQEICERAALTPEGGQEVVEAANDNGGGQVVISGH 180

Query: 175 QDAVKCAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNF 234
           + AV+ A       G KRA+ LPVSAPFH +LM P +  M   L     + P+VP++ N 
Sbjct: 181 RAAVERAVALAKEAGIKRAMLLPVSAPFHCALMAPAADAMAEALALAELRPPLVPVVANV 240

Query: 235 CASPVSSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSL 294
            A+  +   EI  LLV QVTG VRWRE I      G +   E+G+GKVL+GL KR+    
Sbjct: 241 TAAKATDPTEIRELLVRQVTGTVRWRECIGTMRALGCERFIEIGAGKVLSGLMKRLAPEA 300

Query: 295 SAVSISKVEDIDLALRSI 312
            A+S+    +I+  L+++
Sbjct: 301 QAMSVGSPAEIEAFLKTL 318


>gi|329850893|ref|ZP_08265738.1| malonyl CoA-acyl carrier protein transacylase [Asticcacaulis
           biprosthecum C19]
 gi|328841208|gb|EGF90779.1| malonyl CoA-acyl carrier protein transacylase [Asticcacaulis
           biprosthecum C19]
          Length = 319

 Score =  275 bits (704), Expect = 5e-72,   Method: Compositional matrix adjust.
 Identities = 151/314 (48%), Positives = 202/314 (64%), Gaps = 10/314 (3%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M+T   FPGQGSQ +GMG +LYD+FP AR VF+EVD  L Q L  LM  G + +LT T N
Sbjct: 1   MTTAFVFPGQGSQNVGMGAELYDTFPRARAVFDEVDEALGQKLFQLMREGPESDLTLTEN 60

Query: 61  AQPALTAVSMAFIRVMEKN-GLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRAR 119
           AQPA+ AVS+A  RV+E + G+   R   YVAGHSLGEY+A  AA  FSL+DT RL++ R
Sbjct: 61  AQPAIMAVSIAVARVLEGDFGIACTR-AKYVAGHSLGEYSAHAAAGTFSLTDTARLLKIR 119

Query: 120 GKSMQEAVPPGLGSMVAIIGLDD-CVVDSICAQASRVGICEIANDNGGGQVVISGLQDAV 178
           G++MQ AVP G+G+M A+IG  D  + ++ C   S  G+  +ANDN  GQ+VISG++ AV
Sbjct: 120 GQAMQAAVPVGIGAMAALIGKADLALAEAACQAGSAGGVVVVANDNNAGQIVISGVKAAV 179

Query: 179 KCAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASP 238
           + A +     GAK A+ L VSAPFH  LM P +  M   L  V    PV  ++ N  A P
Sbjct: 180 EIAMEKAKELGAK-AMLLNVSAPFHCPLMQPAADAMADALAKVNINAPVSTLVANVTARP 238

Query: 239 VSSIDEISRLLVEQVTGRVRWRETIQWFA------NHGVKSVYEVGSGKVLTGLAKRIDK 292
           V+   +I+ LLV+QVTGRVRWRET++W          GV  + E+G+GKVLTG+ KR   
Sbjct: 239 VADKADIAGLLVQQVTGRVRWRETMEWLGAKESENGGGVTCIAELGAGKVLTGMIKRSLP 298

Query: 293 SLSAVSISKVEDID 306
            ++AV+++   D +
Sbjct: 299 DVTAVALNGAADFE 312


>gi|310815621|ref|YP_003963585.1| malonyl CoA-acyl carrier protein transacylase [Ketogulonicigenium
           vulgare Y25]
 gi|308754356|gb|ADO42285.1| malonyl CoA-acyl carrier protein transacylase [Ketogulonicigenium
           vulgare Y25]
          Length = 295

 Score =  275 bits (702), Expect = 7e-72,   Method: Compositional matrix adjust.
 Identities = 146/288 (50%), Positives = 198/288 (68%), Gaps = 1/288 (0%)

Query: 17  MGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPALTAVSMAFIRVM 76
           MGR L D +P AR VF EVD  L ++LS L+W G  E LT T NAQPAL A S+A +R +
Sbjct: 1   MGRALADHYPAARAVFAEVDDALGESLSALIWEGDIETLTLTRNAQPALMATSIAALRAL 60

Query: 77  EKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQEAVPPGLGSMVA 136
           E  G+ +  D  +VAGHSLGEY+ALCA  A  L+D+ RL+R RG +MQ AVP G+G+M A
Sbjct: 61  EAEGVKIT-DAGFVAGHSLGEYSALCAVGALGLADSARLLRIRGDAMQAAVPVGIGAMAA 119

Query: 137 IIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAADTCLNKGAKRAVFL 196
           I+GLD   V  I A+A++  +C+ ANDN   QVV+SG + AV+ A +    KGAKRA+ L
Sbjct: 120 ILGLDFATVAEIAAEAAQGEVCQAANDNDPSQVVVSGHKAAVERACEIAKAKGAKRALLL 179

Query: 197 PVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSIDEISRLLVEQVTGR 256
           PVSAPFHS+LM P + VM+  L +VT   P VP++ N  AS V+    I  LLV+QVTG 
Sbjct: 180 PVSAPFHSALMQPAADVMRDALAAVTINTPAVPVVANVVASAVTDPAAIRDLLVQQVTGS 239

Query: 257 VRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVED 304
           VRWRE++QW A +GV + +E+G+GK L+G+ +RI+K ++ ++I   E+
Sbjct: 240 VRWRESVQWMAANGVTTAWEIGAGKALSGMIRRIEKDIACLNIGTPEE 287


>gi|298291084|ref|YP_003693023.1| malonyl CoA-acyl carrier protein transacylase [Starkeya novella DSM
           506]
 gi|296927595|gb|ADH88404.1| malonyl CoA-acyl carrier protein transacylase [Starkeya novella DSM
           506]
          Length = 316

 Score =  275 bits (702), Expect = 7e-72,   Method: Compositional matrix adjust.
 Identities = 151/300 (50%), Positives = 202/300 (67%), Gaps = 1/300 (0%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           MS+   FPGQGSQ +GMG+ L D F  AR VFEEVD  L + LS +MW+G  E LT T N
Sbjct: 1   MSSAFVFPGQGSQAVGMGKALADEFAVARAVFEEVDEALGEKLSSVMWDGPIETLTLTAN 60

Query: 61  AQPALTAVSMAFIRVMEKN-GLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRAR 119
            QPAL A S+A +RV+E   GL +KRD ++VAGHSLGEY+AL AA + S++DT RL+R R
Sbjct: 61  TQPALMAASLAALRVLESEAGLDLKRDAAFVAGHSLGEYSALAAAGSISIADTARLLRLR 120

Query: 120 GKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVK 179
           G +MQ A P G G+M AI+GLD   V ++ A+A++  +C+IANDN  GQVV+SG   AV+
Sbjct: 121 GTAMQAATPVGTGAMAAILGLDFDKVAAVAAEAAQGEVCDIANDNAPGQVVVSGNAAAVE 180

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            A +    +GA RA+ L VSAPFH SL+   +  M+  L  V  + P V ++ N  A+PV
Sbjct: 181 RACEIAKREGAMRAILLTVSAPFHCSLIASAADAMREALAGVEVRAPKVLLVANVTAAPV 240

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
               EI  LLV+QVT  VRWRE++ + A  GV  + EVG+GKVL+GL KRI + ++A ++
Sbjct: 241 VDPAEIRALLVKQVTSTVRWRESVAFMAEQGVTRLVEVGTGKVLSGLTKRIARHVAAANV 300


>gi|56552119|ref|YP_162958.1| malonyl CoA-acyl carrier protein transacylase [Zymomonas mobilis
           subsp. mobilis ZM4]
 gi|56543693|gb|AAV89847.1| malonyl CoA-acyl carrier protein transacylase [Zymomonas mobilis
           subsp. mobilis ZM4]
          Length = 311

 Score =  275 bits (702), Expect = 8e-72,   Method: Compositional matrix adjust.
 Identities = 154/303 (50%), Positives = 189/303 (62%), Gaps = 2/303 (0%)

Query: 5   LTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPA 64
             FPGQGSQ +GMG+ L D+   AR VFEEVD  L QNL  LM  G +EEL  T NAQPA
Sbjct: 4   FIFPGQGSQSVGMGQALADASLAARHVFEEVDEALKQNLFRLMSQGPEEELRLTENAQPA 63

Query: 65  LTAVSMAFIRVMEKNGLCVKRDI-SYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSM 123
           + A SMA + ++EK G     D  S+VAGHSLGEY+AL AA AF+L  T  L++ RG++M
Sbjct: 64  IMAHSMAVLAMLEKEGNIRLTDAASFVAGHSLGEYSALAAADAFNLPTTAHLLKKRGQAM 123

Query: 124 QEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAAD 183
           Q AVP G G M AI+GLD   V+SI  +A+   IC+ ANDN  GQVVISG   A++ A  
Sbjct: 124 QAAVPVGEGGMAAILGLDFETVESIAQEAAENDICQAANDNAPGQVVISGSLAAIERAVA 183

Query: 184 TCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSID 243
               KGA+RAV L VSAPFH SLM P + VM   L     + P+VP+  N  A+  +   
Sbjct: 184 LAKGKGARRAVMLDVSAPFHCSLMQPAADVMAKALQENRPRQPIVPVFANVSATAETDPT 243

Query: 244 EISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVE 303
           +I  LLVEQVTGRVRWRE+I   A  GV+   E G GKVL  + KRI     A S+    
Sbjct: 244 KIMNLLVEQVTGRVRWRESIAAMAAAGVEEFVEFG-GKVLAPMIKRIAPDCKATSLIAPA 302

Query: 304 DID 306
           DI+
Sbjct: 303 DIE 305


>gi|58698326|ref|ZP_00373242.1| malonyl CoA-acyl carrier protein transacylase [Wolbachia
           endosymbiont of Drosophila ananassae]
 gi|225630572|ref|YP_002727363.1| malonyl CoA-acyl carrier protein transacylase [Wolbachia sp. wRi]
 gi|58535150|gb|EAL59233.1| malonyl CoA-acyl carrier protein transacylase [Wolbachia
           endosymbiont of Drosophila ananassae]
 gi|225592553|gb|ACN95572.1| malonyl CoA-acyl carrier protein transacylase [Wolbachia sp. wRi]
          Length = 326

 Score =  275 bits (702), Expect = 8e-72,   Method: Compositional matrix adjust.
 Identities = 141/306 (46%), Positives = 188/306 (61%), Gaps = 3/306 (0%)

Query: 4   VLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQP 63
           +  FPGQGSQ +GMGR LY  F  AR VF EVD  L + LS L++NG  EELT T NAQP
Sbjct: 2   IFAFPGQGSQFVGMGRSLYSEFSVARQVFNEVDSILGRKLSHLIFNGPIEELTITENAQP 61

Query: 64  ALTAVSMAFIRVMEK---NGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
           A+ AVS+A +RVME      L    ++ YV GHS+GEYTALCAA A +L   I+L++ R 
Sbjct: 62  AIMAVSIAMLRVMEHMFGKSLFTDHNVKYVCGHSVGEYTALCAAGALTLESAIKLLKVRS 121

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           ++M EA     G MVA++G +   V+ I       GICEIANDNGGGQVVISG ++A++ 
Sbjct: 122 EAMHEASLKCKGGMVALLGAEINEVEDILKSVQIDGICEIANDNGGGQVVISGTREALEM 181

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
             D   N   ++ + L VS PFHSSLM P  + +   L  +    P+VP++ N  A   S
Sbjct: 182 LPDLFKNSSVRKLIKLQVSGPFHSSLMKPADEKVLEFLKGIKITRPIVPLITNVTAKEES 241

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
               I  LL +QV  RV+WRE + + ++ G+    E+G  KVL+ L KRID+S+S  +I 
Sbjct: 242 DPKVIKTLLAKQVVSRVKWREMVLYMSSRGINKFVEIGPNKVLSNLVKRIDQSISTKNID 301

Query: 301 KVEDID 306
            + DID
Sbjct: 302 SIGDID 307


>gi|167646479|ref|YP_001684142.1| malonyl CoA-acyl carrier protein transacylase [Caulobacter sp. K31]
 gi|167348909|gb|ABZ71644.1| malonyl CoA-acyl carrier protein transacylase [Caulobacter sp. K31]
          Length = 314

 Score =  274 bits (700), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 155/316 (49%), Positives = 201/316 (63%), Gaps = 6/316 (1%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           MS    FPGQGSQ +GMG DL  +F  AR VF+EVD  L Q L  LM  G + +LT T N
Sbjct: 1   MSIAFIFPGQGSQTVGMGADLAQAFATAREVFQEVDDALGQKLFKLMVEGPEGDLTLTEN 60

Query: 61  AQPALTAVSMAFIRVMEKN-GLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRAR 119
           AQPAL AVS+A  RV+E+  G+ + R  ++VAGHSLGEY+AL AA + +L+DT RL++ R
Sbjct: 61  AQPALMAVSLAVSRVLEREFGVGIDR-AAFVAGHSLGEYSALAAAGSITLADTARLLKLR 119

Query: 120 GKSMQEAVPPGLGSMVAIIG--LDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDA 177
           G++MQ AVP G G+M ++IG   D  + ++  A  S VG+C +ANDN  G VVISG + A
Sbjct: 120 GQAMQRAVPVGEGAMASLIGPKTDLALAEAAAAAGSEVGVCVVANDNNNGNVVISGTKAA 179

Query: 178 VKCAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCAS 237
           V  A +     GA RA+ L VSAPFH  LM P +  M+  L   T   P  P++ N  AS
Sbjct: 180 VDKAIEKAKELGA-RAIPLNVSAPFHCPLMRPAADEMEEALARTTIIAPRAPLVANVTAS 238

Query: 238 PVSSIDEISRLLVEQVTGRVRWRETIQWFANH-GVKSVYEVGSGKVLTGLAKRIDKSLSA 296
           PV   D I RLLVEQVTGRVRWRE++ W A   GV    E G+GKVL+G+AKRI     A
Sbjct: 239 PVHEPDVIRRLLVEQVTGRVRWRESMTWLAGEGGVTRFAEAGAGKVLSGMAKRIAPDAEA 298

Query: 297 VSISKVEDIDLALRSI 312
           V ++   D++   +S+
Sbjct: 299 VPLNSPADLEAFAKSL 314


>gi|16125920|ref|NP_420484.1| acyl-carrier-protein S-malonyltransferase [Caulobacter crescentus
           CB15]
 gi|221234683|ref|YP_002517119.1| malonyl-CoA-(acyl-carrier-protein) transacylase [Caulobacter
           crescentus NA1000]
 gi|13423084|gb|AAK23652.1| malonyl CoA-acyl carrier protein transacylase [Caulobacter
           crescentus CB15]
 gi|220963855|gb|ACL95211.1| malonyl-CoA-(acyl-carrier-protein) transacylase [Caulobacter
           crescentus NA1000]
          Length = 314

 Score =  273 bits (699), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 154/316 (48%), Positives = 201/316 (63%), Gaps = 6/316 (1%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           MS    FPGQGSQ +GMG DL ++F  AR VF+EVD  L Q L  LM  G + +LT T N
Sbjct: 1   MSIAFIFPGQGSQSVGMGADLAEAFSAAREVFQEVDDALGQKLFALMKEGPEGDLTLTEN 60

Query: 61  AQPALTAVSMAFIRVMEKN-GLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRAR 119
           AQPAL AVS+A  R +EK  G+ + +  ++VAGHSLGEY+AL AA A SLSDT RL++ R
Sbjct: 61  AQPALMAVSLAVTRTLEKEFGVGIDK-AAFVAGHSLGEYSALAAAGAISLSDTARLLKLR 119

Query: 120 GKSMQEAVPPGLGSMVAIIG--LDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDA 177
           G++MQ AVP G G+M ++IG   D  + ++  A  S VG+C +ANDN  G VVISG + A
Sbjct: 120 GQAMQRAVPVGEGAMASLIGPKTDLALAEAAAAAGSEVGVCVVANDNNNGNVVISGAKAA 179

Query: 178 VKCAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCAS 237
           V  A +     GA RA+ L VSAPFH  LM P +  M   L + T   P  P++ N  A+
Sbjct: 180 VDKAIEKAKELGA-RAIPLNVSAPFHCPLMQPAADEMATALAAATIVAPRAPLVANVTAA 238

Query: 238 PVSSIDEISRLLVEQVTGRVRWRETIQWFANH-GVKSVYEVGSGKVLTGLAKRIDKSLSA 296
           P+   D I +LLVEQVTGRVRWRE++ W A   GV    E G+GKVL+G+AKRI     A
Sbjct: 239 PIHDPDVIRKLLVEQVTGRVRWRESMTWMATEGGVTRFAEAGAGKVLSGMAKRIAPDAEA 298

Query: 297 VSISKVEDIDLALRSI 312
           V ++   D++   +S+
Sbjct: 299 VPLNTPADLEAFAKSL 314


>gi|42520704|ref|NP_966619.1| malonyl CoA-acyl carrier protein transacylase [Wolbachia
           endosymbiont of Drosophila melanogaster]
 gi|42410444|gb|AAS14553.1| malonyl CoA-acyl carrier protein transacylase [Wolbachia
           endosymbiont of Drosophila melanogaster]
          Length = 326

 Score =  273 bits (697), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 140/306 (45%), Positives = 188/306 (61%), Gaps = 3/306 (0%)

Query: 4   VLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQP 63
           +  FPGQGSQ +GMG+ LY  F  AR VF EVD  L+  LS L++NG  EELT T NAQP
Sbjct: 2   IFAFPGQGSQFVGMGKSLYSEFSVARQVFHEVDSILDGKLSHLIFNGPIEELTITENAQP 61

Query: 64  ALTAVSMAFIRVMEK---NGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
           A+ AVS+A +RVME      L    ++ YV GHS+GEYTALCAA A +L   I+L++ R 
Sbjct: 62  AIMAVSIAMLRVMEHVFGKSLFTDHNVKYVCGHSVGEYTALCAAGALTLESAIKLLKVRS 121

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           ++M EA     G MVA++G +   V+ I       GICEIANDNGGGQVVISG ++A++ 
Sbjct: 122 EAMHEASLKCKGGMVALLGAEINEVEDILKSVQIDGICEIANDNGGGQVVISGTREALEM 181

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
             D   N   ++ + L VS PFHSSLM P  + +   L  +    P+VP++ N  A   S
Sbjct: 182 LPDLFKNSSVRKLIKLQVSGPFHSSLMKPADEKVLEFLKGIKITRPIVPLISNVTAKEES 241

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
               I  LL +QV  RV+WRE + + ++ G+    E+G  KVL+ L KRID+S+S  +I 
Sbjct: 242 DPKVIKTLLAKQVVSRVKWREMVLYMSSRGINKFVEIGPNKVLSNLVKRIDQSISTKNID 301

Query: 301 KVEDID 306
            + DID
Sbjct: 302 SIGDID 307


>gi|114799413|ref|YP_760857.1| malonyl CoA-acyl carrier protein transacylase [Hyphomonas neptunium
           ATCC 15444]
 gi|114739587|gb|ABI77712.1| malonyl CoA-acyl carrier protein transacylase [Hyphomonas neptunium
           ATCC 15444]
          Length = 316

 Score =  273 bits (697), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 146/313 (46%), Positives = 199/313 (63%), Gaps = 1/313 (0%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M+    FPGQGSQ IGMG+ L D+FP A+ VFEEVD  L+Q LS +MW G   ELT T N
Sbjct: 1   MTLAFIFPGQGSQEIGMGKALADAFPAAKAVFEEVDAALSQKLSSVMWEGDIAELTLTAN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
            QPAL A S+A +R +E +     +D ++VAGHSLGEY+AL +A + S+SDT RL+R RG
Sbjct: 61  TQPALMAHSVAAMRALEAHFGISAKDAAFVAGHSLGEYSALASAGSISVSDTARLLRIRG 120

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRV-GICEIANDNGGGQVVISGLQDAVK 179
            +MQ AV PG G+M A++G D    ++ CA      G C+IANDN  GQ+VISG + A+ 
Sbjct: 121 NAMQSAVQPGQGAMAALLGADYAQAEAACAAGRETGGACDIANDNAPGQLVISGTKAAID 180

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            A       G K+A+ L VSAPFH +LM P +  M   L     + P VP++ N  AS V
Sbjct: 181 AAIVWSQANGVKKAMALNVSAPFHCALMQPAADAMAAALADTEIKAPAVPLVANVSASAV 240

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
           +  + I + LV+QVTGRVRW E++Q+    GV    E G+GKVLT + +RI+KSL+  ++
Sbjct: 241 TDPETIRQNLVKQVTGRVRWTESVQYMVGQGVTMTGEAGAGKVLTVMQRRIEKSLNGFTL 300

Query: 300 SKVEDIDLALRSI 312
              ED++   ++I
Sbjct: 301 GTPEDLEAFAKAI 313


>gi|294677212|ref|YP_003577827.1| [acyl-carrier-protein] S-malonyltransferase [Rhodobacter capsulatus
           SB 1003]
 gi|294476032|gb|ADE85420.1| [acyl-carrier-protein] S-malonyltransferase [Rhodobacter capsulatus
           SB 1003]
          Length = 309

 Score =  271 bits (694), Expect = 6e-71,   Method: Compositional matrix adjust.
 Identities = 151/305 (49%), Positives = 202/305 (66%), Gaps = 1/305 (0%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           MS    FPGQG+Q IGMG+ L +++P A+ VF+EVD  L + LS L+W G  E LT T N
Sbjct: 1   MSVAWVFPGQGAQTIGMGKALAEAYPAAKAVFDEVDAALGEKLSALIWEGEIERLTLTAN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
           AQPAL A S+A +  ++  G+ V +  ++VAGHSLGEY+ALCAA A SL+DT RL+R RG
Sbjct: 61  AQPALMATSLAAVAALKAEGIEVGQ-AAFVAGHSLGEYSALCAAGALSLADTARLLRIRG 119

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           ++MQ AVP G+G+M A++GLD      + A+A++  +C+ ANDN   QVV+SG + AV+ 
Sbjct: 120 EAMQSAVPVGVGAMAALLGLDFATAAEVAAEAAQGEVCQAANDNDPAQVVVSGHKAAVER 179

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A +    KGAKRAV LPVSAPFH +LM P +  M   L +VT   PVVP++ N  A  V 
Sbjct: 180 AVEIAKGKGAKRAVMLPVSAPFHCALMQPAADRMAEALAAVTVSAPVVPVVANVRAEAVC 239

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
               I +LLVEQVTG VRWRE++ W    GV    EVG+GK L+G+ KRI K  +  ++ 
Sbjct: 240 DPATIRQLLVEQVTGSVRWRESVLWMVGQGVTDFCEVGAGKALSGMIKRIAKDTTQKAVG 299

Query: 301 KVEDI 305
             ED+
Sbjct: 300 TPEDV 304


>gi|295689691|ref|YP_003593384.1| malonyl CoA-acyl carrier protein transacylase [Caulobacter segnis
           ATCC 21756]
 gi|295431594|gb|ADG10766.1| malonyl CoA-acyl carrier protein transacylase [Caulobacter segnis
           ATCC 21756]
          Length = 314

 Score =  271 bits (693), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 152/310 (49%), Positives = 194/310 (62%), Gaps = 6/310 (1%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           MS    FPGQGSQ +GMG DL ++F  AR VF+EVD  L Q L  LM  G + +LT T N
Sbjct: 1   MSIAFIFPGQGSQSVGMGVDLAEAFASAREVFQEVDDALGQKLFALMKEGPEGDLTLTEN 60

Query: 61  AQPALTAVSMAFIRVMEKN-GLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRAR 119
           AQPAL AVS+A  R +EK  G+ + +  ++VAGHSLGEY+AL AA A SLSDT RL++ R
Sbjct: 61  AQPALMAVSLAVTRTLEKEFGVGIDK-AAFVAGHSLGEYSALAAAGAISLSDTARLLKLR 119

Query: 120 GKSMQEAVPPGLGSMVAIIG--LDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDA 177
           G++MQ AVP G G+M ++IG   D  + +      S VG+C +ANDN  G VVISG + A
Sbjct: 120 GQAMQRAVPVGEGAMASLIGPKTDLALAEEAAKAGSEVGVCVVANDNNNGNVVISGAKAA 179

Query: 178 VKCAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCAS 237
           V  A +     GA RA+ L VSAPFH  LM P +  M   L   T   P  P++ N  A+
Sbjct: 180 VDKAIEKAKELGA-RAIPLNVSAPFHCPLMQPAADEMAEALAKTTILAPRAPLVANVTAA 238

Query: 238 PVSSIDEISRLLVEQVTGRVRWRETIQWFANH-GVKSVYEVGSGKVLTGLAKRIDKSLSA 296
           PV   D I +LLVEQVTGRVRWRE++ W A   GV    E G+GKVL+G+AKRI     A
Sbjct: 239 PVHDPDVIRKLLVEQVTGRVRWRESMTWLATQGGVTRFAEAGAGKVLSGMAKRIAPDAEA 298

Query: 297 VSISKVEDID 306
             ++   D++
Sbjct: 299 TPLNTPADLE 308


>gi|126725405|ref|ZP_01741247.1| malonyl CoA-acyl carrier protein transacylase [Rhodobacterales
           bacterium HTCC2150]
 gi|126704609|gb|EBA03700.1| malonyl CoA-acyl carrier protein transacylase [Rhodobacterales
           bacterium HTCC2150]
          Length = 328

 Score =  271 bits (692), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 146/294 (49%), Positives = 198/294 (67%), Gaps = 1/294 (0%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M+    FPGQG+Q IGMG DL  ++P A+ VF+EVD  L + LS L+W G ++ LT T N
Sbjct: 15  MTRAFVFPGQGAQTIGMGADLAAAYPAAKAVFDEVDDALGEKLSSLIWEGDKDTLTLTQN 74

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
           AQPAL A S+A ++ +E  G+ +  D  +VAGHSLGEY+AL AA + SLSDT RL+R RG
Sbjct: 75  AQPALMATSLAAMKALEAEGITMA-DAGFVAGHSLGEYSALAAAGSISLSDTARLLRIRG 133

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
            +MQEAVP G+G+M A++GLD     ++ A+A+   +C+ ANDN   QVVISG + AV+ 
Sbjct: 134 LAMQEAVPVGVGAMAALLGLDFGTATAVAAEAAEGEVCQAANDNDPSQVVISGHKAAVER 193

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A      KGAKRA+ LPVSAPFH +LM P +  M   L +V  + P VP++ N  AS +S
Sbjct: 194 ACIIAKEKGAKRAMLLPVSAPFHCTLMQPAADKMAEALANVEIKAPSVPLVANVVASAIS 253

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSL 294
              EI  LLV+QVTG VRWRE++ W +   V   +E+G+GK L+G+ +RIDK +
Sbjct: 254 DPAEIRELLVKQVTGSVRWRESVLWMSAQVVTEAWEIGAGKALSGMIRRIDKEI 307


>gi|225631025|ref|ZP_03787779.1| malonyl CoA-acyl carrier protein transacylase [Wolbachia
           endosymbiont of Muscidifurax uniraptor]
 gi|225591273|gb|EEH12408.1| malonyl CoA-acyl carrier protein transacylase [Wolbachia
           endosymbiont of Muscidifurax uniraptor]
          Length = 326

 Score =  271 bits (692), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 139/306 (45%), Positives = 188/306 (61%), Gaps = 3/306 (0%)

Query: 4   VLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQP 63
           +  FPGQGSQ +GMG+ LY  F  AR VF EVD  L++ LS L++NG  EELT T +AQP
Sbjct: 2   IFAFPGQGSQFVGMGKSLYSEFSVARQVFNEVDSILDRKLSHLIFNGPIEELTITEDAQP 61

Query: 64  ALTAVSMAFIRVMEK---NGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
           A+ AVS+A +RVME      L    ++ YV GHS+GEYTALCAA A +L   I+L++ R 
Sbjct: 62  AIMAVSIAMLRVMEHVFGKSLFTDHNVKYVCGHSVGEYTALCAAGALTLESAIKLLKVRS 121

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           ++M EA     G MVA++G +   V+ I       GICEIANDNGGGQVVISG ++A++ 
Sbjct: 122 EAMHEASLKCKGGMVALLGAEINEVEDILKSVQIDGICEIANDNGGGQVVISGTREALEM 181

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
             D   N   ++ + L VS PFHSSLM P  + +   L  +    P+VP++ N  A   S
Sbjct: 182 LPDLFKNSSVRKLIKLQVSGPFHSSLMKPADEKVLEFLKGIKITRPIVPLISNVTAKEES 241

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
               I  LL +QV  RV+WRE + + ++ G+    E G  KVL+ L KRID+S+S  +I 
Sbjct: 242 DPKVIKTLLAKQVVSRVKWREMVLYMSSRGINKFVETGPNKVLSNLVKRIDQSISTKNID 301

Query: 301 KVEDID 306
            + DID
Sbjct: 302 SIGDID 307


>gi|157827152|ref|YP_001496216.1| malonyl CoA-acyl carrier protein transacylase [Rickettsia bellii
           OSU 85-389]
 gi|157802456|gb|ABV79179.1| Malonyl CoA-acyl carrier protein transacylase [Rickettsia bellii
           OSU 85-389]
          Length = 312

 Score =  269 bits (688), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 141/313 (45%), Positives = 194/313 (61%), Gaps = 8/313 (2%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M T   FPGQGSQ IGMG D YD+F  A+  F+ +D  LN+ L+D+++N + EELT T N
Sbjct: 1   MKTAFIFPGQGSQAIGMGNDFYDNFKSAKETFQTIDEALNRKLTDIIFNSTSEELTLTTN 60

Query: 61  AQPALTAVSMAFIRVM--EKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRA 118
           AQPAL AVSMA I  +  E N   V+    YVAGHSLGEY+ALCAA++ S+    +L+  
Sbjct: 61  AQPALMAVSMAIINTIKAETNKNIVQL-CDYVAGHSLGEYSALCAAESISIETAAKLLHT 119

Query: 119 RGKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAV 178
           R  SMQEA P   G+M A IG+    ++ I  ++     CEIANDN  GQ+VISG  +AV
Sbjct: 120 RSSSMQEACPANFGAMAACIGISIDKLEKIVKESK----CEIANDNIEGQIVISGKVEAV 175

Query: 179 KCAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASP 238
             A +     G K A+ L VSAPFH SLM P  + M+  LD+     P++P++ N+ A P
Sbjct: 176 DHAINLIKEAGYK-AIKLKVSAPFHCSLMKPAEEKMRIALDNSVITKPLIPVIQNYTAKP 234

Query: 239 VSSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVS 298
           V    EI + LV Q+ GRVRWRET++ F    +  + E+G+G VLT + ++I+      +
Sbjct: 235 VLEPLEIKQNLVLQICGRVRWRETLELFNELNITHIVEIGAGNVLTNMLRKINYPFKLSN 294

Query: 299 ISKVEDIDLALRS 311
           IS VE++ L L++
Sbjct: 295 ISNVEEMKLFLQA 307


>gi|58584659|ref|YP_198232.1| (acyl-carrier-protein) S-malonyltransferase, FabD [Wolbachia
           endosymbiont strain TRS of Brugia malayi]
 gi|58418975|gb|AAW70990.1| (acyl-carrier-protein) S-malonyltransferase, FabD [Wolbachia
           endosymbiont strain TRS of Brugia malayi]
          Length = 326

 Score =  268 bits (686), Expect = 6e-70,   Method: Compositional matrix adjust.
 Identities = 139/306 (45%), Positives = 190/306 (62%), Gaps = 3/306 (0%)

Query: 4   VLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQP 63
           +  FPGQGSQ +GMGRDLY  F  A+ VF+EVD  L + LS L++NG  EELT T NAQP
Sbjct: 2   IFAFPGQGSQFVGMGRDLYSQFSVAKQVFDEVDSILGRKLSHLIFNGPVEELTITENAQP 61

Query: 64  ALTAVSMAFIRVMEK---NGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
           A+TAVS+A +RVME      L    D+ YV GHS+GEYTALCAA A +L  T++L++AR 
Sbjct: 62  AITAVSIATLRVMEHVFGKSLLSDHDVKYVCGHSVGEYTALCAAGALTLESTVKLLKARS 121

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           ++M +A     G MVA++G +   V+ I   A    I  IANDNGGGQVV+SG  +A++ 
Sbjct: 122 EAMHKASLKCKGGMVALLGAEISEVEDILESAQIDEIYGIANDNGGGQVVVSGTAEALEI 181

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
                 N   ++ + L VS PFHSSLM P  + +   L+S+    P +P + N  A   S
Sbjct: 182 LPGLFKNSSVRKLIKLQVSGPFHSSLMRPADEKILEFLESIDITHPSIPFVSNVTAKEES 241

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
           + + I  LL +Q+  RV+WRE +   A+ G+    E+G  KVL+ L KRID+S+S  +I 
Sbjct: 242 NPETIKILLAKQIVSRVKWREMVLHMASSGINEFVEIGPNKVLSNLVKRIDQSISTKNIG 301

Query: 301 KVEDID 306
            + DID
Sbjct: 302 SISDID 307


>gi|288575037|ref|ZP_06393394.1| malonyl CoA-acyl carrier protein transacylase [Dethiosulfovibrio
           peptidovorans DSM 11002]
 gi|288570778|gb|EFC92335.1| malonyl CoA-acyl carrier protein transacylase [Dethiosulfovibrio
           peptidovorans DSM 11002]
          Length = 318

 Score =  268 bits (686), Expect = 7e-70,   Method: Compositional matrix adjust.
 Identities = 144/303 (47%), Positives = 196/303 (64%), Gaps = 3/303 (0%)

Query: 5   LTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPA 64
           L FPGQG+Q +GMGRDLY+SFP AR VF+E D  L  +LS +++ G +E+LT T   QPA
Sbjct: 8   LLFPGQGAQSVGMGRDLYESFPAARRVFDEADEALGFSLSSIIFEGPEEKLTLTEYTQPA 67

Query: 65  LTAVSMAFIRVM-EKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSM 123
           L  VS+AF R + E NG+ +  D  +VAGHSLGEY+AL A+   SL+D +RLV ARG+ M
Sbjct: 68  LLTVSLAFFRALTEDNGIVLSPD--FVAGHSLGEYSALVASGTLSLADGVRLVNARGRLM 125

Query: 124 QEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAAD 183
           Q+AVP G G+M AI+GL D  V  IC++     +CE AN N  GQVVISG  D+V  A +
Sbjct: 126 QKAVPEGEGAMAAILGLKDSDVRDICSRFDGDKVCEAANFNSPGQVVISGDSDSVAKAIE 185

Query: 184 TCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSID 243
                GAKRA+ L VSAPFH  LMT V+  +   ++  +  +   P++ N  ASPV+S++
Sbjct: 186 AAKEAGAKRAIPLNVSAPFHCRLMTDVADELSKEMERCSWSESSCPLVANVSASPVTSVE 245

Query: 244 EISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVE 303
           +I   L  Q    VRW E++++ ++ GV +  E+G GKVL GLAK+  K    +SI   E
Sbjct: 246 DIRAGLYRQTYSPVRWVESMRYMSDAGVSTFLELGPGKVLAGLAKKCVKGSKTLSIGSAE 305

Query: 304 DID 306
           D+D
Sbjct: 306 DLD 308


>gi|91205486|ref|YP_537841.1| malonyl CoA-acyl carrier protein transacylase [Rickettsia bellii
           RML369-C]
 gi|91069030|gb|ABE04752.1| Malonyl CoA-acyl carrier protein transacylase [Rickettsia bellii
           RML369-C]
          Length = 312

 Score =  267 bits (683), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 141/313 (45%), Positives = 194/313 (61%), Gaps = 8/313 (2%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M T   FPGQGSQ IGMG D YD+F  A+  F+ +D  LN+ L+D+++N + EELT T N
Sbjct: 1   MKTAFIFPGQGSQAIGMGNDFYDNFKSAKETFQTIDEALNRKLTDIIFNSTSEELTLTTN 60

Query: 61  AQPALTAVSMAFIRVM--EKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRA 118
           AQPAL AVSMA I  +  E N   V+    YVAGHSLGEY+ALCAA++ S+    +L+  
Sbjct: 61  AQPALMAVSMAIINTIKAETNKNIVQL-CDYVAGHSLGEYSALCAAESISIETAAKLLHT 119

Query: 119 RGKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAV 178
           R  SMQEA P   G+M A IG+    ++ I  ++     CEIANDN  GQ+VISG  +AV
Sbjct: 120 RSSSMQEACPANFGAMAACIGISIDKLEKIVKESK----CEIANDNIEGQIVISGKVEAV 175

Query: 179 KCAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASP 238
             A +     G K A+ L VSAPFH SLM P  + M+  LD+     P++P++ N+ A P
Sbjct: 176 DHAINLIKEAGYK-AIKLKVSAPFHCSLMKPAEEKMRIALDNSVITKPLIPVIQNYTAKP 234

Query: 239 VSSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVS 298
           V    EI + LV Q+ GRVRWRET++ F +  +  + E+G+G VLT +  +I+      +
Sbjct: 235 VLEPLEIKQNLVLQICGRVRWRETLELFNDLNITHIVEIGAGNVLTNMLGKINYPFKLSN 294

Query: 299 ISKVEDIDLALRS 311
           IS VE++ L L++
Sbjct: 295 ISNVEEMKLFLQA 307


>gi|330813907|ref|YP_004358146.1| malonyl CoA-acyl carrier protein transacylase [Candidatus
           Pelagibacter sp. IMCC9063]
 gi|327487002|gb|AEA81407.1| malonyl CoA-acyl carrier protein transacylase [Candidatus
           Pelagibacter sp. IMCC9063]
          Length = 306

 Score =  267 bits (683), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 131/311 (42%), Positives = 199/311 (63%), Gaps = 9/311 (2%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M   + FPGQGSQ +GMG D+Y++F EA+ V++EVD  L  NLSD+++ G   +L  T N
Sbjct: 1   MKKSILFPGQGSQYVGMGLDVYEAFDEAKEVYQEVDDVLQSNLSDIIFRGEASDLNLTAN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
            QPA+ A  +A  RV++K       D S+ AGHSLGEYTAL  A++ SL+D  +++RARG
Sbjct: 61  TQPAIMATGVAIFRVLQKKNNLKITDFSFCAGHSLGEYTALVCAESLSLADAAKILRARG 120

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           ++MQ AV PG GSM AI+G +   ++ +  + S     EI+NDN  GQ+V+SG +  V  
Sbjct: 121 QAMQSAVKPGEGSMAAILGSEINDIEQLIKE-SNCSTVEISNDNCPGQIVVSGKKSEV-- 177

Query: 181 AADTCL----NKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCA 236
             D CL     K +K+++ LPVSAPFH  LM P ++ +K ++ S++ ++P++PI+ N  A
Sbjct: 178 --DECLIAIKQKLSKKSISLPVSAPFHCQLMKPAAEEIKELIMSLSMKNPLIPIVSNVTA 235

Query: 237 SPVSSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSA 296
             V+  DE+ +LL++Q+  RVRWRE I++   +   S  E+G GK L+G+ KR  K +  
Sbjct: 236 EAVTQADEVKQLLIQQIYKRVRWREIIEYMFKNSNDSFLEIGPGKALSGMLKRFKKEIEI 295

Query: 297 VSISKVEDIDL 307
            + +  ED++L
Sbjct: 296 KNYNNREDLEL 306


>gi|157964876|ref|YP_001499700.1| malonyl CoA-acyl carrier protein transacylase [Rickettsia massiliae
           MTU5]
 gi|157844652|gb|ABV85153.1| Malonyl CoA-acyl carrier protein transacylase [Rickettsia massiliae
           MTU5]
          Length = 318

 Score =  267 bits (682), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 134/313 (42%), Positives = 195/313 (62%), Gaps = 2/313 (0%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M T   FPGQG Q+IGMG+D YD+F  A+  F+ VD  LN+ L+D+++NG  EELT T N
Sbjct: 5   MKTAFIFPGQGLQLIGMGKDFYDNFKPAKETFQIVDEVLNRKLTDIIFNGPSEELTLTTN 64

Query: 61  AQPALTAVSMAFIRVME-KNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRAR 119
           AQPAL AVSMA I +++ + G  +     Y AGHSLGEY+ALC+ ++ +L    +L+  R
Sbjct: 65  AQPALMAVSMAIINIIKAETGKSLDSLCDYAAGHSLGEYSALCSTESINLETATKLLHIR 124

Query: 120 GKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVK 179
             SMQEA P G GSM A I +    ++ I A+++++ +C+IANDN  GQ+VISG   A+ 
Sbjct: 125 STSMQEACPEGEGSMAACINIPLQKLEEILAESNKINLCQIANDNIEGQIVISGKTTAID 184

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            A     + G K A+ L VSAPFH SLM P  + M+  LD      P++PI+ N+ A P 
Sbjct: 185 HAISIIKDLGYK-AIKLKVSAPFHCSLMKPAEEKMRVALDKAVINKPLIPIIQNYTAKPT 243

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
               EI + L+ Q+ GRVRWRET++ F    +  + E+G+G VLT + ++I+      +I
Sbjct: 244 LDPTEIKQNLILQICGRVRWRETLELFNKLEITHIVEIGAGSVLTNMLRQINYPYKLSNI 303

Query: 300 SKVEDIDLALRSI 312
           S +E++   L ++
Sbjct: 304 SNLEELQNCLDNV 316


>gi|67458563|ref|YP_246187.1| acyl-carrier-protein S-malonyltransferase [Rickettsia felis
           URRWXCal2]
 gi|67004096|gb|AAY61022.1| Malonyl CoA-acyl carrier protein transacylase [Rickettsia felis
           URRWXCal2]
          Length = 313

 Score =  267 bits (682), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 133/306 (43%), Positives = 192/306 (62%), Gaps = 2/306 (0%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M T   FPGQGSQ+IGMG+D YD+F  A+  F+ VD  LN+ L+D+++NG+ +ELT T N
Sbjct: 1   MKTAFIFPGQGSQLIGMGKDFYDNFKPAKEAFQIVDEALNRKLTDIIFNGTSKELTLTTN 60

Query: 61  AQPALTAVSMAFIRVME-KNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRAR 119
           AQPAL AVSMA I +++ + G  +     Y AGHSLGEY+ALC+ ++ SL  T +L+  R
Sbjct: 61  AQPALMAVSMAIINIIKAETGKSLDSLCDYAAGHSLGEYSALCSTESISLETTAKLLHIR 120

Query: 120 GKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVK 179
             SMQEA P G GSM A I +    ++ I    +++ +C+IANDN  GQ+VISG   A+ 
Sbjct: 121 STSMQEACPEGEGSMAACINIPLQKLEEILEDINKINLCQIANDNIEGQIVISGKTAAID 180

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            A     + G K A+ L VSAPFH SLM P  + M+  LD      P++P++ N+ A P 
Sbjct: 181 HAISIIKDLGYK-AIKLKVSAPFHCSLMKPAEEKMRVALDKAVINKPLIPVIQNYTAKPT 239

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
               EI + L+ Q+ GRVRWRET++ F    +  + E+G+G VLT + ++I+      +I
Sbjct: 240 LDPTEIKQNLILQICGRVRWRETLELFNTLDITHIVEIGAGSVLTNMLRKINYPYKLSNI 299

Query: 300 SKVEDI 305
           S +E++
Sbjct: 300 SNLEEL 305


>gi|103487381|ref|YP_616942.1| malonyl CoA-acyl carrier protein transacylase [Sphingopyxis
           alaskensis RB2256]
 gi|98977458|gb|ABF53609.1| [Acyl-carrier-protein] S-malonyltransferase [Sphingopyxis
           alaskensis RB2256]
          Length = 312

 Score =  267 bits (682), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 149/310 (48%), Positives = 195/310 (62%), Gaps = 7/310 (2%)

Query: 7   FPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPALT 66
           FPGQGSQ +GMGR L D+   AR VF+EVD  L Q L  LM  G +++LT T NAQPA+ 
Sbjct: 6   FPGQGSQSVGMGRALADASSHAREVFQEVDDALGQKLFRLMSEGPEDQLTLTENAQPAIM 65

Query: 67  AVSMAFIRVMEKNG---LCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSM 123
           A ++A +RV+EK G   L  K D  YVAGHSLGEY+ALCAA AF L+   RL++ RG++M
Sbjct: 66  ANAIATLRVLEKEGGVTLAAKAD--YVAGHSLGEYSALCAAGAFDLATAARLLKTRGQAM 123

Query: 124 QEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAAD 183
           Q AVP G+G+M A++G D      +   A+   IC +ANDN   QVVISG + AV+ A  
Sbjct: 124 QAAVPVGVGAMAALLGADIETAQRLADAAAEGEICTVANDNDPLQVVISGHKGAVERAVA 183

Query: 184 TCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSID 243
              + G KR V LPVSAPFH  LM P +  M   L +     P+VP++ N  ASPVS  D
Sbjct: 184 LVKDYGIKRGVLLPVSAPFHCPLMQPAADAMAEALGANPPAAPLVPVVANVTASPVSDAD 243

Query: 244 EISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKR-IDKSLSAVSISKV 302
            I  LLV+QVTGRVRWRE++    + GV    E G GKVL+ + KR     +  VS+  +
Sbjct: 244 TIRDLLVQQVTGRVRWRESVGAMEDVGVTHFVEFG-GKVLSPMVKRSASGEVETVSLISM 302

Query: 303 EDIDLALRSI 312
           +DI+  L+++
Sbjct: 303 DDIEALLKTL 312


>gi|83945282|ref|ZP_00957631.1| acyl-carrier-protein S-malonyltransferase [Oceanicaulis alexandrii
           HTCC2633]
 gi|83851452|gb|EAP89308.1| acyl-carrier-protein S-malonyltransferase [Oceanicaulis alexandrii
           HTCC2633]
          Length = 313

 Score =  266 bits (680), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 144/314 (45%), Positives = 192/314 (61%), Gaps = 1/314 (0%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M+   TFPGQGSQ +GMG+ L +SF  AR VFEEVD  L Q LS LMW+G  EELT T N
Sbjct: 1   MALAFTFPGQGSQAVGMGKPLAESFASARAVFEEVDDALGQKLSQLMWDGPIEELTLTEN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
           AQPA+ AVS+A +  ++ +         +VAGHSLGEY+ALCAA A S+SD  +L++ RG
Sbjct: 61  AQPAIMAVSLAAMAALKSDFDVDVTAAKFVAGHSLGEYSALCAAGAVSVSDAAKLLKLRG 120

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           +SMQ+AVP G G+M A++G +    +     A   GI  IANDN  GQ+VISG + AV  
Sbjct: 121 QSMQKAVPVGQGAMAALLGAEMEQAEKAIELAGSEGIVTIANDNAPGQIVISGDKAAVDA 180

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A     + G ++A+ LPVSAPFH  LM P +  M   L S    +P VP++ N  A  VS
Sbjct: 181 AVAAIKDLGVRKAMLLPVSAPFHCPLMEPAADAMADALKSAAISNPSVPVVTNVSAGAVS 240

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
             + +   LVEQVTG+VRWRE++ W    GV+   E G+ KVLT + KR  K     ++ 
Sbjct: 241 DAETLRTQLVEQVTGKVRWRESVDWMHGQGVEQFVEAGA-KVLTTMLKRHIKEAQGTALV 299

Query: 301 KVEDIDLALRSIVG 314
             +D++    S+ G
Sbjct: 300 TADDLEAFAASLKG 313


>gi|15893039|ref|NP_360753.1| acyl-carrier-protein S-malonyltransferase [Rickettsia conorii str.
           Malish 7]
 gi|15620241|gb|AAL03654.1| malonyl CoA-acyl carrier protein transacylase [Rickettsia conorii
           str. Malish 7]
          Length = 314

 Score =  265 bits (678), Expect = 4e-69,   Method: Compositional matrix adjust.
 Identities = 134/313 (42%), Positives = 194/313 (61%), Gaps = 2/313 (0%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M T   FPGQG Q+IGMG+D YD+F  A+  F+ VD  LN+ L+D+++NG  EELT T N
Sbjct: 1   MKTAFIFPGQGLQLIGMGKDFYDNFKPAKETFQIVDEVLNRKLTDIIFNGPSEELTLTTN 60

Query: 61  AQPALTAVSMAFIRVME-KNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRAR 119
           AQPAL AVSMA I +++ + G  + R   Y AGHSLGEY+ALC+ ++ +L    +L+  R
Sbjct: 61  AQPALMAVSMAIINIIKAETGKSLDRLCDYAAGHSLGEYSALCSTESINLETAAKLLHIR 120

Query: 120 GKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVK 179
             SMQEA P G GSM A I +    ++ I  + +++ +C+IANDN  GQ+VISG   A+ 
Sbjct: 121 STSMQEACPEGEGSMAACINIPLQKLEEILEEINKINLCQIANDNIEGQIVISGKTTAID 180

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            A     + G K A+ L VSAPFH SLM P  + ++  LD      P++PI+ N+ A P 
Sbjct: 181 HAISIIKDLGYK-AIKLKVSAPFHCSLMKPAEEKIRVALDKAVINKPLIPIIQNYTAKPT 239

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
               EI + L+ Q+ GRVRWRET++ F    +  + E+G+G VLT + ++I+      +I
Sbjct: 240 LDPTEIKQNLMLQICGRVRWRETLELFHKLEIAHIVEIGAGSVLTNMLRKINYPYKLSNI 299

Query: 300 SKVEDIDLALRSI 312
           S +E++   L +I
Sbjct: 300 SNLEELQHCLDNI 312


>gi|83949656|ref|ZP_00958389.1| acyl-carrier-protein S-malonyltransferase [Roseovarius nubinhibens
           ISM]
 gi|83837555|gb|EAP76851.1| acyl-carrier-protein S-malonyltransferase [Roseovarius nubinhibens
           ISM]
          Length = 297

 Score =  265 bits (678), Expect = 5e-69,   Method: Compositional matrix adjust.
 Identities = 135/298 (45%), Positives = 193/298 (64%), Gaps = 1/298 (0%)

Query: 17  MGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPALTAVSMAFIRVM 76
           MG+ L +++P A+ VF+EVD  L + LS L+W G Q++LT T NAQPAL   S+A +R +
Sbjct: 1   MGKALAEAYPAAKAVFDEVDEALGEKLSQLIWEGEQDKLTLTQNAQPALMVTSLAAMRAL 60

Query: 77  EKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQEAVPPGLGSMVA 136
           E  G+ +    ++VAGHSLGEY+AL AA A S++DT RL+R RG +MQEAVP G G+M A
Sbjct: 61  EAEGVSIDA-AAFVAGHSLGEYSALAAAGAMSIADTARLLRTRGVAMQEAVPVGQGAMAA 119

Query: 137 IIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAADTCLNKGAKRAVFL 196
           ++GLD   V  + A+A+   +C+ ANDN  GQVV+SG + AV+ A +    +GAKRA+ L
Sbjct: 120 LLGLDFDTVREVAAEAAEQEVCQAANDNDPGQVVVSGHKAAVERAVELAKGRGAKRAMLL 179

Query: 197 PVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSIDEISRLLVEQVTGR 256
           PVSAPFH  LM P +KVM   LD V    P VP++ N  A        I  LLV QVTG 
Sbjct: 180 PVSAPFHCELMAPAAKVMAEALDDVEIHAPKVPLVANVIARSAEDPATIRSLLVSQVTGS 239

Query: 257 VRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVEDIDLALRSIVG 314
           VRWRE+++     GV   +E+G+GK L+G+ +RI++  +  ++   +++  A  ++ G
Sbjct: 240 VRWRESVEQMVADGVTEFWEIGAGKALSGMIRRINREAATRTVGTPDEVKAAAEALQG 297


>gi|260575005|ref|ZP_05843006.1| malonyl CoA-acyl carrier protein transacylase [Rhodobacter sp. SW2]
 gi|259022627|gb|EEW25922.1| malonyl CoA-acyl carrier protein transacylase [Rhodobacter sp. SW2]
          Length = 310

 Score =  265 bits (678), Expect = 5e-69,   Method: Compositional matrix adjust.
 Identities = 147/309 (47%), Positives = 199/309 (64%), Gaps = 1/309 (0%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           MS    FPGQG+Q IGMG+ L  ++P A+ VF+EVD  L + LS L+W G    LT T N
Sbjct: 1   MSRAFVFPGQGAQTIGMGQALAAAYPAAKAVFDEVDEALGEKLSALIWQGDIAALTLTQN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
           AQPAL A S+A +R ++  G+ V+   ++VAGHSLGEY+ALCAA A  L+DT RL+R RG
Sbjct: 61  AQPALMATSIAALRALQAEGIGVE-TAAFVAGHSLGEYSALCAAGALGLADTARLLRIRG 119

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
            +MQEAVP G+G+M A++GLD      + A+A++  +C+ ANDN  GQVV+SG + AV+ 
Sbjct: 120 AAMQEAVPVGVGAMAALLGLDFAAAVEVAAEAAQGEVCQAANDNDPGQVVVSGHKGAVER 179

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A +    +GAKRA+ LPVSAPFH +LM P + VM   L  V    P VP++ N  A  V+
Sbjct: 180 ALEIAKARGAKRALLLPVSAPFHCALMQPAAAVMAEALAGVVIAAPSVPVVVNVRAEAVT 239

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
             D I  LLV QVTG VRWRE++ W    GV   +E+G+GK L+G+ KR        ++ 
Sbjct: 240 EPDRIRDLLVAQVTGSVRWRESVLWMQGAGVTEFWEIGAGKALSGMIKRTATGAVTRAVG 299

Query: 301 KVEDIDLAL 309
             ED+  A+
Sbjct: 300 TPEDVAAAV 308


>gi|229587090|ref|YP_002845591.1| Malonyl CoA-acyl carrier protein transacylase [Rickettsia africae
           ESF-5]
 gi|228022140|gb|ACP53848.1| Malonyl CoA-acyl carrier protein transacylase [Rickettsia africae
           ESF-5]
          Length = 314

 Score =  265 bits (676), Expect = 8e-69,   Method: Compositional matrix adjust.
 Identities = 134/313 (42%), Positives = 193/313 (61%), Gaps = 2/313 (0%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M T   FPGQG Q+IGMG+D YD+F  A+  F+ VD  LN+ L+D+++NG  EELT T N
Sbjct: 1   MKTAFIFPGQGLQLIGMGKDFYDNFKPAKETFQIVDEVLNRKLTDIIFNGPSEELTLTTN 60

Query: 61  AQPALTAVSMAFIRVME-KNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRAR 119
           AQPAL AVSMA I +++ + G  +     Y AGHSLGEY+ALC+ ++ +L    +L+  R
Sbjct: 61  AQPALMAVSMAIINIIKAETGKSLDSLCDYAAGHSLGEYSALCSTESINLETAAKLLHIR 120

Query: 120 GKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVK 179
             SMQEA P G GSM A I +    ++ I  + +++ +C+IANDN  GQ+VISG   A+ 
Sbjct: 121 STSMQEACPEGEGSMAACINIPFQKLEEILEEINKINLCQIANDNIEGQIVISGKTTAID 180

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            A     + G K A+ L VSAPFH SLM P  + M+  LD      P++PI+ N+ A P 
Sbjct: 181 HAISIIKDLGYK-AIKLKVSAPFHCSLMKPAEEKMRVALDKAVINKPLIPIIQNYTAKPT 239

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
               EI + L+ Q+ GRVRWRET++ F    +  + E+G+G VLT + ++I+      +I
Sbjct: 240 LDPTEIKQNLMLQICGRVRWRETLELFHKLEIAHIVEIGAGSVLTNMLRKINYPYKLSNI 299

Query: 300 SKVEDIDLALRSI 312
           S +E++   L +I
Sbjct: 300 SNLEELQHCLDNI 312


>gi|254454458|ref|ZP_05067895.1| malonyl CoA-acyl carrier protein transacylase [Octadecabacter
           antarcticus 238]
 gi|198268864|gb|EDY93134.1| malonyl CoA-acyl carrier protein transacylase [Octadecabacter
           antarcticus 238]
          Length = 297

 Score =  265 bits (676), Expect = 8e-69,   Method: Compositional matrix adjust.
 Identities = 139/289 (48%), Positives = 201/289 (69%), Gaps = 2/289 (0%)

Query: 17  MGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPALTAVSMAFIRVM 76
           MG+ +  ++P A+ VF+EVD  L + LSDL+W+G   +LT T NAQPAL A S+A +R +
Sbjct: 1   MGQAMAQAYPAAKAVFDEVDDALGEKLSDLIWSGDIADLTLTKNAQPALMATSLAAMRAL 60

Query: 77  EKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQEAVPPGLGSMVA 136
           E  G+ +    S+VAGHSLGEY+AL A+ A S++DT RL+R RG++MQ+AVP G+G+M  
Sbjct: 61  EVEGVTIAA-ASFVAGHSLGEYSALAASGASSIADTARLLRIRGEAMQDAVPVGIGAMAV 119

Query: 137 IIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAADTCLNKGAKRAVFL 196
           ++GLD     ++ A+A++  +C+ ANDN   QVV+SG + AV+ A +     GAKRA+ L
Sbjct: 120 LLGLDFAGAQAVAAEAAQGEVCQAANDNDPSQVVVSGHRSAVERAVEIAKAHGAKRAMLL 179

Query: 197 PVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSIDEISRLLVEQVTGR 256
           PVSAPFHSSLM P + VM   L  VT   P VP++ N  A+ V  +D+I  LLVEQ+TG 
Sbjct: 180 PVSAPFHSSLMGPAADVMAKALADVTMTAPAVPLIANVRAAAV-GVDDIKGLLVEQITGS 238

Query: 257 VRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVEDI 305
           VRWRE++ W A+ GV  V+E+G+GK L+G+ KR+D++++  +I   +DI
Sbjct: 239 VRWRESVMWMADAGVTDVWEIGAGKALSGMVKRVDRNIATRAIGSPDDI 287


>gi|238650392|ref|YP_002916244.1| malonyl-CoA-[acyl-carrier-protein] transacylase [Rickettsia
           peacockii str. Rustic]
 gi|238624490|gb|ACR47196.1| malonyl-CoA-[acyl-carrier-protein] transacylase [Rickettsia
           peacockii str. Rustic]
          Length = 314

 Score =  265 bits (676), Expect = 8e-69,   Method: Compositional matrix adjust.
 Identities = 134/313 (42%), Positives = 193/313 (61%), Gaps = 2/313 (0%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M T   FPGQG Q+IGMG+D YD+F  A+  F+ VD  LN+ L+D+++NG  EELT T N
Sbjct: 1   MKTAFIFPGQGLQLIGMGKDFYDNFKPAKETFQIVDEVLNRKLTDIIFNGPSEELTLTTN 60

Query: 61  AQPALTAVSMAFIRVME-KNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRAR 119
           AQPAL AVSMA I +++ + G  +     Y AGHSLGEY+ALC+ ++ +L    +L+  R
Sbjct: 61  AQPALMAVSMAIINIIKAETGKSLDSLCDYAAGHSLGEYSALCSTESINLETAAKLLHIR 120

Query: 120 GKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVK 179
             SMQEA P G GSM A I +    ++ I  + +++ +C+IANDN  GQ+VISG   A+ 
Sbjct: 121 STSMQEACPEGEGSMAACINIPLQKLEEILEEINKINLCQIANDNIEGQIVISGKTTAID 180

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            A     + G K A+ L VSAPFH SLM P  + M+  LD      P++PI+ N+ A P 
Sbjct: 181 HAISIIKDLGYK-AIKLKVSAPFHCSLMKPAEEKMRVALDKAVINKPLIPIIQNYTAKPT 239

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
               EI + L+ Q+ GRVRWRET++ F    +  + E+G+G VLT + ++I+      +I
Sbjct: 240 LDPTEIKQNLMLQICGRVRWRETLELFHKLEIAHIVEIGAGSVLTNMLRKINYPYKLSNI 299

Query: 300 SKVEDIDLALRSI 312
           S +E++   L +I
Sbjct: 300 SNLEELQHCLDNI 312


>gi|34581273|ref|ZP_00142753.1| malonyl CoA-acyl carrier protein transacylase [Rickettsia sibirica
           246]
 gi|28262658|gb|EAA26162.1| malonyl CoA-acyl carrier protein transacylase [Rickettsia sibirica
           246]
          Length = 314

 Score =  265 bits (676), Expect = 9e-69,   Method: Compositional matrix adjust.
 Identities = 134/313 (42%), Positives = 192/313 (61%), Gaps = 2/313 (0%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M T   FPGQG Q+IGMG+D YD+F  A+  F+ VD  LN+ L+D+++NG  EELT T N
Sbjct: 1   MKTAFIFPGQGLQLIGMGKDFYDNFKPAKETFQIVDEVLNRKLTDIIFNGPSEELTLTTN 60

Query: 61  AQPALTAVSMAFIRVME-KNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRAR 119
           AQPAL AVSMA I +++ + G  +     Y AGHSLGEY+ALC+ ++ +L    +L+  R
Sbjct: 61  AQPALMAVSMAIINIIKAETGKSLDSLCDYAAGHSLGEYSALCSTESINLETAAKLLHIR 120

Query: 120 GKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVK 179
             SMQEA P G GSM A I +    ++ I  + +++ +C+IANDN  GQ+VISG   A+ 
Sbjct: 121 STSMQEACPEGEGSMAACINIPLQKLEEILEEINKINLCQIANDNIEGQIVISGKTTAID 180

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            A     + G K A+ L VSAPFH SLM P  + M+  LD      P++PI+ N+ A P 
Sbjct: 181 HAISIIKDLGYK-AIKLKVSAPFHCSLMKPAEEKMRVALDKAVINKPLIPIIQNYTAKPT 239

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
               EI   L+ Q+ GRVRWRET++ F    +  + E+G+G VLT + ++I+      +I
Sbjct: 240 LDPTEIKHNLMLQICGRVRWRETLELFHKLEIAHIVEIGAGSVLTNMLRKINYPYKLSNI 299

Query: 300 SKVEDIDLALRSI 312
           S +E++   L +I
Sbjct: 300 SNLEELQHCLDNI 312


>gi|315499773|ref|YP_004088576.1| malonyl CoA-acyl carrier protein transacylase [Asticcacaulis
           excentricus CB 48]
 gi|315417785|gb|ADU14425.1| malonyl CoA-acyl carrier protein transacylase [Asticcacaulis
           excentricus CB 48]
          Length = 314

 Score =  264 bits (675), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 142/315 (45%), Positives = 197/315 (62%), Gaps = 4/315 (1%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M+    FPGQGSQ +GMG +L+D+F  AR VF EV+  L  +L  LM  G + +LT T N
Sbjct: 1   MTLAFVFPGQGSQSVGMGSELFDNFAAAREVFGEVNEVLGLDLLRLMREGPEADLTLTEN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
           AQPAL AVS+A +RV++ +      + ++ AGHSLGEY+AL A +  +L+D  RL++ RG
Sbjct: 61  AQPALMAVSLAVVRVLKADFGVDVSEAAFCAGHSLGEYSALAAMEVLTLADAARLLKLRG 120

Query: 121 KSMQEAVPPGLGSMVAIIG--LDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAV 178
           ++MQ AVP G G+M A+IG   D  + +  C      G+  +ANDN  GQVVISG + AV
Sbjct: 121 QAMQRAVPVGQGAMAALIGAKADLALAEVACEAGRAAGVVVVANDNNAGQVVISGEKAAV 180

Query: 179 KCAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASP 238
             A +     GAK A+ L VSAPFHS LM P ++ M   L  +  +DP   ++ N  A P
Sbjct: 181 DLAVEKAKELGAK-AMLLNVSAPFHSPLMQPAAEEMAEALSKINFRDPQSVLVANVTAQP 239

Query: 239 VSSIDEISRLLVEQVTGRVRWRETIQWFA-NHGVKSVYEVGSGKVLTGLAKRIDKSLSAV 297
           V    +++ LLVEQVTGRVRWRE++QW A + GV    E+G+GKVLTG+ KR+     AV
Sbjct: 240 VGDKAQVAPLLVEQVTGRVRWRESVQWLAQDGGVTQFAELGAGKVLTGMIKRLAPGCEAV 299

Query: 298 SISKVEDIDLALRSI 312
           +++   D +   +SI
Sbjct: 300 ALNGALDFEAFAKSI 314


>gi|88607175|ref|YP_504720.1| malonyl CoA-acyl carrier protein transacylase [Anaplasma
           phagocytophilum HZ]
 gi|88598238|gb|ABD43708.1| malonyl CoA-acyl carrier protein transacylase [Anaplasma
           phagocytophilum HZ]
          Length = 319

 Score =  264 bits (675), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 136/306 (44%), Positives = 195/306 (63%), Gaps = 5/306 (1%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           MSTV  FPGQGSQ +GMG+++Y++F  AR VF EVD TL +NLSD+++NG +E LT+TCN
Sbjct: 1   MSTVFMFPGQGSQFVGMGKEVYENFAVAREVFHEVDETLGRNLSDIIFNGPEEVLTSTCN 60

Query: 61  AQPALTAVSMAFIRVMEKN-GLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRAR 119
           AQ AL  VS+A +R +E   G+ + R   YV GHS+GEYTALCAA    L   +R++  R
Sbjct: 61  AQLALMTVSIAVVRAVEHVVGMPLDRYARYVIGHSVGEYTALCAAGVIDLPTAVRILDVR 120

Query: 120 GKSMQEAVPPGLGSMVAIIGLDDCV--VDSICAQASRVGICEIANDNGGGQVVISGLQDA 177
            ++M +A     G M A+IG   CV  V+++   AS+ G+CEIANDN  GQ+V+SG  +A
Sbjct: 121 SRAMGKASEMCQGGMSALIG--GCVEDVEAVVQAASKFGVCEIANDNCNGQIVVSGTNEA 178

Query: 178 VKCAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCAS 237
           ++   +  +    +R + L VS PFHSSLM P  + ++  + ++  + P + I+ N  AS
Sbjct: 179 LEALPELVVGTAVRRVIRLRVSGPFHSSLMHPAYEELRDFVSTLELKAPKIGIVYNVSAS 238

Query: 238 PVSSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAV 297
                D I  L+  QV  RVRWRE+I++   HG     E G G+VLTGL +RID+++  V
Sbjct: 239 EHEDCDVIKDLMARQVVSRVRWRESIEYLLGHGCSEFVEAGPGEVLTGLLRRIDRTVRCV 298

Query: 298 SISKVE 303
           S+  V+
Sbjct: 299 SVCAVD 304


>gi|149184747|ref|ZP_01863065.1| malonyl CoA-acyl carrier protein transacylase [Erythrobacter sp.
           SD-21]
 gi|148832067|gb|EDL50500.1| malonyl CoA-acyl carrier protein transacylase [Erythrobacter sp.
           SD-21]
          Length = 312

 Score =  264 bits (675), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 146/305 (47%), Positives = 194/305 (63%), Gaps = 2/305 (0%)

Query: 3   TVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQ 62
           T   FPGQGSQ +GMG +L ++   AR VFEEVD  LNQ LS LM +G + ELT T NAQ
Sbjct: 2   TAFIFPGQGSQKVGMGVELAEASAHAREVFEEVDDALNQKLSALMKDGPESELTLTSNAQ 61

Query: 63  PALTAVSMAFIRVMEKN-GLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           PA+ A S+A +RV+EK  G+ +    + VAGHSLGEY+ALCAA AF LS+T +L+R RG 
Sbjct: 62  PAIMANSIATLRVLEKEFGVVLADKATCVAGHSLGEYSALCAAGAFGLSETAKLLRLRGI 121

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCA 181
           +MQ+AVP G+G+M A++G D     ++   A+   +CE+ANDN   QVVISG  +A+  A
Sbjct: 122 AMQDAVPIGVGAMAALLGADIEKATALAEAAAEGQVCEVANDNDPTQVVISGHAEAIDRA 181

Query: 182 ADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSS 241
            +     G KR + LPVSAPFH SLM P ++ MK  L         VP+  N  A+ V+ 
Sbjct: 182 IEMAKEHGIKRGIKLPVSAPFHCSLMEPAAQRMKIALADTAPGSFTVPLFANVTAARVTD 241

Query: 242 IDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISK 301
             E   LLV+QVTGRVRWRE++      GV+   E+G GKVL  +  RI K  + VS+  
Sbjct: 242 PAEEQALLVDQVTGRVRWRESVLAMQEAGVERFVELG-GKVLGPMVGRIAKEATTVSLVT 300

Query: 302 VEDID 306
           +ED++
Sbjct: 301 MEDLE 305


>gi|330994304|ref|ZP_08318232.1| Malonyl CoA-acyl carrier protein transacylase [Gluconacetobacter
           sp. SXCC-1]
 gi|329758771|gb|EGG75287.1| Malonyl CoA-acyl carrier protein transacylase [Gluconacetobacter
           sp. SXCC-1]
          Length = 328

 Score =  264 bits (674), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 154/317 (48%), Positives = 201/317 (63%), Gaps = 12/317 (3%)

Query: 5   LTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPA 64
             FPGQGSQ +GMGRDL ++F  AR VF+EVD  L Q+LS LM+ G  EELT T NAQPA
Sbjct: 9   FVFPGQGSQSVGMGRDLAEAFAPAREVFQEVDDALEQHLSTLMFEGPMEELTRTDNAQPA 68

Query: 65  LTAVSMAFIRVMEKNG-LCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSM 123
           L AVS+A +RV+E+ G L +KRD++ VAGHSLGEY+AL AA A  ++ T RL+R RG +M
Sbjct: 69  LMAVSLAVLRVLEREGGLDLKRDVALVAGHSLGEYSALAAAGALGIARTARLLRLRGNAM 128

Query: 124 QEAVPPGLGSMVAIIG--LDDCVVDSICAQA---------SRVGICEIANDNGGGQVVIS 172
           Q AVPPG G M A+IG  +D     S+CA+A         +   + E+ANDNGGGQVV++
Sbjct: 129 QAAVPPGQGGMAALIGADMDMDRAASLCAEAATFTDEAGKTHTEVLEVANDNGGGQVVVA 188

Query: 173 GLQDAVKCAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILP 232
           G   A+         +G KRA+ LPVSAPFH S+M P +  M+  L       P VP++ 
Sbjct: 189 GQMAAIDRVIALARAQGVKRALKLPVSAPFHCSMMAPAADAMRAALADTDIAAPAVPLVA 248

Query: 233 NFCASPVSSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDK 292
           N  A+ V+    I  LLV QVTG VRWRE++      G+ S  E+GSGKVL GL +RI+ 
Sbjct: 249 NVTAAKVTDPATIRDLLVRQVTGTVRWRESVDAMVGMGIDSFVEIGSGKVLAGLVRRING 308

Query: 293 SLSAVSISKVEDIDLAL 309
            ++  S+    DI+  L
Sbjct: 309 DVATRSVGTPADIEAYL 325


>gi|83954300|ref|ZP_00963020.1| acyl-carrier-protein S-malonyltransferase [Sulfitobacter sp.
           NAS-14.1]
 gi|83841337|gb|EAP80507.1| acyl-carrier-protein S-malonyltransferase [Sulfitobacter sp.
           NAS-14.1]
          Length = 310

 Score =  264 bits (674), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 145/299 (48%), Positives = 204/299 (68%), Gaps = 1/299 (0%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M+    +PGQG+Q IGMGRDL D++P A+ VF+EVD  L + LS L+W G  EELT T N
Sbjct: 1   MTIAFVYPGQGAQTIGMGRDLADAYPAAKAVFDEVDEALGEKLSQLIWEGDAEELTLTQN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
           AQPAL A SMA +  ++  G+ V +  +YVAGHSLGEY ALCAA  FSL+DT RL+R RG
Sbjct: 61  AQPALMATSMAAMAALKAEGVTVDK-AAYVAGHSLGEYAALCAAGTFSLADTARLLRIRG 119

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           ++MQ AVP G G+M A++GL     +++ A+A++  +C++AN N   Q V+SG + AV+ 
Sbjct: 120 RAMQAAVPVGQGAMAALLGLSFEQAEAVAAEAAQGEVCQVANQNDPAQNVVSGSKAAVER 179

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A D     GAKRA+ LPVSAPFH +LM P ++ M   L  V    P VP++ N  A  V+
Sbjct: 180 AIDLAKAAGAKRALLLPVSAPFHCALMAPAAEEMAGALADVAMNAPAVPVVANVVAEAVT 239

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
             ++I +LL+EQVTG+VRW  +++W    GV  V+E+G+GK L+G+ +RI+K ++ V+I
Sbjct: 240 DPEQIRKLLIEQVTGQVRWMSSVEWMGAQGVTEVWEIGAGKALSGMIRRINKEITCVNI 298


>gi|194014475|ref|ZP_03053092.1| malonyl CoA-acyl carrier protein transacylase [Bacillus pumilus
           ATCC 7061]
 gi|194013501|gb|EDW23066.1| malonyl CoA-acyl carrier protein transacylase [Bacillus pumilus
           ATCC 7061]
          Length = 314

 Score =  263 bits (673), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 136/307 (44%), Positives = 194/307 (63%), Gaps = 5/307 (1%)

Query: 7   FPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPALT 66
           FPGQGSQ IGMG+DL+D    ++ VFEE D TL  +LS +++ G  EELT T NAQPAL 
Sbjct: 8   FPGQGSQKIGMGKDLFDQEEVSKAVFEEADKTLGFDLSSMIFEGDAEELTLTYNAQPALL 67

Query: 67  AVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQEA 126
             S+A ++  E++G  +K D  Y AGHSLGEYTAL AA A S  D +  VR RG+ M EA
Sbjct: 68  TTSIAILKKFEESG--IKAD--YAAGHSLGEYTALVAAGALSFQDAVYAVRKRGELMNEA 123

Query: 127 VPPGLGSMVAIIGLDDCVVDSICAQASRVG-ICEIANDNGGGQVVISGLQDAVKCAADTC 185
           VP G G+M AI+GLD   +  +  + +  G + E+AN N  GQ+VISG    V+ A++  
Sbjct: 124 VPAGEGAMAAILGLDQAALLEVTKEVTESGHLVELANLNCPGQIVISGTAKGVELASEKA 183

Query: 186 LNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSIDEI 245
             KGAKRA+ L VS PFHS+LM P ++    +L  +   D   P++ N  A  V+S D I
Sbjct: 184 KEKGAKRAIALEVSGPFHSALMKPAAEKFTDVLSKLNITDAKTPVISNVTADIVTSRDAI 243

Query: 246 SRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVEDI 305
              L+EQ+   VR+ E+++   + GV +  E+G GKVL+GL K++++ L+ +S+S  E I
Sbjct: 244 ETKLIEQLYSPVRFEESVERLIDLGVTTFIEIGPGKVLSGLVKKVNRRLTTISVSDQETI 303

Query: 306 DLALRSI 312
           + A+ ++
Sbjct: 304 EAAIETL 310


>gi|167630232|ref|YP_001680731.1| malonyl CoA-acyl carrier protein transacylase [Heliobacterium
           modesticaldum Ice1]
 gi|167592972|gb|ABZ84720.1| malonyl CoA-acyl carrier protein transacylase [Heliobacterium
           modesticaldum Ice1]
          Length = 303

 Score =  263 bits (673), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 143/303 (47%), Positives = 193/303 (63%), Gaps = 6/303 (1%)

Query: 3   TVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQ 62
           T+  FPGQGSQ +GMG DL   + EA  VF E D TL  +LS L + G +EEL  T N Q
Sbjct: 4   TLFMFPGQGSQFVGMGADLVRHYSEACQVFAEADDTLGFSLSRLCFEGPEEELRLTANTQ 63

Query: 63  PALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKS 122
           PAL AVS+A+ RV+   G   K D  +VAGHSLGEY+AL AA + +L+D +RLVR RG  
Sbjct: 64  PALLAVSIAYFRVLAAKGW--KAD--WVAGHSLGEYSALVAAGSLTLADGLRLVRQRGLF 119

Query: 123 MQEAVPPGLGSMVAIIGLDDCVVDSICAQASRV--GICEIANDNGGGQVVISGLQDAVKC 180
           MQEAVP G G+M AI+GL+   V+ +C QA+    G+ E AN NG GQVVI+G + AV+ 
Sbjct: 120 MQEAVPAGQGTMAAIMGLEAEAVEEVCRQAATALGGVVEPANFNGAGQVVIAGERLAVEK 179

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A +     GAKRA+ L VSAPFH SLM P ++ M  +L +    DPV+P++ N  A+PV 
Sbjct: 180 AMELAKVAGAKRALLLNVSAPFHCSLMRPAAERMAGLLRTAAIADPVIPLVANVTAAPVC 239

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
             + +   L+ QV   VRW ++I++ A+ GV    EVG GKVL+GL ++I K    ++  
Sbjct: 240 DAERVRENLILQVDHPVRWEQSIRFLADQGVTRFVEVGPGKVLSGLVRKIAKGAEVLAAG 299

Query: 301 KVE 303
            ++
Sbjct: 300 DIQ 302


>gi|157828962|ref|YP_001495204.1| acyl-carrier-protein S-malonyltransferase [Rickettsia rickettsii
           str. 'Sheila Smith']
 gi|165933687|ref|YP_001650476.1| malonyl-CoA-[acyl-carrier-protein] transacylase [Rickettsia
           rickettsii str. Iowa]
 gi|157801443|gb|ABV76696.1| acyl-carrier-protein S-malonyltransferase [Rickettsia rickettsii
           str. 'Sheila Smith']
 gi|165908774|gb|ABY73070.1| malonyl-CoA-[acyl-carrier-protein] transacylase [Rickettsia
           rickettsii str. Iowa]
          Length = 314

 Score =  263 bits (673), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 134/313 (42%), Positives = 192/313 (61%), Gaps = 2/313 (0%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M T   FPGQG Q+IGMG+D YD+F  A+  F+ VD  LN+ L+D+++NG  EELT T N
Sbjct: 1   MKTAFIFPGQGLQLIGMGKDFYDNFKPAKETFQIVDEVLNRKLTDIIFNGPSEELTLTTN 60

Query: 61  AQPALTAVSMAFIRVME-KNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRAR 119
           AQPAL AVSMA I +++ + G  +     Y AGHSLGEY+ALC+ ++ +L    +L+  R
Sbjct: 61  AQPALMAVSMAIINIIKAETGKSLDSLCDYAAGHSLGEYSALCSTESINLETAAKLLHIR 120

Query: 120 GKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVK 179
             SMQEA P G GSM A I +    ++ I  + +++ +C+IANDN  GQ+VISG   A+ 
Sbjct: 121 STSMQEACPEGEGSMAACINIPLQKLEEILEEINKINLCQIANDNIEGQIVISGKTTAID 180

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            A     + G K A+ L VSAPFH SLM P  + M+  LD      P++PI+ N+ A P 
Sbjct: 181 HAISIIKDLGYK-AIKLKVSAPFHCSLMKPAEEKMRVALDKAVINKPLIPIIQNYTAKPT 239

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
               EI + L+ Q+ GRVRWRET++ F    +  + E+G G VLT + ++I+      +I
Sbjct: 240 LDPTEIKQNLMLQICGRVRWRETLELFHKLEIAHIVEIGVGSVLTNMLRKINYPYKLSNI 299

Query: 300 SKVEDIDLALRSI 312
           S +E++   L +I
Sbjct: 300 SNLEELQHCLDNI 312


>gi|83943166|ref|ZP_00955626.1| acyl-carrier-protein S-malonyltransferase [Sulfitobacter sp. EE-36]
 gi|83846174|gb|EAP84051.1| acyl-carrier-protein S-malonyltransferase [Sulfitobacter sp. EE-36]
          Length = 310

 Score =  263 bits (672), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 145/299 (48%), Positives = 205/299 (68%), Gaps = 1/299 (0%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M+    +PGQG+Q IGMGRDL D++P A+ VF+EVD  L + LS L+W G  EELT T N
Sbjct: 1   MTIAFVYPGQGAQTIGMGRDLADAYPAAKAVFDEVDEALGEKLSTLIWEGDAEELTLTQN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
           AQPAL A SMA +  ++  G+ V +  ++VAGHSLGEY ALCAA  FSL+DT RL+R RG
Sbjct: 61  AQPALMATSMAAMAALKAEGVTVDK-AAFVAGHSLGEYAALCAAGTFSLADTARLLRIRG 119

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           ++MQ AVP G G+M A++GL     +++ A+A++  +C++AN N   Q V+SG + AV+ 
Sbjct: 120 RAMQAAVPVGQGAMAALLGLSFEQAEAVAAEAAQGEVCQVANQNDPAQNVVSGSKAAVER 179

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A D     GAKRA+ LPVSAPFH +LM P ++ M   L  VT   P VP++ N  A  V+
Sbjct: 180 AIDLAKAAGAKRALLLPVSAPFHCALMAPAAEEMAGALADVTMNAPAVPVVANVVAEAVT 239

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
             ++I +LL+EQVTG+VRW  +++W    GV  V+E+G+GK L+G+ +RI+K ++ V+I
Sbjct: 240 DPEQIRKLLIEQVTGQVRWMSSVEWMGVQGVTEVWEIGAGKALSGMIRRINKEITCVNI 298


>gi|52080193|ref|YP_078984.1| malonyl CoA-acyl carrier protein transacylase [Bacillus
           licheniformis ATCC 14580]
 gi|52785570|ref|YP_091399.1| acyl-carrier-protein S-malonyltransferase [Bacillus licheniformis
           ATCC 14580]
 gi|319646028|ref|ZP_08000258.1| FabD protein [Bacillus sp. BT1B_CT2]
 gi|52003404|gb|AAU23346.1| malonyl CoA-acyl carrier protein transacylase [Bacillus
           licheniformis ATCC 14580]
 gi|52348072|gb|AAU40706.1| FabD [Bacillus licheniformis ATCC 14580]
 gi|317391778|gb|EFV72575.1| FabD protein [Bacillus sp. BT1B_CT2]
          Length = 319

 Score =  262 bits (669), Expect = 5e-68,   Method: Compositional matrix adjust.
 Identities = 134/307 (43%), Positives = 194/307 (63%), Gaps = 5/307 (1%)

Query: 7   FPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPALT 66
           FPGQGSQ IGMG +LY+  P A+ +FEE D TL   LS LM+ G  +ELT T NAQP+L 
Sbjct: 8   FPGQGSQHIGMGHELYEKEPNAKKIFEEADQTLETKLSTLMFEGDAKELTLTYNAQPSLL 67

Query: 67  AVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQEA 126
             S+A +  +++ G  +K D  Y AGHSLGEY+AL AA A S  D +  VR RG+ M EA
Sbjct: 68  TASIAALEKLKEYG--IKAD--YAAGHSLGEYSALVAAGALSFKDAVYAVRKRGEFMNEA 123

Query: 127 VPPGLGSMVAIIGLDDCVVDSICAQASRVG-ICEIANDNGGGQVVISGLQDAVKCAADTC 185
           VP G G+M AI+G+D   +  +  + S  G + ++AN N  GQ+VISG    V+ A++  
Sbjct: 124 VPAGEGAMAAILGMDSQALKEVTDKISEEGNLVQLANLNCPGQIVISGTAKGVELASELA 183

Query: 186 LNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSIDEI 245
             KGAKRA+ L VS PFHS LM P +  ++ +LD+ T  D  +P++ N  A  V+  D+I
Sbjct: 184 KEKGAKRAIPLEVSGPFHSELMKPAADKLREVLDACTINDAAIPVVSNVTADFVTDKDDI 243

Query: 246 SRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVEDI 305
              L+EQ+   VR+ ETI    + GV +  E+G GKVL+GL K++++ +  +++S    I
Sbjct: 244 KNKLIEQLYSPVRFEETISRLIDEGVTTFIEIGPGKVLSGLVKKVNRRVKTIAVSDPNTI 303

Query: 306 DLALRSI 312
           +LA++++
Sbjct: 304 ELAVQTL 310


>gi|296115270|ref|ZP_06833910.1| malonyl CoA-acyl carrier protein transacylase [Gluconacetobacter
           hansenii ATCC 23769]
 gi|295978173|gb|EFG84911.1| malonyl CoA-acyl carrier protein transacylase [Gluconacetobacter
           hansenii ATCC 23769]
          Length = 306

 Score =  262 bits (669), Expect = 5e-68,   Method: Compositional matrix adjust.
 Identities = 142/303 (46%), Positives = 197/303 (65%), Gaps = 16/303 (5%)

Query: 17  MGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPALTAVSMAFIRVM 76
           MGRDL D+F  AR VF+EVD  L Q+LS LM+ G  EELT T N QPAL AVS+A +RV+
Sbjct: 1   MGRDLADAFAPAREVFQEVDDALGQHLSKLMFEGPIEELTRTENTQPALMAVSLAVLRVL 60

Query: 77  EKNG-LCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQEAVPPGLGSMV 135
           E+ G + ++  ++ VAGHSLGEY+AL A  AF L+   RL+R RG++MQ+AVP G G M 
Sbjct: 61  EREGGVDLRTQVALVAGHSLGEYSALAAVGAFGLTQAARLLRVRGQAMQKAVPVGRGGMA 120

Query: 136 AIIGLDDCVVDSICAQAS---------RVGICEIANDNGGGQVVISGLQDAVKCAADTCL 186
           A+IG+D     +IC +A+         R  + EIANDNGGGQVV++G   A++ A     
Sbjct: 121 ALIGVDLEQARAICEEAAVVKEEGRPDRHEVIEIANDNGGGQVVVAGESAAIERAIAIAK 180

Query: 187 NKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQD---PVVPILPNFCASPVSSID 243
            +  KRA+ LPVSAPFH SLM P ++ M    D++ ++D   PV+P++ N  A+ V+   
Sbjct: 181 ARKVKRALALPVSAPFHCSLMEPAAEAMH---DALAREDIRPPVIPVVANVTAAKVTDPA 237

Query: 244 EISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVE 303
            I  LLV QVTG VRWRE+++     GV S  E+G+GKVL+GL +RI+  ++  S+    
Sbjct: 238 TIRDLLVRQVTGTVRWRESVEAMVAMGVDSFVEIGAGKVLSGLVRRINGDVATCSVGTPA 297

Query: 304 DID 306
           D++
Sbjct: 298 DVE 300


>gi|260752355|ref|YP_003225248.1| malonyl CoA-acyl carrier protein transacylase [Zymomonas mobilis
           subsp. mobilis NCIMB 11163]
 gi|258551718|gb|ACV74664.1| malonyl CoA-acyl carrier protein transacylase [Zymomonas mobilis
           subsp. mobilis NCIMB 11163]
          Length = 311

 Score =  261 bits (668), Expect = 7e-68,   Method: Compositional matrix adjust.
 Identities = 155/303 (51%), Positives = 189/303 (62%), Gaps = 2/303 (0%)

Query: 5   LTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPA 64
             FPGQGSQ +GMG+ L D+   AR VFEEVD  L QNL  LM  G +EEL  T NAQPA
Sbjct: 4   FIFPGQGSQSVGMGQALADASLAARHVFEEVDEALKQNLFRLMSQGPEEELRLTENAQPA 63

Query: 65  LTAVSMAFIRVMEKNGLCVKRDI-SYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSM 123
           + A SMA + ++EK G     D  S+VAGHSLGEY+AL AA AF L  T RL++ RG++M
Sbjct: 64  IMAHSMAVLAMLEKEGNIRLTDAASFVAGHSLGEYSALAAADAFDLPTTARLLKKRGQAM 123

Query: 124 QEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAAD 183
           Q AVP G G M AI+GLD   V+SI  +A+   IC+ ANDN  GQVVISG   A++ A  
Sbjct: 124 QAAVPVGEGGMAAILGLDFETVESIAQEAAENDICQAANDNAPGQVVISGSLAAIERAVA 183

Query: 184 TCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSID 243
               KGA+RAV L VSAPFH SLM P + VM   L     + P+VP+  N  A+  +   
Sbjct: 184 LAKEKGARRAVMLDVSAPFHCSLMQPAADVMAKALQENRPRQPIVPVFANVSATAETDPT 243

Query: 244 EISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVE 303
           +I  LLVEQVTGRVRWRE+I   A  GV+   E G GKVL  + KRI     A S+    
Sbjct: 244 KIMNLLVEQVTGRVRWRESIAAMAAAGVEEFVEFG-GKVLAPMIKRIAPHCKATSLIAPA 302

Query: 304 DID 306
           DI+
Sbjct: 303 DIE 305


>gi|157692270|ref|YP_001486732.1| [Acyl-carrier-protein] S-malonyltransferase [Bacillus pumilus
           SAFR-032]
 gi|157681028|gb|ABV62172.1| [Acyl-carrier-protein] S-malonyltransferase [Bacillus pumilus
           SAFR-032]
          Length = 314

 Score =  261 bits (668), Expect = 8e-68,   Method: Compositional matrix adjust.
 Identities = 136/309 (44%), Positives = 194/309 (62%), Gaps = 5/309 (1%)

Query: 7   FPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPALT 66
           FPGQGSQ IGMG+DL+D    ++ VFEE D TL  +LS +++ G  EELT T NAQPAL 
Sbjct: 8   FPGQGSQKIGMGKDLFDQEAVSKAVFEEADKTLGFDLSSMIFEGEAEELTLTYNAQPALL 67

Query: 67  AVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQEA 126
             S+A ++  E++G  +K D  Y AGHSLGEYTAL AA A S  D +  V  RG+ M EA
Sbjct: 68  TTSIAILKKFEESG--IKAD--YAAGHSLGEYTALVAAGALSFQDAVYAVSKRGELMNEA 123

Query: 127 VPPGLGSMVAIIGLDDCVVDSICAQASRVG-ICEIANDNGGGQVVISGLQDAVKCAADTC 185
           VP G G+M AI+GLD   +  +  + +  G + E+AN N  GQ+VISG    V+ A++  
Sbjct: 124 VPAGEGAMAAILGLDQTALLEVTKEVTESGHLVELANLNCPGQIVISGTAKGVELASEKA 183

Query: 186 LNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSIDEI 245
             KGAKRA+ L VS PFHS+LM P ++    +L  +   D   P++ N  A  V+S D I
Sbjct: 184 KEKGAKRAIALEVSGPFHSALMKPAAEKFTDVLSKLDISDAKTPVISNVTADIVTSRDAI 243

Query: 246 SRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVEDI 305
              L+EQ+   VR+ E+++   + GV +  E+G GKVL+GL K++++ L+ +S+S  E I
Sbjct: 244 ETKLIEQLYSPVRFEESVERLIDLGVTTFIEIGPGKVLSGLVKKVNRRLTTISVSDQETI 303

Query: 306 DLALRSIVG 314
           + A+ ++ G
Sbjct: 304 EAAIETLKG 312


>gi|251797480|ref|YP_003012211.1| malonyl CoA-acyl carrier protein transacylase [Paenibacillus sp.
           JDR-2]
 gi|247545106|gb|ACT02125.1| malonyl CoA-acyl carrier protein transacylase [Paenibacillus sp.
           JDR-2]
          Length = 307

 Score =  261 bits (667), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 131/306 (42%), Positives = 192/306 (62%), Gaps = 6/306 (1%)

Query: 3   TVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQ 62
           T   FPGQG+Q +GMG+D Y++F  +R VFE+ D  L   LSD+++NG  + L  T N Q
Sbjct: 4   TAFVFPGQGAQAVGMGKDAYEAFESSRAVFEQADQALGFKLSDIIFNGPDDVLKQTANTQ 63

Query: 63  PALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKS 122
           PAL  VS+A ++ +E  GL  K D  YVAGHSLGEY+AL AA      D +R VRARG+ 
Sbjct: 64  PALLTVSIALLKALEGRGL--KAD--YVAGHSLGEYSALVAAGVLGFEDAVRTVRARGEF 119

Query: 123 MQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVG-ICEIANDNGGGQVVISGLQDAVKCA 181
           M++AVP G G+M A++G +  V+  +C++ +  G   E+AN N  GQ+V+SG    V+  
Sbjct: 120 MEQAVPSGQGAMAAVLGAERGVLAELCSKITEEGNTVELANVNCPGQIVVSGSAAGVQAV 179

Query: 182 ADTCLNK-GAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
            +    + GAKR + L VS PFHSSLM P ++ +  +L  V+  D  +P++ N  A+PV+
Sbjct: 180 VERGKEEAGAKRVIPLEVSGPFHSSLMKPAAEKLSGVLSEVSMNDAAIPVVANVTAAPVT 239

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
               I  LLVEQV   V W ++I++ A  GV +  E+GSG VL GL K++DK+L  +S++
Sbjct: 240 EAASIRNLLVEQVYSPVLWEDSIRYLAEQGVDTFVEIGSGTVLAGLIKKVDKNLRVISVN 299

Query: 301 KVEDID 306
            +  ++
Sbjct: 300 NIAALE 305


>gi|149913877|ref|ZP_01902409.1| acyl-carrier-protein S-malonyltransferase [Roseobacter sp. AzwK-3b]
 gi|149812161|gb|EDM71992.1| acyl-carrier-protein S-malonyltransferase [Roseobacter sp. AzwK-3b]
          Length = 297

 Score =  260 bits (665), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 142/298 (47%), Positives = 199/298 (66%), Gaps = 1/298 (0%)

Query: 17  MGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPALTAVSMAFIRVM 76
           MG+ L +++P AR VF+EVD  L + LS L+W G+Q++LT T NAQPAL A S+A +R +
Sbjct: 1   MGKALAETYPAARAVFDEVDEALGEKLSALVWEGAQDDLTLTQNAQPALMATSLAAMRAL 60

Query: 77  EKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQEAVPPGLGSMVA 136
           E  G+ +    + VAGHSLGEY+AL AA A S++D  RL+R RG++MQ+AVP G+G+M A
Sbjct: 61  EAEGITIDA-AAMVAGHSLGEYSALAAAGALSVADCARLLRIRGEAMQKAVPVGVGAMAA 119

Query: 137 IIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAADTCLNKGAKRAVFL 196
           I+GLD   V ++ A A+   +CE ANDN  GQVV+SG   AV+ A     ++GAKRA+ L
Sbjct: 120 ILGLDLEAVRALAADAAEGEVCEAANDNDPGQVVVSGQCGAVERAVAMAKDRGAKRAMLL 179

Query: 197 PVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSIDEISRLLVEQVTGR 256
           PVSAPFH +LM P +  M   L +V    P VP++ N  A  VS  D I  LLVEQVTG 
Sbjct: 180 PVSAPFHCALMQPAADAMAEALSAVAISAPRVPLVANVVAEQVSDPDRIRALLVEQVTGA 239

Query: 257 VRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVEDIDLALRSIVG 314
           VRWRE++ + A  GV   +E+G+GK L+G+ +RID+ +   ++   ED+  A+ ++ G
Sbjct: 240 VRWRESVLYMATQGVTETWEIGAGKALSGMVRRIDRDIETRAVGTPEDVAAAVAAMNG 297


>gi|332185172|ref|ZP_08386921.1| malonyl CoA-acyl carrier protein transacylase [Sphingomonas sp.
           S17]
 gi|332014896|gb|EGI56952.1| malonyl CoA-acyl carrier protein transacylase [Sphingomonas sp.
           S17]
          Length = 319

 Score =  259 bits (662), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 150/311 (48%), Positives = 192/311 (61%), Gaps = 14/311 (4%)

Query: 7   FPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPALT 66
           FPGQGSQ +GMG+ L ++ P AR VF+EVD  L Q+L  LM  G  +ELT T NAQPA+ 
Sbjct: 6   FPGQGSQAVGMGKALAEASPVAREVFQEVDEALGQHLYRLMVEGPADELTLTENAQPAIM 65

Query: 67  AVSMAFIRVMEKNG---LCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSM 123
           A ++A +RV+EK G   L  K D  +VAGHSLGEYTALCAA A  L+ T RL++ RG++M
Sbjct: 66  ANAIATLRVLEKEGGVRLSEKAD--FVAGHSLGEYTALCAADALDLATTARLLKLRGRAM 123

Query: 124 QEAVPPGLGSMVAIIGLD--------DCVVDSICAQASRVGICEIANDNGGGQVVISGLQ 175
           Q AVP G G+M A++G D           VDSI A+     +C +ANDN   QVVISG +
Sbjct: 124 QAAVPVGEGAMAALLGADLEKAKTIAGAAVDSILAEGGEELVCTVANDNDPSQVVISGHR 183

Query: 176 DAVKCAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFC 235
            A++ A     + GAKRAV LPVSAPFH  LM P +  M   L   T + P+VP+  N  
Sbjct: 184 AAIEKAVTLAKDLGAKRAVLLPVSAPFHCPLMQPAADAMDAALAEATIRAPLVPVYANVE 243

Query: 236 ASPVSSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLS 295
           A+ V+    I  LLV QVTG VRWRE++    + GV    E G GKVL  + KRI     
Sbjct: 244 AAAVADPGAIRALLVAQVTGMVRWRESVLAMQDAGVAQFVEFG-GKVLGPMVKRIAPDAD 302

Query: 296 AVSISKVEDID 306
           AVS+  ++DI+
Sbjct: 303 AVSVVTMDDIE 313


>gi|213019596|ref|ZP_03335402.1| malonyl CoA-acyl carrier protein transacylase [Wolbachia
           endosymbiont of Culex quinquefasciatus JHB]
 gi|212995018|gb|EEB55660.1| malonyl CoA-acyl carrier protein transacylase [Wolbachia
           endosymbiont of Culex quinquefasciatus JHB]
          Length = 328

 Score =  259 bits (662), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 136/303 (44%), Positives = 182/303 (60%), Gaps = 2/303 (0%)

Query: 4   VLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQP 63
           +  FPGQGSQ +GMG+ LYD F  AR VF+EVD  L + LS L++NG  E+LT T NAQP
Sbjct: 9   IFAFPGQGSQFVGMGKSLYDEFSVARNVFDEVDDILGRKLSHLIFNGPIEKLTITENAQP 68

Query: 64  ALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSM 123
           A+ AVS+A +RVM+         + YV GHS+GEYTALCAA A +L   ++L++ R ++M
Sbjct: 69  AIMAVSIATLRVMKHVFGESLYSVQYVCGHSVGEYTALCAAGALTLESAVKLLKVRSEAM 128

Query: 124 QEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAAD 183
            EA     G M A++G +   V+ I   A     CEIANDNGGGQVV+SG  +A++   D
Sbjct: 129 HEASLKCKGGMFALLGAEISEVEGILKSAQID--CEIANDNGGGQVVVSGTAEALEVLPD 186

Query: 184 TCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSID 243
              N   K+ + L VS PFHSS M P  + +   L S+    P +P + N  A   S  +
Sbjct: 187 LFKNSSVKKMIKLQVSGPFHSSFMKPADEKLLEFLKSINITRPSIPFVSNVTAKEESDPE 246

Query: 244 EISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVE 303
            I  LL +QV  RVRWRE + +  +HG     EVG  KVL+ L KRID+S++  SI  + 
Sbjct: 247 IIRALLAKQVVSRVRWREMVLYMTSHGTNKFVEVGPNKVLSNLVKRIDQSINTKSIGSIS 306

Query: 304 DID 306
           D D
Sbjct: 307 DAD 309


>gi|261419388|ref|YP_003253070.1| malonyl CoA-acyl carrier protein transacylase [Geobacillus sp.
           Y412MC61]
 gi|319766203|ref|YP_004131704.1| malonyl CoA-acyl carrier protein transacylase [Geobacillus sp.
           Y412MC52]
 gi|261375845|gb|ACX78588.1| malonyl CoA-acyl carrier protein transacylase [Geobacillus sp.
           Y412MC61]
 gi|317111069|gb|ADU93561.1| malonyl CoA-acyl carrier protein transacylase [Geobacillus sp.
           Y412MC52]
          Length = 313

 Score =  259 bits (662), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 139/312 (44%), Positives = 198/312 (63%), Gaps = 11/312 (3%)

Query: 7   FPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPALT 66
           FPGQGSQ +GM +D  +    AR V  E D  L   LS LM+NG QEELT T NAQPAL 
Sbjct: 8   FPGQGSQTVGMAKDAAEHDARARAVIAEADERLGFALSKLMFNGPQEELTLTYNAQPALL 67

Query: 67  AVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQEA 126
             S+A +++++  GL  K D  YVAGHSLGEYTAL AA A S +D +  VR RG+ M EA
Sbjct: 68  TASIALLQLVDGAGL--KAD--YVAGHSLGEYTALVAAGAMSFADAVYAVRRRGELMDEA 123

Query: 127 VPPGLGSMVAIIGLD----DCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAA 182
           VP G G+M A++G+D    + V + I AQ   V   E AN N  GQ+VISG +  V+ AA
Sbjct: 124 VPAGEGTMAAVLGMDADALEAVTNEIAAQGDPV---EPANFNCPGQIVISGSKAGVEKAA 180

Query: 183 DTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSI 242
                +GAKR + L VS PFHS+LM P ++ +K +LDS+  +D V+P++ N  A PV+  
Sbjct: 181 QLLKERGAKRVIPLEVSGPFHSALMKPAAEKLKAVLDSLVIRDAVIPVVANVTAEPVTKK 240

Query: 243 DEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKV 302
           ++I+RLL+EQ+   VRW ++++   + GV +  E+G GKVL+GL K+ID++    +++ +
Sbjct: 241 EDIARLLIEQLYSPVRWEQSVRTLLSLGVDTFVEIGPGKVLSGLVKKIDRNARVYAVNDL 300

Query: 303 EDIDLALRSIVG 314
              +  + ++ G
Sbjct: 301 ASFEATVAALKG 312


>gi|190571076|ref|YP_001975434.1| malonyl CoA-acyl carrier protein transacylase [Wolbachia
           endosymbiont of Culex quinquefasciatus Pel]
 gi|190357348|emb|CAQ54779.1| malonyl CoA-acyl carrier protein transacylase [Wolbachia
           endosymbiont of Culex quinquefasciatus Pel]
          Length = 321

 Score =  259 bits (661), Expect = 5e-67,   Method: Compositional matrix adjust.
 Identities = 136/303 (44%), Positives = 182/303 (60%), Gaps = 2/303 (0%)

Query: 4   VLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQP 63
           +  FPGQGSQ +GMG+ LYD F  AR VF+EVD  L + LS L++NG  E+LT T NAQP
Sbjct: 2   IFAFPGQGSQFVGMGKSLYDEFSVARNVFDEVDDILGRKLSHLIFNGPIEKLTITENAQP 61

Query: 64  ALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSM 123
           A+ AVS+A +RVM+         + YV GHS+GEYTALCAA A +L   ++L++ R ++M
Sbjct: 62  AIMAVSIATLRVMKHVFGESLYSVQYVCGHSVGEYTALCAAGALTLESAVKLLKVRSEAM 121

Query: 124 QEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAAD 183
            EA     G M A++G +   V+ I   A     CEIANDNGGGQVV+SG  +A++   D
Sbjct: 122 HEASLKCKGGMFALLGAEISEVEGILKSAQI--DCEIANDNGGGQVVVSGTAEALEVLPD 179

Query: 184 TCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSID 243
              N   K+ + L VS PFHSS M P  + +   L S+    P +P + N  A   S  +
Sbjct: 180 LFKNSSVKKMIKLQVSGPFHSSFMKPADEKLLEFLKSINITRPSIPFVSNVTAKEESDPE 239

Query: 244 EISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVE 303
            I  LL +QV  RVRWRE + +  +HG     EVG  KVL+ L KRID+S++  SI  + 
Sbjct: 240 IIRALLAKQVVSRVRWREMVLYMTSHGTNKFVEVGPNKVLSNLVKRIDQSINTKSIGSIS 299

Query: 304 DID 306
           D D
Sbjct: 300 DAD 302


>gi|56419724|ref|YP_147042.1| acyl-carrier-protein S-malonyltransferase [Geobacillus kaustophilus
           HTA426]
 gi|56379566|dbj|BAD75474.1| malonyl CoA-acyl carrier protein transacylase [Geobacillus
           kaustophilus HTA426]
          Length = 313

 Score =  259 bits (661), Expect = 5e-67,   Method: Compositional matrix adjust.
 Identities = 139/312 (44%), Positives = 198/312 (63%), Gaps = 11/312 (3%)

Query: 7   FPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPALT 66
           FPGQGSQ +GM +D  +    AR V  E D  L   LS LM+NG QEELT T NAQPAL 
Sbjct: 8   FPGQGSQTVGMAKDAAEHDDRARAVIAEADERLGFALSKLMFNGPQEELTLTYNAQPALL 67

Query: 67  AVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQEA 126
             S+A +++++  GL  K D  YVAGHSLGEYTAL AA A S +D +  VR RG+ M EA
Sbjct: 68  TASIALLQLVDGAGL--KAD--YVAGHSLGEYTALVAAGAMSFADAVYAVRRRGELMDEA 123

Query: 127 VPPGLGSMVAIIGLD----DCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAA 182
           VP G G+M A++G+D    + V + I AQ   V   E AN N  GQ+VISG +  V+ AA
Sbjct: 124 VPAGEGTMAAVLGMDADALEAVTNEIAAQGDPV---EPANFNCPGQIVISGSKAGVEKAA 180

Query: 183 DTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSI 242
                +GAKR + L VS PFHS+LM P ++ +K +LDS+  +D V+P++ N  A PV+  
Sbjct: 181 QLLKERGAKRVIPLEVSGPFHSALMKPAAEKLKAVLDSLVIRDAVIPVVANVTAEPVTKK 240

Query: 243 DEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKV 302
           ++I+RLL+EQ+   VRW ++++   + GV +  E+G GKVL+GL K+ID++    +++ +
Sbjct: 241 EDIARLLIEQLYSPVRWEQSVRTLLSLGVDTFVEIGPGKVLSGLVKKIDRNARVYAVNDL 300

Query: 303 EDIDLALRSIVG 314
              +  + ++ G
Sbjct: 301 ASFEATVAALKG 312


>gi|294084210|ref|YP_003550968.1| acyl-carrier-protein S-malonyltransferase [Candidatus
           Puniceispirillum marinum IMCC1322]
 gi|292663783|gb|ADE38884.1| acyl-carrier-protein S-malonyltransferase [Candidatus
           Puniceispirillum marinum IMCC1322]
          Length = 316

 Score =  259 bits (661), Expect = 5e-67,   Method: Compositional matrix adjust.
 Identities = 139/304 (45%), Positives = 192/304 (63%), Gaps = 1/304 (0%)

Query: 7   FPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPALT 66
           FPGQG+Q IGMGR L  S   AR +FEEV+  L+++L  LM NG ++ L  T NAQPAL 
Sbjct: 10  FPGQGAQAIGMGRQLAASHDVARHLFEEVNDALSEDLFALMQNGPEDVLRLTRNAQPALF 69

Query: 67  AVSMAFIRVMEKN-GLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQE 125
           A SMA +RV+E   G  +    +YVAGHSLGEY AL AA +  ++D  +L+R RG +MQ 
Sbjct: 70  AASMAAVRVLETEIGKPLTAVATYVAGHSLGEYAALAAAGSLGIADAAQLLRQRGDAMQA 129

Query: 126 AVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAADTC 185
           AV  G G+M AI+G D+  +D+I  +AS  G+ +IANDN  GQ+VISG+ DAV  A D  
Sbjct: 130 AVADGDGAMAAILGADEAQIDAILTEASAKGLVQIANDNAPGQIVISGMTDAVDAAIDIA 189

Query: 186 LNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSIDEI 245
            + G +RA+ LPVSAPFH  LM P +  M+  L SV+  D +VP++ N  A+  +  D +
Sbjct: 190 KDAGIRRAIKLPVSAPFHCDLMAPAADTMQSALGSVSMFDSIVPVICNVSAAAETDADML 249

Query: 246 SRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVEDI 305
              L+ Q+  RVRWRET+       +    E+G+GKVL+GL KR  + +S  ++   +D+
Sbjct: 250 RANLITQICSRVRWRETLMLLGQSEITHFIELGTGKVLSGLVKRTLEDVSIANLDGTDDL 309

Query: 306 DLAL 309
           D  L
Sbjct: 310 DKVL 313


>gi|15604570|ref|NP_221088.1| acyl-carrier-protein S-malonyltransferase [Rickettsia prowazekii
           str. Madrid E]
 gi|3861265|emb|CAA15164.1| MALONYL COA-ACYL CARRIER PROTEIN TRANSACYLASE (fabD) [Rickettsia
           prowazekii]
          Length = 319

 Score =  258 bits (659), Expect = 7e-67,   Method: Compositional matrix adjust.
 Identities = 130/313 (41%), Positives = 192/313 (61%), Gaps = 2/313 (0%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M T   FPGQGSQ+IGMG+D YD+   A+  F+ +D  LN+ L+D+++NG  E LT T N
Sbjct: 6   MKTAFIFPGQGSQLIGMGKDFYDNLKPAKETFQIIDEVLNRKLTDIIFNGPSEALTLTTN 65

Query: 61  AQPALTAVSMAFIRVME-KNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRAR 119
           AQPAL AVSMA I +++ + G  +     Y AGHSLGEY+ALC+A++ +L  T +L+  R
Sbjct: 66  AQPALMAVSMAIINIIKAETGKNLDSLCDYAAGHSLGEYSALCSAESINLETTAKLLHIR 125

Query: 120 GKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVK 179
             SMQEA P G+G+M A I +    +  +     ++ +C+IANDN  GQ++ISG  +A+ 
Sbjct: 126 STSMQEACPEGVGAMAACINIPLQTLVELLEDIKKINLCQIANDNIEGQIIISGKVEAIN 185

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            A     + G K A+ L VSAPFH SLM P  + M   LD      P++PI+ N+ A P 
Sbjct: 186 HAISIIKDLGYK-AIRLKVSAPFHCSLMKPAEEKMSIALDKAVINKPIIPIIQNYTAKPT 244

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
            +  EI + L+ Q+ GRVRWRET++ F +  V  + E+G+G VLT + ++I+      +I
Sbjct: 245 INPLEIKQNLILQICGRVRWRETLKLFNHLHVTHIVEIGAGNVLTNMLRKINYPYKLSNI 304

Query: 300 SKVEDIDLALRSI 312
             + ++   L +I
Sbjct: 305 RNLAELKNFLDNI 317


>gi|297530635|ref|YP_003671910.1| malonyl CoA-acyl carrier protein transacylase [Geobacillus sp.
           C56-T3]
 gi|297253887|gb|ADI27333.1| malonyl CoA-acyl carrier protein transacylase [Geobacillus sp.
           C56-T3]
          Length = 313

 Score =  258 bits (658), Expect = 9e-67,   Method: Compositional matrix adjust.
 Identities = 139/312 (44%), Positives = 197/312 (63%), Gaps = 11/312 (3%)

Query: 7   FPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPALT 66
           FPGQGSQ +GM +D  +    AR V  E D  L   LS LM+NG QEELT T NAQPAL 
Sbjct: 8   FPGQGSQTVGMAKDAAEHDARARAVIAEADERLGFALSKLMFNGPQEELTLTYNAQPALL 67

Query: 67  AVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQEA 126
             S+A +++++  GL  K D  YVAGHSLGEYTAL AA A S +D +  VR RG+ M EA
Sbjct: 68  TASIALLQLVDGAGL--KAD--YVAGHSLGEYTALVAAGAMSFADAVYAVRRRGELMDEA 123

Query: 127 VPPGLGSMVAIIGLD----DCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAA 182
           VP G G+M A++G+D    + V + I AQ   V   E AN N  GQ+VISG +  V+ AA
Sbjct: 124 VPAGEGTMAAVLGMDADALEAVTNEIAAQGDPV---EPANFNCPGQIVISGSKAGVEKAA 180

Query: 183 DTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSI 242
                +GAKR + L VS PFHS+LM P ++ +K +LDS+  +D V+P++ N  A PV+  
Sbjct: 181 QLLKERGAKRVIPLEVSGPFHSALMKPAAEKLKAVLDSLVIRDAVIPVVANVTAEPVTKK 240

Query: 243 DEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKV 302
           ++I+RLL+EQ+   VRW ++++   + GV    E+G GKVL+GL K+ID++    +++ +
Sbjct: 241 EDIARLLIEQLYSPVRWEQSVRTLLSLGVDMFVEIGPGKVLSGLVKKIDRNARVYAVNDL 300

Query: 303 EDIDLALRSIVG 314
              +  + ++ G
Sbjct: 301 ASFEATVAALKG 312


>gi|292572377|gb|ADE30292.1| Malonyl CoA-acyl carrier protein transacylase [Rickettsia
           prowazekii Rp22]
          Length = 314

 Score =  258 bits (658), Expect = 9e-67,   Method: Compositional matrix adjust.
 Identities = 130/313 (41%), Positives = 192/313 (61%), Gaps = 2/313 (0%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M T   FPGQGSQ+IGMG+D YD+   A+  F+ +D  LN+ L+D+++NG  E LT T N
Sbjct: 1   MKTAFIFPGQGSQLIGMGKDFYDNLKPAKETFQIIDEVLNRKLTDIIFNGPSEALTLTTN 60

Query: 61  AQPALTAVSMAFIRVME-KNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRAR 119
           AQPAL AVSMA I +++ + G  +     Y AGHSLGEY+ALC+A++ +L  T +L+  R
Sbjct: 61  AQPALMAVSMAIINIIKAETGKNLDSLCDYAAGHSLGEYSALCSAESINLETTAKLLHIR 120

Query: 120 GKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVK 179
             SMQEA P G+G+M A I +    +  +     ++ +C+IANDN  GQ++ISG  +A+ 
Sbjct: 121 STSMQEACPEGVGAMAACINIPLQTLVELLEDIKKINLCQIANDNIEGQIIISGKVEAIN 180

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            A     + G K A+ L VSAPFH SLM P  + M   LD      P++PI+ N+ A P 
Sbjct: 181 HAISIIKDLGYK-AIRLKVSAPFHCSLMKPAEEKMSIALDKAVINKPIIPIIQNYTAKPT 239

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
            +  EI + L+ Q+ GRVRWRET++ F +  V  + E+G+G VLT + ++I+      +I
Sbjct: 240 INPLEIKQNLILQICGRVRWRETLKLFNHLHVTHIVEIGAGNVLTNMLRKINYPYKLSNI 299

Query: 300 SKVEDIDLALRSI 312
             + ++   L +I
Sbjct: 300 RNLAELKNFLDNI 312


>gi|302383703|ref|YP_003819526.1| malonyl CoA-acyl carrier protein transacylase [Brevundimonas
           subvibrioides ATCC 15264]
 gi|302194331|gb|ADL01903.1| malonyl CoA-acyl carrier protein transacylase [Brevundimonas
           subvibrioides ATCC 15264]
          Length = 316

 Score =  258 bits (658), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 154/316 (48%), Positives = 207/316 (65%), Gaps = 6/316 (1%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M+  L FPGQGSQ +GMG  L ++F  AR VF E+D  L Q+LS LM +G +++LT T N
Sbjct: 1   MTLALLFPGQGSQAVGMGAVLAETFASAREVFAEIDQALGQDLSGLMRDGPEDQLTLTEN 60

Query: 61  AQPALTAVSMAFIRVMEKN-GLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRAR 119
           AQPAL AVS+A +R+++K  G+ V R  ++VAGHSLGEY+AL AA A S++DT RL++ R
Sbjct: 61  AQPALMAVSLAVMRLLDKEFGVSVDR-AAFVAGHSLGEYSALAAAGALSIADTARLLKLR 119

Query: 120 GKSMQEAVPPGLGSMVAIIG--LDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDA 177
           G++MQ AVP G G+M ++IG   D  + ++  A  + VG C +ANDN  G VVISG + A
Sbjct: 120 GQAMQRAVPVGQGAMASLIGPKTDLALAEAAAAAGAEVGTCVVANDNNNGNVVISGDKAA 179

Query: 178 VKCAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCAS 237
           V  A +     GA RA+ L VSAPFH  LM P +  M   L S     P VP++ N  A 
Sbjct: 180 VDRAIEKAKELGA-RAIPLNVSAPFHCPLMQPAADEMAAALASANLIAPSVPVVANVTAR 238

Query: 238 PVSSIDEISRLLVEQVTGRVRWRETIQWFANH-GVKSVYEVGSGKVLTGLAKRIDKSLSA 296
           P +  D + RLLVEQVTGRVRWRE++ W A   GV    E+GSGKVLTG+AKRI     +
Sbjct: 239 PETDADTLRRLLVEQVTGRVRWRESMMWMAGEGGVTRFVEIGSGKVLTGMAKRIAPDAES 298

Query: 297 VSISKVEDIDLALRSI 312
           ++++  EDI+   +S+
Sbjct: 299 LALNTPEDIEAFAKSL 314


>gi|209545517|ref|YP_002277746.1| malonyl CoA-acyl carrier protein transacylase [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|209533194|gb|ACI53131.1| malonyl CoA-acyl carrier protein transacylase [Gluconacetobacter
           diazotrophicus PAl 5]
          Length = 323

 Score =  258 bits (658), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 156/316 (49%), Positives = 202/316 (63%), Gaps = 10/316 (3%)

Query: 7   FPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPALT 66
           FPGQGSQ +GMG +L  +F  AR VF+EVD  L+Q LS LM+ G  E+LT T N QPAL 
Sbjct: 8   FPGQGSQSVGMGSELAAAFAPAREVFQEVDDALDQKLSALMFEGPMEDLTRTENTQPALM 67

Query: 67  AVSMAFIRVMEKNG-LCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQE 125
           AVS+A +RV+EK G L +KR  + VAGHSLGEY+AL AA A  ++ T RL+R RG +MQ+
Sbjct: 68  AVSLAVLRVLEKEGGLDLKRTAALVAGHSLGEYSALAAAGALGIAQTARLLRLRGTAMQK 127

Query: 126 AVPPGLGSMVAIIGLDDCVVDSICAQAS---------RVGICEIANDNGGGQVVISGLQD 176
           AVP G G M A+IG+D     +ICA+A+         R    EIANDNGGGQ+VISG   
Sbjct: 128 AVPAGEGGMAALIGVDLDQARAICAEAAILRTEGQPDRTETIEIANDNGGGQIVISGRLS 187

Query: 177 AVKCAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCA 236
           AV+ A      +G KRA+ LPVSAPFH SLM P +  M   L+      PVVP++ N  A
Sbjct: 188 AVERAIGVAKARGVKRALLLPVSAPFHCSLMAPAADAMGEALERAEIAPPVVPVVANVSA 247

Query: 237 SPVSSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSA 296
           + V+    I  LLV QVTG VRWRE+++  A  GV S  E+G+GKVL+GL +RI    + 
Sbjct: 248 AKVTDPQAIRDLLVRQVTGTVRWRESVEAMAAMGVDSFVELGAGKVLSGLVRRIVPDAAT 307

Query: 297 VSISKVEDIDLALRSI 312
            S+    D++  L ++
Sbjct: 308 RSVGTPADVEAFLATL 323


>gi|162148716|ref|YP_001603177.1| malonyl CoA-acyl carrier protein transacylase [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|161787293|emb|CAP56887.1| Malonyl CoA-acyl carrier protein transacylase [Gluconacetobacter
           diazotrophicus PAl 5]
          Length = 355

 Score =  258 bits (658), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 156/316 (49%), Positives = 202/316 (63%), Gaps = 10/316 (3%)

Query: 7   FPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPALT 66
           FPGQGSQ +GMG +L  +F  AR VF+EVD  L+Q LS LM+ G  E+LT T N QPAL 
Sbjct: 40  FPGQGSQSVGMGSELAAAFAPAREVFQEVDDALDQKLSALMFEGPMEDLTRTENTQPALM 99

Query: 67  AVSMAFIRVMEKNG-LCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQE 125
           AVS+A +RV+EK G L +KR  + VAGHSLGEY+AL AA A  ++ T RL+R RG +MQ+
Sbjct: 100 AVSLAVLRVLEKEGGLDLKRTAALVAGHSLGEYSALAAAGALGIAQTARLLRLRGTAMQK 159

Query: 126 AVPPGLGSMVAIIGLDDCVVDSICAQAS---------RVGICEIANDNGGGQVVISGLQD 176
           AVP G G M A+IG+D     +ICA+A+         R    EIANDNGGGQ+VISG   
Sbjct: 160 AVPAGEGGMAALIGVDLDQARAICAEAAILRTEGQPDRTETIEIANDNGGGQIVISGRLS 219

Query: 177 AVKCAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCA 236
           AV+ A      +G KRA+ LPVSAPFH SLM P +  M   L+      PVVP++ N  A
Sbjct: 220 AVERAIGVAKARGVKRALLLPVSAPFHCSLMAPAADAMGEALERAEIAPPVVPVVANVSA 279

Query: 237 SPVSSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSA 296
           + V+    I  LLV QVTG VRWRE+++  A  GV S  E+G+GKVL+GL +RI    + 
Sbjct: 280 AKVTDPQAIRDLLVRQVTGTVRWRESVEAMAAMGVDSFVELGAGKVLSGLVRRIVPDAAT 339

Query: 297 VSISKVEDIDLALRSI 312
            S+    D++  L ++
Sbjct: 340 RSVGTPADVEAFLATL 355


>gi|27262212|gb|AAN87387.1| Malonyl-CoA-[acyl-carrier-protein] transacylase [Heliobacillus
           mobilis]
          Length = 308

 Score =  258 bits (658), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 143/307 (46%), Positives = 192/307 (62%), Gaps = 4/307 (1%)

Query: 5   LTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPA 64
             FPGQ SQ +GMG DL   FP A+ VF+E D  L  +LS L + G +EEL  T N QPA
Sbjct: 6   FMFPGQCSQFVGMGADLAAQFPLAKAVFDEADEALGFSLSKLCFEGPEEELRLTANTQPA 65

Query: 65  LTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQ 124
           L A ++A  RV+  NG   + D  +VAGHSLGEY+AL AA + +L + IRLVR RG  MQ
Sbjct: 66  LLATAVAVYRVLAANGF--RPD--WVAGHSLGEYSALVAAGSLTLVEGIRLVRQRGLFMQ 121

Query: 125 EAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAADT 184
           +AVP G G+M AI+GL+   V+++C  AS  G+ E AN NG GQVVI+G   AV+ A   
Sbjct: 122 DAVPAGRGTMAAIMGLEAEAVEALCRDASTAGVVEPANFNGAGQVVIAGEVAAVEQAVAL 181

Query: 185 CLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSIDE 244
               GAKR+V L VSAPFH SLM P ++ M  +L +    DP +P++ N  A P +S + 
Sbjct: 182 AKAAGAKRSVMLNVSAPFHCSLMKPAAERMTEVLQAANISDPTIPLVANVTAQPATSGEA 241

Query: 245 ISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVED 304
           + + L+ QV   VRW +++++ A+ GV+   EVG GKVLTGLA++I K     +I  V+ 
Sbjct: 242 VRKNLILQVDHPVRWEQSVKFLADAGVQRFIEVGPGKVLTGLARKIVKGSETAAIGDVDT 301

Query: 305 IDLALRS 311
           I   L S
Sbjct: 302 IQKVLAS 308


>gi|304404212|ref|ZP_07385874.1| malonyl CoA-acyl carrier protein transacylase [Paenibacillus
           curdlanolyticus YK9]
 gi|304347190|gb|EFM13022.1| malonyl CoA-acyl carrier protein transacylase [Paenibacillus
           curdlanolyticus YK9]
          Length = 311

 Score =  257 bits (657), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 128/304 (42%), Positives = 189/304 (62%), Gaps = 5/304 (1%)

Query: 3   TVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQ 62
           T   FPGQG+Q +GMG D + +F E+R +FE+ D  L  +LSD+++NG  + L  T N Q
Sbjct: 4   TAFVFPGQGAQAVGMGHDAFQTFEESRKIFEQADEALGFSLSDIIFNGPDDSLKQTANTQ 63

Query: 63  PALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKS 122
           PAL  VS+A +  ++  GL       YVAGHSLGEY+AL A+   S +D +R VR+RG+ 
Sbjct: 64  PALLTVSVALLEALKDRGLTPD----YVAGHSLGEYSALVASGVLSFADAVRTVRSRGEF 119

Query: 123 MQEAVPPGLGSMVAIIGLDDCVVDSIC-AQASRVGICEIANDNGGGQVVISGLQDAVKCA 181
           M++AVP G G+M A++G +   +  +C A  + VG  E+AN N  GQ+V+SG    V+  
Sbjct: 120 MEQAVPSGNGAMAAVLGAEREALAQLCKAVTAEVGAVELANVNCPGQIVVSGTAAGVQGV 179

Query: 182 ADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSS 241
            +     GAKR + L VS PFHSSLM P ++ +  +L+ V+  D  +P++ N  A PVS+
Sbjct: 180 VERGKEAGAKRVIPLEVSGPFHSSLMKPAAERLAGVLEGVSFHDAAIPVIANVTAEPVSA 239

Query: 242 IDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISK 301
              I  LLVEQV   V W +TI+   + GV +  E+GSG VL GL K++D+S++ + ++ 
Sbjct: 240 ASSIRELLVEQVYSPVLWEDTIRKLIDLGVTTFVEIGSGNVLAGLIKKVDRSVTIIPVNS 299

Query: 302 VEDI 305
           VE +
Sbjct: 300 VETL 303


>gi|88608410|ref|YP_506824.1| malonyl CoA-acyl carrier protein transacylase [Neorickettsia
           sennetsu str. Miyayama]
 gi|88600579|gb|ABD46047.1| malonyl CoA-acyl carrier protein transacylase [Neorickettsia
           sennetsu str. Miyayama]
          Length = 309

 Score =  257 bits (656), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 140/312 (44%), Positives = 197/312 (63%), Gaps = 15/312 (4%)

Query: 7   FPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPALT 66
           FPGQGSQ +GMG+ LY++F  AR VF EVD +L   LS +++ G   EL+ T NAQPAL 
Sbjct: 6   FPGQGSQRVGMGKSLYENFSVAREVFSEVDESLGMKLSKVIFEGP--ELSNTENAQPALM 63

Query: 67  AVSMAFIRVM-EKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQE 125
           A SMA ++V+  ++G  V     Y+AGHSLGEYTALCA+ A ++S   R+++ RGKSMQE
Sbjct: 64  ATSMAALKVLLSESGKSVSELSKYLAGHSLGEYTALCASGAITISQVARILKIRGKSMQE 123

Query: 126 AVPPGLGSMVAIIGL-----DDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           AVP G G M+A++ +      D +V+S          CEI+NDN   QVV+SGL   ++ 
Sbjct: 124 AVPMGEGGMLALLKVTFEEVQDLIVESKAN-------CEISNDNSNEQVVVSGLTTEIEK 176

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
                  KG KR V L VSAPFH  LM P    +K  LD+     P VPI+ N  ASPV+
Sbjct: 177 IEQYAKQKGIKRVVRLNVSAPFHCKLMQPAVMPVKDALDTAEIVTPSVPIVSNVTASPVT 236

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
            + +I  LLV+Q+TG VRWRE++ +    GVK+  EVGSG VL+ +  R++ +++ +++ 
Sbjct: 237 EVQKIKELLVQQITGCVRWRESMLFAIGAGVKTFIEVGSGNVLSKMLSRMNPNVTTLNLE 296

Query: 301 KVEDIDLALRSI 312
            V+D+D  + +I
Sbjct: 297 GVDDLDRIIATI 308


>gi|313673184|ref|YP_004051295.1| (acyl-carrier-protein) s-malonyltransferase [Calditerrivibrio
           nitroreducens DSM 19672]
 gi|312939940|gb|ADR19132.1| (Acyl-carrier-protein) S-malonyltransferase [Calditerrivibrio
           nitroreducens DSM 19672]
          Length = 310

 Score =  257 bits (656), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 131/302 (43%), Positives = 188/302 (62%), Gaps = 6/302 (1%)

Query: 5   LTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPA 64
           + FPGQGSQ +GMG+D Y+++ E++  FE  D  LN  L+D+M+NG ++EL  T N QPA
Sbjct: 6   VVFPGQGSQYVGMGKDFYETYSESKKFFETADSVLNYKLTDIMFNGPEDELKITYNTQPA 65

Query: 65  LTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQ 124
           L  VS+A   +++      K D+SY AGHSLGEY+A+ AA   S  D +  V  RGK MQ
Sbjct: 66  LLTVSIAIWELIKD-----KVDVSYFAGHSLGEYSAIVAAGGMSFKDAVLAVHNRGKFMQ 120

Query: 125 EAVPPGLGSMVAIIGLDDCVVDSICAQASRVG-ICEIANDNGGGQVVISGLQDAVKCAAD 183
           EAVP G G+M A++ +D+ ++   C + S+ G I E AN N   Q+V++G  +AV    +
Sbjct: 121 EAVPVGTGAMAAVLSMDESIILETCKEISKDGFIVEPANFNSEAQIVVAGHAEAVDKFIE 180

Query: 184 TCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSID 243
               KG ++ V LPVSAPFH SLM P    M   L +V  +D   P+  N  AS  ++  
Sbjct: 181 KIKEKGGRKVVKLPVSAPFHCSLMKPAELKMAEYLKNVQIKDLSKPVFNNVTASMETTSL 240

Query: 244 EISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVE 303
           E+   LV+QV+  VRW E I+   + GV + +EVG+G VLTGL K+IDK++   +ISK++
Sbjct: 241 EVRENLVKQVSSPVRWTELIKNMVSEGVDTFFEVGAGNVLTGLIKKIDKNVKCFNISKID 300

Query: 304 DI 305
           D+
Sbjct: 301 DL 302


>gi|332976634|gb|EGK13475.1| malonyl-CoA-[acyl-carrier-protein] transacylase [Desmospora sp.
           8437]
          Length = 311

 Score =  257 bits (656), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 140/311 (45%), Positives = 192/311 (61%), Gaps = 5/311 (1%)

Query: 3   TVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQ 62
           T   FPGQGSQ +GMG+D++D  P+ R VFE+ D  L  +LS L + G +EEL  T NAQ
Sbjct: 4   TAFLFPGQGSQAVGMGKDVHDGDPQVREVFEQADEELGYSLSRLCFEGPEEELRLTANAQ 63

Query: 63  PALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKS 122
           PA+   S+A  R++E  GL       +VAGHSLGEY+AL AA+A S  D +R VR RG  
Sbjct: 64  PAILTTSVALYRLVEAAGLTA----DFVAGHSLGEYSALVAAEALSFKDAVRTVRKRGLL 119

Query: 123 MQEAVPPGLGSMVAIIGLDDCVVDSICAQAS-RVGICEIANDNGGGQVVISGLQDAVKCA 181
           M+EAVP G G+M A+IGLD   V+ IC +AS   G+ E AN N  GQ+VISG ++AV+ A
Sbjct: 120 MEEAVPAGEGAMSAVIGLDRESVERICREASGEQGVVEPANYNCPGQLVISGSKEAVEAA 179

Query: 182 ADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSS 241
                  GA+R + L VS PFHSSLM P ++ MK +LD +  ++  VP++ N  A P   
Sbjct: 180 GAKAKEAGARRVLPLSVSGPFHSSLMRPAAERMKEVLDRLEIREARVPVVANVSARPQQE 239

Query: 242 IDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISK 301
             +I + LVEQV   V W ++I+     GV +  E+G G VLTGL ++I + ++A+SI  
Sbjct: 240 AADIRKALVEQVAAPVLWEDSIRRLIEEGVDTFVEIGPGNVLTGLVRKIQRGVTALSIQD 299

Query: 302 VEDIDLALRSI 312
            E +   L  +
Sbjct: 300 GESMRKTLEKM 310


>gi|307294388|ref|ZP_07574232.1| malonyl CoA-acyl carrier protein transacylase [Sphingobium
           chlorophenolicum L-1]
 gi|306880539|gb|EFN11756.1| malonyl CoA-acyl carrier protein transacylase [Sphingobium
           chlorophenolicum L-1]
          Length = 311

 Score =  256 bits (653), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 139/309 (44%), Positives = 198/309 (64%), Gaps = 6/309 (1%)

Query: 7   FPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPALT 66
           FPGQGSQ +GMG+ L D+ P A+ +F+EVD  L+Q+L  +M  G + +LT T NAQPA+ 
Sbjct: 6   FPGQGSQSVGMGKALADASPAAKELFQEVDDALSQHLFRIMVEGPESDLTLTENAQPAIM 65

Query: 67  AVSMAFIRVMEKNG---LCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSM 123
           A ++A +RVM++ G   L  K D  +VAGHSLGEY+ALCAA+AF +  T +L++ RG++M
Sbjct: 66  ANALATLRVMQREGGFSLAEKGD--FVAGHSLGEYSALCAAEAFDIGTTAKLLKLRGRAM 123

Query: 124 QEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAAD 183
           Q AVP G G+M A++G D     ++   A+   +C +ANDN   QVVISG + A++ A  
Sbjct: 124 QAAVPVGEGAMAALLGADIEKAQALADAAAEGEVCTVANDNDPTQVVISGHRGAIERAVA 183

Query: 184 TCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSID 243
              + G KR V LPVSAPFH  LM P ++ M+  L       P++P+  N  AS ++  +
Sbjct: 184 LVKDHGIKRGVLLPVSAPFHCPLMQPAAEAMEEALGKAAINTPLLPVYANVLASAIADPE 243

Query: 244 EISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVE 303
           EI R LVEQVTGRVRWRE++    + GV    E+G GKVL  + KRI    +  SI  ++
Sbjct: 244 EIKRRLVEQVTGRVRWRESVAAMWDAGVTEFVELG-GKVLGPMVKRIAPDATVRSIVTMD 302

Query: 304 DIDLALRSI 312
           D++ AL ++
Sbjct: 303 DVEAALGAL 311


>gi|16078653|ref|NP_389472.1| malonyl CoA:acyl carrier protein transacylase [Bacillus subtilis
           subsp. subtilis str. 168]
 gi|221309465|ref|ZP_03591312.1| acyl-carrier-protein S-malonyltransferase [Bacillus subtilis subsp.
           subtilis str. 168]
 gi|221313790|ref|ZP_03595595.1| acyl-carrier-protein S-malonyltransferase [Bacillus subtilis subsp.
           subtilis str. NCIB 3610]
 gi|221318714|ref|ZP_03600008.1| acyl-carrier-protein S-malonyltransferase [Bacillus subtilis subsp.
           subtilis str. JH642]
 gi|221322985|ref|ZP_03604279.1| acyl-carrier-protein S-malonyltransferase [Bacillus subtilis subsp.
           subtilis str. SMY]
 gi|321315356|ref|YP_004207643.1| malonyl CoA:acyl carrier protein transacylase [Bacillus subtilis
           BSn5]
 gi|7404378|sp|P71019|FABD_BACSU RecName: Full=Malonyl CoA-acyl carrier protein transacylase;
           Short=MCT
 gi|2337819|emb|CAA74249.1| putative FabD protein [Bacillus subtilis subsp. subtilis str. 168]
 gi|2633962|emb|CAB13463.1| malonyl CoA:acyl carrier protein transacylase [Bacillus subtilis
           subsp. subtilis str. 168]
 gi|320021630|gb|ADV96616.1| malonyl CoA:acyl carrier protein transacylase [Bacillus subtilis
           BSn5]
          Length = 317

 Score =  256 bits (653), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 129/307 (42%), Positives = 192/307 (62%), Gaps = 5/307 (1%)

Query: 7   FPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPALT 66
           FPGQGSQ IGMG++LY+  P A+ +F+E D TL   LS L++ G  EELT T NAQPAL 
Sbjct: 8   FPGQGSQFIGMGKELYEQVPAAKRLFDEADETLETKLSSLIFEGDAEELTLTYNAQPALL 67

Query: 67  AVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQEA 126
             S+A +   +++G+       + AGHSLGEY+AL AA A S  D +  VR RG+ M EA
Sbjct: 68  TTSIAVLEKFKESGITP----DFTAGHSLGEYSALVAAGALSFKDAVYTVRKRGEFMNEA 123

Query: 127 VPPGLGSMVAIIGLDDCVVDSICAQASRVG-ICEIANDNGGGQVVISGLQDAVKCAADTC 185
           VP G G+M AI+G+D   +  +  + +  G + ++AN N  GQ+VISG    V+ A++  
Sbjct: 124 VPAGEGAMAAILGMDAEALKQVTDKVTEEGNLVQLANLNCPGQIVISGTAKGVELASELA 183

Query: 186 LNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSIDEI 245
              GAKRA+ L VS PFHS LM P ++ +K +LD+   +D  VP++ N  A  ++   +I
Sbjct: 184 KENGAKRAIPLEVSGPFHSELMKPAAEKLKEVLDACDIKDADVPVISNVSADVMTEKADI 243

Query: 246 SRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVEDI 305
              L+EQ+   VR+ E+I      GV +  E+G GKVL+GL K++++ L  +++S  E I
Sbjct: 244 KEKLIEQLYSPVRFEESINKLIAEGVTTFIEIGPGKVLSGLVKKVNRRLKTIAVSDPETI 303

Query: 306 DLALRSI 312
           +LA++++
Sbjct: 304 ELAIQTL 310


>gi|308173553|ref|YP_003920258.1| malonyl CoA:acyl carrier protein transacylase [Bacillus
           amyloliquefaciens DSM 7]
 gi|307606417|emb|CBI42788.1| malonyl CoA:acyl carrier protein transacylase [Bacillus
           amyloliquefaciens DSM 7]
 gi|328553514|gb|AEB24006.1| malonyl CoA:acyl carrier protein transacylase [Bacillus
           amyloliquefaciens TA208]
 gi|328911694|gb|AEB63290.1| malonyl CoA:acyl carrier protein transacylase [Bacillus
           amyloliquefaciens LL3]
          Length = 317

 Score =  256 bits (653), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 128/307 (41%), Positives = 194/307 (63%), Gaps = 5/307 (1%)

Query: 7   FPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPALT 66
           FPGQGSQ IGMG+DLY+    ++ +F+E D TL   LS L++ G  EELT T NAQPAL 
Sbjct: 8   FPGQGSQYIGMGKDLYEREEASKRIFDEADETLETKLSSLIFEGDAEELTLTYNAQPALL 67

Query: 67  AVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQEA 126
             S+A +   +++G+       + AGHSLGEY+AL AA A +  D +  VR RG+ M EA
Sbjct: 68  TTSIAVLEKFKESGITP----DFTAGHSLGEYSALVAAGAMTFKDAVYTVRKRGEFMNEA 123

Query: 127 VPPGLGSMVAIIGLDDCVVDSICAQASRVG-ICEIANDNGGGQVVISGLQDAVKCAADTC 185
           VP G G+M AI+G+D   +  +  Q +  G + ++AN N  GQ+VISG    V+ A++  
Sbjct: 124 VPAGEGAMAAILGMDAESLKKVTDQVTENGHLVQLANLNCPGQIVISGTAKGVELASEEA 183

Query: 186 LNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSIDEI 245
            N GAKRA+ L VS PFHS LM P ++ ++ +L +   ++  VP++ N  A  ++  D+I
Sbjct: 184 KNNGAKRAIPLEVSGPFHSELMKPAAQKLEDVLSACDVKNAAVPVISNVSADVMTDKDDI 243

Query: 246 SRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVEDI 305
            + L+EQ+   VR+ ETI    + GV +  E+G GKVL+GL K++++ L  +++S  E I
Sbjct: 244 KKKLIEQLYSPVRFEETINKLIDEGVTTFVEIGPGKVLSGLVKKVNRRLKTIAVSDQETI 303

Query: 306 DLALRSI 312
           +LA++++
Sbjct: 304 ELAIQTL 310


>gi|291484141|dbj|BAI85216.1| acyl-carrier-protein S-malonyltransferase [Bacillus subtilis subsp.
           natto BEST195]
          Length = 317

 Score =  256 bits (653), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 128/307 (41%), Positives = 193/307 (62%), Gaps = 5/307 (1%)

Query: 7   FPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPALT 66
           FPGQGSQ IGMG++LY+  P A+ +F+E D TL   LS L++ G+ EELT T NAQPAL 
Sbjct: 8   FPGQGSQFIGMGKELYEQVPAAKRLFDEADETLETKLSSLIFEGAAEELTLTYNAQPALL 67

Query: 67  AVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQEA 126
             S+A +   +++G+       + AGHSLGEY+AL AA A S  D +  VR RG+ M EA
Sbjct: 68  TTSIAVLEKFKESGITP----DFTAGHSLGEYSALVAAGALSFKDAVYTVRKRGEFMNEA 123

Query: 127 VPPGLGSMVAIIGLDDCVVDSICAQASRVG-ICEIANDNGGGQVVISGLQDAVKCAADTC 185
           VP G G+M AI+G+D   +  +  + +  G + ++AN N  GQ+VISG    V+ A++  
Sbjct: 124 VPAGEGAMAAILGMDAEALKQVTDKVTEEGNLVQLANLNCPGQIVISGTAKGVELASELA 183

Query: 186 LNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSIDEI 245
              GAKRA+ L VS PFHS LM P ++ +K +LD+   +D  +P++ N  A  ++   +I
Sbjct: 184 KENGAKRAIPLEVSGPFHSELMKPAAEKLKEVLDACDIKDADIPVISNVSADVMTEKADI 243

Query: 246 SRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVEDI 305
              L+EQ+   VR+ E+I      GV +  E+G GKVL+GL K++++ L  +++S  E I
Sbjct: 244 KEKLIEQLYSPVRFEESINKLIAEGVTTFIEIGPGKVLSGLVKKVNRRLKTIAVSDPETI 303

Query: 306 DLALRSI 312
           +LA++++
Sbjct: 304 ELAIQTL 310


>gi|312143446|ref|YP_003994892.1| malonyl CoA-acyl carrier protein transacylase [Halanaerobium sp.
           'sapolanicus']
 gi|311904097|gb|ADQ14538.1| malonyl CoA-acyl carrier protein transacylase [Halanaerobium sp.
           'sapolanicus']
          Length = 309

 Score =  256 bits (653), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 129/309 (41%), Positives = 191/309 (61%), Gaps = 6/309 (1%)

Query: 4   VLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQP 63
           V  F GQGSQ +GMG+DLYD++  A  V  + D+ ++ +L D+++ G +E L  T N QP
Sbjct: 6   VFMFSGQGSQYVGMGKDLYDNYRAAEEVLNKADNLVDFDLKDIIFKGPKETLNNTKNTQP 65

Query: 64  ALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSM 123
           A+  +S     V+E+ G+      S VAGHSLGEY+AL AA   S +D ++LVR RG+ M
Sbjct: 66  AIYTISAMVKAVLEEEGIRA----SAVAGHSLGEYSALYAAGVLSFADGLKLVRKRGELM 121

Query: 124 QEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAAD 183
            +A P G G+M A+IGL+D +V+ IC Q    GIC++AN N  GQVVISG  DA+K A +
Sbjct: 122 DKADPEGKGTMAAVIGLEDQIVEDICEQVD--GICQVANYNSPGQVVISGEVDAIKKAEE 179

Query: 184 TCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSID 243
               +GAKR + L VS  FHS LM P  + +K +++ +  +D  +P+L N  A  V    
Sbjct: 180 ILNEQGAKRVIPLQVSGAFHSPLMEPAKEELKKLIEEIEFKDAELPLLANVSADYVKDRQ 239

Query: 244 EISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVE 303
           +I  +L++Q+   VRW E IQ F   G +   E+G G+VL GL +RID+SL+A ++   +
Sbjct: 240 DIKEVLIKQLDNSVRWSEIIQKFKEDGYQDFVELGPGRVLKGLMRRIDRSLNAYNVEDSK 299

Query: 304 DIDLALRSI 312
            ++  L+ +
Sbjct: 300 SLNKTLKKL 308


>gi|254994670|ref|ZP_05276860.1| malonyl CoA-acyl carrier protein transacylase (fabD) [Anaplasma
           marginale str. Mississippi]
 gi|255002778|ref|ZP_05277742.1| malonyl CoA-acyl carrier protein transacylase (fabD) [Anaplasma
           marginale str. Puerto Rico]
          Length = 325

 Score =  255 bits (652), Expect = 5e-66,   Method: Compositional matrix adjust.
 Identities = 137/306 (44%), Positives = 184/306 (60%), Gaps = 1/306 (0%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           MS V  FPGQGSQ +GMGR++YDS P AR VF EVD TL ++LS +++ G +E LT+TCN
Sbjct: 1   MSVVFMFPGQGSQFVGMGREVYDSSPAARRVFHEVDETLGRHLSRIIFQGPEEALTSTCN 60

Query: 61  AQPALTAVSMAFIRVMEKN-GLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRAR 119
           AQ AL  VS+A +R +E+N G  +   + YV GHS+GEYTAL  +K   L    RL+  R
Sbjct: 61  AQLALMTVSVALVRALEENLGGPITDAVKYVLGHSVGEYTALHVSKVIGLPSVARLLDVR 120

Query: 120 GKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVK 179
           GK+M  A     G M A+IG     V+++ A+AS  GICE+ANDN  GQVV+SG + A++
Sbjct: 121 GKAMHRASSLCCGGMAALIGGSLSEVEAVAARASEYGICEVANDNCTGQVVVSGTESALQ 180

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
                    G K+ + L VS PFHSSLM      +   +D +    P V ++ N  AS  
Sbjct: 181 QLPKLIEGTGIKKVIRLRVSGPFHSSLMRLACNEIGDFVDQLEMNPPEVEMVFNVSASTH 240

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
           S  + I  L+V QV  RVRWRE+I++    G     EVG G+VL GL KRID S+    +
Sbjct: 241 SDCNAIRNLMVRQVVSRVRWRESIEYLIGCGCSEFIEVGPGQVLVGLLKRIDNSVRGFGV 300

Query: 300 SKVEDI 305
             +E +
Sbjct: 301 DSMESV 306


>gi|227824527|ref|ZP_03989359.1| malonyl CoA-acyl carrier protein transacylase [Acidaminococcus sp.
           D21]
 gi|226905026|gb|EEH90944.1| malonyl CoA-acyl carrier protein transacylase [Acidaminococcus sp.
           D21]
          Length = 315

 Score =  255 bits (652), Expect = 6e-66,   Method: Compositional matrix adjust.
 Identities = 136/307 (44%), Positives = 192/307 (62%), Gaps = 6/307 (1%)

Query: 5   LTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPA 64
             FPGQGSQ +GM +DLYD++   + VF+E D  L  +++DL + G +E+L  T N QPA
Sbjct: 6   FMFPGQGSQKVGMMKDLYDNYSVVKDVFKEADEALGFSMTDLCFKGPEEQLRLTYNTQPA 65

Query: 65  LTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQ 124
           +   S+A ++V+E+N +      S VAGHSLGEY+AL  A A S +D +R VR RG+ MQ
Sbjct: 66  ILTCSVAAMKVLEENEIIP----SVVAGHSLGEYSALVCAGAMSFADAVRTVRKRGQFMQ 121

Query: 125 EAVPPGLGSMVAIIGLDDCVVDSICAQ-ASRVGIC-EIANDNGGGQVVISGLQDAVKCAA 182
           EAVP G G+M AIIGLD   +  ICA+ A+    C +  N N  GQ+VI+G  +AV  A 
Sbjct: 122 EAVPVGEGAMAAIIGLDTDKIKEICAETANMTNQCVQAVNFNCPGQIVIAGATEAVHKAC 181

Query: 183 DTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSI 242
           D     GAKRA+ LPVSAPFHS+LM P +  +K +LDSV   D  +P++ N  A P +  
Sbjct: 182 DRLKEAGAKRAILLPVSAPFHSTLMQPAADRLKEVLDSVEIVDAKIPVVANVNAKPETKA 241

Query: 243 DEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKV 302
           DEI   LV Q    V W ++++   N GV +  EVG GKVL G  K++D+S + +++  +
Sbjct: 242 DEIRSQLVLQAASPVLWEDSVRRMMNDGVDTFVEVGPGKVLCGFIKKVDRSYAPLNVEDM 301

Query: 303 EDIDLAL 309
           E ++ +L
Sbjct: 302 ESLEKSL 308


>gi|329890135|ref|ZP_08268478.1| malonyl CoA-acyl carrier protein transacylase [Brevundimonas
           diminuta ATCC 11568]
 gi|328845436|gb|EGF95000.1| malonyl CoA-acyl carrier protein transacylase [Brevundimonas
           diminuta ATCC 11568]
          Length = 314

 Score =  254 bits (650), Expect = 8e-66,   Method: Compositional matrix adjust.
 Identities = 157/316 (49%), Positives = 205/316 (64%), Gaps = 6/316 (1%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           MS  L FPGQGSQ +GMG  L ++F  AR VF EVD  LNQ L +LM  G +++LT T N
Sbjct: 1   MSLALLFPGQGSQSVGMGVALSEAFASAREVFAEVDDALNQKLFELMREGPEDQLTLTEN 60

Query: 61  AQPALTAVSMAFIRVME-KNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRAR 119
           AQPAL AVS+A  RV++ + G+ V R  ++VAGHSLGEY+AL AA A SLSDT RL++ R
Sbjct: 61  AQPALMAVSVATARVLKVEFGVDVAR-AAFVAGHSLGEYSALAAAGAISLSDTARLLKLR 119

Query: 120 GKSMQEAVPPGLGSMVAIIG--LDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDA 177
           G++MQ AVP G G+M ++IG   D  + +      S  G+C +ANDN  G VVISG + A
Sbjct: 120 GQAMQRAVPVGKGAMASLIGPKTDLALAEEAAKAGSAAGVCVVANDNNKGNVVISGDKAA 179

Query: 178 VKCAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCAS 237
           V  A +     GA RA+ L VSAPFH  LM P +  M   L       PVVP++ N  A 
Sbjct: 180 VDLAIEKAKELGA-RAIPLNVSAPFHCPLMQPAADEMAAALADAKIIAPVVPVVANVTAR 238

Query: 238 PVSSIDEISRLLVEQVTGRVRWRETIQWFANH-GVKSVYEVGSGKVLTGLAKRIDKSLSA 296
           P +  + I RLLVEQVTGRVRWRE+++W A+  GV    EVGSGKVLTG+AKRI     A
Sbjct: 239 PETDAEVIRRLLVEQVTGRVRWRESMEWMASEGGVTRFVEVGSGKVLTGMAKRIAPDAEA 298

Query: 297 VSISKVEDIDLALRSI 312
           ++++  E+++   +S+
Sbjct: 299 LALNTAEELEAFAKSL 314


>gi|77919038|ref|YP_356853.1| malonyl CoA-acyl carrier protein transacylase [Pelobacter
           carbinolicus DSM 2380]
 gi|77545121|gb|ABA88683.1| [Acyl-carrier-protein] S-malonyltransferase [Pelobacter
           carbinolicus DSM 2380]
          Length = 304

 Score =  254 bits (650), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 137/301 (45%), Positives = 188/301 (62%), Gaps = 3/301 (0%)

Query: 5   LTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPA 64
             FPGQGSQ  GMG+DL ++F +A+LVFEE +  L  +LS L + G ++EL  T N QPA
Sbjct: 4   FVFPGQGSQYAGMGKDLAENFGQAKLVFEEANDVLGIDLSKLCFEGPEDELKLTANTQPA 63

Query: 65  LTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQ 124
           + A S+A +RV++     V     +VAGHSLGEY AL  A   S +D ++ VR RG  MQ
Sbjct: 64  IVATSIAALRVLQSETGLVP---DFVAGHSLGEYAALVCAGGLSFADAVQTVRKRGTFMQ 120

Query: 125 EAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAADT 184
           +AVP G+G+M AIIGLD  VVD +CA+ +   +   AN N  GQ+VI+G   AV+ A   
Sbjct: 121 DAVPVGVGTMAAIIGLDAPVVDEVCAEVASGDVVAPANYNSPGQIVIAGHIAAVERAMAL 180

Query: 185 CLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSIDE 244
              +GAKRA+ LPVSAPFH SLM P ++ +  +L  V+ +    P++ N  AS  S    
Sbjct: 181 AKERGAKRALPLPVSAPFHCSLMEPAARQLDEVLAGVSVETLACPVVSNVEASANSDAKA 240

Query: 245 ISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVED 304
           +  LLV+QV   VRW E++   ++ GV    E+G GKVL+GL KRI K +S  ++ KVED
Sbjct: 241 VRELLVKQVYSPVRWEESVSAMSDEGVDRFVEIGPGKVLSGLIKRIVKGVSLQNMGKVED 300

Query: 305 I 305
           +
Sbjct: 301 L 301


>gi|239948418|ref|ZP_04700171.1| malonyl CoA-acyl carrier protein transacylase [Rickettsia
           endosymbiont of Ixodes scapularis]
 gi|239922694|gb|EER22718.1| malonyl CoA-acyl carrier protein transacylase [Rickettsia
           endosymbiont of Ixodes scapularis]
          Length = 314

 Score =  254 bits (649), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 128/311 (41%), Positives = 187/311 (60%), Gaps = 12/311 (3%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M     FPGQG Q+ G+G+D YD+F  A+  F+ VD  LN+ L+D+++NG  EELT T N
Sbjct: 1   MKIAFIFPGQGVQLTGIGKDFYDNFKPAKETFQIVDEVLNRKLTDIIFNGPSEELTLTTN 60

Query: 61  AQPALTAVSMAFIRVMEK------NGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIR 114
           AQPAL AVSMA I +++       + LC      Y AGHSLGEY+ALC+ ++ S+    +
Sbjct: 61  AQPALMAVSMAIINIIKTETDKSLDSLC-----DYAAGHSLGEYSALCSTESISIETAAK 115

Query: 115 LVRARGKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGL 174
           L+  R  SMQEA P G GSM A I +    ++ I    +++ +C+IANDN  GQ+VISG 
Sbjct: 116 LLHIRSTSMQEACPEGEGSMAACINIPLQKLEEILEDINKINLCQIANDNIEGQIVISGK 175

Query: 175 QDAVKCAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNF 234
             A+  A     + G K A+ L VSAPFH SLM P  + M+  LD      P++P++ N+
Sbjct: 176 TTAIDHAISIIKDLGYK-AIKLKVSAPFHCSLMKPAEEKMRVALDKAVINKPLIPVIQNY 234

Query: 235 CASPVSSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSL 294
            A P     EI + L+ Q+ GRVRWRET++ F    +  + E+G+G VLT + ++I+   
Sbjct: 235 TAKPTLDPTEIKQNLILQICGRVRWRETLELFNTLDITHIVEIGAGSVLTNMLRKINYPY 294

Query: 295 SAVSISKVEDI 305
              +I+ +E++
Sbjct: 295 KLSNITNLEEL 305


>gi|154686006|ref|YP_001421167.1| hypothetical protein RBAM_015730 [Bacillus amyloliquefaciens FZB42]
 gi|154351857|gb|ABS73936.1| FabD [Bacillus amyloliquefaciens FZB42]
          Length = 317

 Score =  254 bits (649), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 127/307 (41%), Positives = 193/307 (62%), Gaps = 5/307 (1%)

Query: 7   FPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPALT 66
           FPGQGSQ IGMG+DLY+    ++ +F+E D TL   LS L++ G  EELT T NAQPAL 
Sbjct: 8   FPGQGSQYIGMGKDLYEREEASKRIFDEADETLETKLSSLIFEGDAEELTLTYNAQPALL 67

Query: 67  AVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQEA 126
             S+A +   +++ +       + AGHSLGEY+AL AA A +  D +  VR RG+ M EA
Sbjct: 68  TTSIAVLEKFKESSITP----DFTAGHSLGEYSALVAAGAMTFKDAVYTVRKRGEFMNEA 123

Query: 127 VPPGLGSMVAIIGLDDCVVDSICAQASRVG-ICEIANDNGGGQVVISGLQDAVKCAADTC 185
           VP G G+M AI+G+D   +  +  Q +  G + ++AN N  GQ+VISG    V+ A++  
Sbjct: 124 VPAGEGAMAAILGMDAESLKKVTDQVTENGHLVQLANLNCPGQIVISGTAKGVELASEEA 183

Query: 186 LNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSIDEI 245
            N GAKRA+ L VS PFHS LM P ++ ++ +L +   ++  VP++ N  A  ++  D+I
Sbjct: 184 KNNGAKRAIPLEVSGPFHSELMKPAAQKLEEVLSACELKNAAVPVISNVSADVMTEKDDI 243

Query: 246 SRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVEDI 305
            + L+EQ+   VR+ ETI    + GV +  E+G GKVL+GL K++++ L  +++S  E I
Sbjct: 244 KKKLIEQLYSPVRFEETINKLIDEGVTTFVEIGPGKVLSGLVKKVNRRLKTIAVSDHETI 303

Query: 306 DLALRSI 312
           +LA++++
Sbjct: 304 ELAIQTL 310


>gi|269959146|ref|YP_003328935.1| malonyl CoA-acyl carrier protein transacylase [Anaplasma centrale
           str. Israel]
 gi|269848977|gb|ACZ49621.1| malonyl CoA-acyl carrier protein transacylase [Anaplasma centrale
           str. Israel]
          Length = 325

 Score =  254 bits (649), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 137/306 (44%), Positives = 184/306 (60%), Gaps = 1/306 (0%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           MS V  FPGQGSQ +GMGR++YDS P AR VF EVD TL + LS +++ G +E LT+TCN
Sbjct: 1   MSVVFMFPGQGSQFVGMGREVYDSSPAARRVFHEVDETLGRYLSRIIFQGPEEALTSTCN 60

Query: 61  AQPALTAVSMAFIRVMEKN-GLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRAR 119
           AQ AL  VS+A +R +E+N G  +   + YV GHS+GEYTAL  +K   L    RL+  R
Sbjct: 61  AQLALMTVSVALVRALEENLGGPITDAVKYVLGHSVGEYTALHVSKVIGLPGIARLLDVR 120

Query: 120 GKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVK 179
           GK+M  A     G M A+IG     V+++ A+AS  GICE+ANDN  GQVV+SG ++A++
Sbjct: 121 GKAMHRASALCCGGMAALIGGSLSEVEAVAARASEYGICEVANDNCTGQVVVSGTENALQ 180

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
                    G K+ + L VS PFHSSLM      +   +D +    P V ++ N  AS  
Sbjct: 181 QLPKLIEGTGIKKVIKLRVSGPFHSSLMRLACNEIGDFVDQLEMNPPEVEMVFNVSASTH 240

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
           S  + I  L+V QV  RVRWRE+I++    G     EVG G+VL GL KRID S+    +
Sbjct: 241 SDCNAIRDLMVRQVVSRVRWRESIEYLVRCGCSEFVEVGPGQVLVGLLKRIDNSVRGFGV 300

Query: 300 SKVEDI 305
             +E +
Sbjct: 301 DSMESV 306


>gi|294011590|ref|YP_003545050.1| [acyl-carrier-protein] S-malonyltransferase [Sphingobium japonicum
           UT26S]
 gi|292674920|dbj|BAI96438.1| [acyl-carrier-protein] S-malonyltransferase [Sphingobium japonicum
           UT26S]
          Length = 312

 Score =  254 bits (649), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 140/315 (44%), Positives = 199/315 (63%), Gaps = 6/315 (1%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M     FPGQGSQ +GMG+ L D+ P A+ +F+EVD  L+Q+L  +M  G + +LT T N
Sbjct: 1   MMRAFLFPGQGSQSVGMGKALADASPAAKELFQEVDDALSQHLFRIMVEGPESDLTLTEN 60

Query: 61  AQPALTAVSMAFIRVMEKNG---LCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVR 117
           AQPA+ A ++A +RVM++ G   L  K D  YVAGHSLGEY+ALCAA+AF +  T +L++
Sbjct: 61  AQPAIMANALATLRVMQREGGFSLAEKGD--YVAGHSLGEYSALCAAEAFDIGTTAKLLK 118

Query: 118 ARGKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDA 177
            RG++MQ AVP G G+M A++G D     ++   A++  +C +ANDN   QVVISG + A
Sbjct: 119 LRGRAMQAAVPVGEGAMAALLGADIEKAQALAEAAAQGEVCTVANDNDPTQVVISGHRGA 178

Query: 178 VKCAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCAS 237
           ++ A     + G +R V LPVSAPFH  LM P ++ M+  L       P++P+  N  AS
Sbjct: 179 IERAVALVKDHGIRRGVLLPVSAPFHCPLMQPAAEAMEDALGKAAINTPLLPVYANVLAS 238

Query: 238 PVSSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAV 297
            ++  DEI   LVEQVTGRVRWRE++    + GV    E+G GKVL  + KRI    +  
Sbjct: 239 AIADPDEIRLRLVEQVTGRVRWRESVAAMWDAGVNEFVELG-GKVLGPMVKRIAPDATVR 297

Query: 298 SISKVEDIDLALRSI 312
           S+  ++DI+ AL ++
Sbjct: 298 SVVTMDDIEAALGAL 312


>gi|326387154|ref|ZP_08208764.1| [Acyl-carrier-protein] S-malonyltransferase [Novosphingobium
           nitrogenifigens DSM 19370]
 gi|326208335|gb|EGD59142.1| [Acyl-carrier-protein] S-malonyltransferase [Novosphingobium
           nitrogenifigens DSM 19370]
          Length = 311

 Score =  254 bits (649), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 142/309 (45%), Positives = 192/309 (62%), Gaps = 2/309 (0%)

Query: 5   LTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPA 64
             FPGQGSQ +GMG DL  +   AR VFEEVD  L Q LS +M  G +++LT T NAQPA
Sbjct: 4   FVFPGQGSQKVGMGADLAAASAVAREVFEEVDDALGQKLSLIMREGPEDQLTLTENAQPA 63

Query: 65  LTAVSMAFIRVMEKNG-LCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSM 123
           + A ++A +RV+EK G + +     +VAGHSLGEYTALCAA AFSL+DT RL++ RG+SM
Sbjct: 64  IMANAIAVLRVLEKEGGIAIADKADFVAGHSLGEYTALCAAGAFSLADTARLLKLRGQSM 123

Query: 124 QEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAAD 183
           Q AVP G+G+M A++G D     ++   A+   +C +ANDN   QVV+SG + A++ A  
Sbjct: 124 QAAVPVGVGAMAALLGADIAKATALAEAAAEGEVCTVANDNDPTQVVLSGHKGAIERAVA 183

Query: 184 TCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSID 243
              + G KR V LPVSAPFH  LM P ++ M    +    +   V +  N  A+PV+   
Sbjct: 184 MVKDHGIKRGVLLPVSAPFHCPLMEPAAQAMAKAFEKTPPRQLAVTLFANVTAAPVTDPV 243

Query: 244 EISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVE 303
           E++RLLVEQVTGRVRWRE+       GV    E+G GKVL  +  R    +S  S+  + 
Sbjct: 244 EVARLLVEQVTGRVRWRESAIAMQAAGVDQFIELG-GKVLGPMIARTVADVSITSVITMA 302

Query: 304 DIDLALRSI 312
           DI+  L+ +
Sbjct: 303 DIEALLKDL 311


>gi|296331165|ref|ZP_06873639.1| malonyl CoA-acyl carrier protein transacylase [Bacillus subtilis
           subsp. spizizenii ATCC 6633]
 gi|305674321|ref|YP_003865993.1| malonyl CoA:acyl carrier protein transacylase [Bacillus subtilis
           subsp. spizizenii str. W23]
 gi|296151809|gb|EFG92684.1| malonyl CoA-acyl carrier protein transacylase [Bacillus subtilis
           subsp. spizizenii ATCC 6633]
 gi|305412565|gb|ADM37684.1| malonyl CoA:acyl carrier protein transacylase [Bacillus subtilis
           subsp. spizizenii str. W23]
          Length = 317

 Score =  254 bits (648), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 129/307 (42%), Positives = 190/307 (61%), Gaps = 5/307 (1%)

Query: 7   FPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPALT 66
           FPGQGSQ IGMG+DLY+  P A+ +F+E D  L   LS L++ G  +ELT T NAQPAL 
Sbjct: 8   FPGQGSQFIGMGKDLYEQVPAAKRLFDEADEKLETKLSSLIFEGDAKELTLTYNAQPALL 67

Query: 67  AVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQEA 126
             S+A +   +++G+       + AGHSLGEY+AL A+ A S  D +  VR RG+ M EA
Sbjct: 68  TTSIAVLEKFKESGITP----DFTAGHSLGEYSALVASGALSFKDAVYTVRKRGEFMNEA 123

Query: 127 VPPGLGSMVAIIGLDDCVVDSICAQASRVG-ICEIANDNGGGQVVISGLQDAVKCAADTC 185
           VP G G+M AI+G+D   +  +  + +  G + ++AN N  GQ+VISG    V+ A++  
Sbjct: 124 VPAGEGAMAAILGMDAEALKKVTDKVTEEGHLVQLANLNCPGQIVISGTAKGVELASEQA 183

Query: 186 LNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSIDEI 245
              GAKRA+ L VS PFHS LM P ++ +K +LDS   +D  VP++ N  A  ++   EI
Sbjct: 184 KENGAKRAIPLEVSGPFHSELMKPAAEKLKEVLDSCDIKDASVPVISNVSADVMTEKAEI 243

Query: 246 SRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVEDI 305
              L+EQ+   VR+ E+I      GV    E+G GKVL+GL K++++ L  +++S  E I
Sbjct: 244 KEKLIEQLYSPVRFEESINKLIAEGVTIFIEIGPGKVLSGLVKKVNRRLKTIAVSDPETI 303

Query: 306 DLALRSI 312
           +LA++++
Sbjct: 304 ELAIQTL 310


>gi|108762809|ref|YP_632933.1| malonyl CoA-acyl carrier protein transacylase [Myxococcus xanthus
           DK 1622]
 gi|108466689|gb|ABF91874.1| malonyl CoA-acyl carrier protein transacylase [Myxococcus xanthus
           DK 1622]
          Length = 313

 Score =  254 bits (648), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 141/313 (45%), Positives = 183/313 (58%), Gaps = 5/313 (1%)

Query: 1   MSTV-LTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATC 59
           MS V   FPGQGSQ +GMG+DLY+ FPEAR VF+ VD  L + LS L + G  E L  T 
Sbjct: 1   MSKVAFVFPGQGSQAVGMGKDLYEKFPEARAVFDAVDAALGEKLSTLCFEGPDEALKLTA 60

Query: 60  NAQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRAR 119
           N QPA+  VS+A   V  K G       S+VAGHSLGEY+AL AA A  L D +R+VRAR
Sbjct: 61  NTQPAILTVSLAAHAVFAKRGPA----PSFVAGHSLGEYSALVAAGAMDLGDAVRVVRAR 116

Query: 120 GKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVK 179
           G  MQEAVP G+G+M A++GL    V + C  A+   +   AN N   Q VI+G   AV+
Sbjct: 117 GTFMQEAVPAGVGAMAAVLGLVPEKVKAACDAAAEGQVVSPANYNSPEQTVIAGDAAAVE 176

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            A   C   GAKR + LPVSAPFH +LM PV   +  +L  +    P VP++ N  A P 
Sbjct: 177 RAGVKCKEAGAKRVMPLPVSAPFHCALMAPVQPRLAEVLGGIQVSAPSVPVVTNVEARPN 236

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
           +    +  LL+EQV+  VRW E ++     GV  + E+G GKVL GL KRI K +   ++
Sbjct: 237 ADASRVVPLLLEQVSSPVRWIECVEALKAEGVTRIIELGPGKVLVGLVKRITKDIELFNV 296

Query: 300 SKVEDIDLALRSI 312
                +D AL ++
Sbjct: 297 EDSASLDKALAAL 309


>gi|255003912|ref|ZP_05278713.1| malonyl CoA-acyl carrier protein transacylase (fabD) [Anaplasma
           marginale str. Virginia]
          Length = 331

 Score =  254 bits (648), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 136/306 (44%), Positives = 184/306 (60%), Gaps = 1/306 (0%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           +S V  FPGQGSQ +GMGR++YDS P AR VF EVD TL ++LS +++ G +E LT+TCN
Sbjct: 7   VSVVFMFPGQGSQFVGMGREVYDSSPAARRVFHEVDETLGRHLSRIIFQGPEEALTSTCN 66

Query: 61  AQPALTAVSMAFIRVMEKN-GLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRAR 119
           AQ AL  VS+A +R +E+N G  +   + YV GHS+GEYTAL  +K   L    RL+  R
Sbjct: 67  AQLALMTVSVALVRALEENLGGPITDAVKYVLGHSVGEYTALHVSKVIGLPSVARLLDVR 126

Query: 120 GKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVK 179
           GK+M  A     G M A+IG     V+++ A+AS  GICE+ANDN  GQVV+SG + A++
Sbjct: 127 GKAMHRASSLCCGGMAALIGGSLSEVEAVAARASEYGICEVANDNCTGQVVVSGTESALQ 186

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
                    G K+ + L VS PFHSSLM      +   +D +    P V ++ N  AS  
Sbjct: 187 QLPKLIEGTGIKKVIRLRVSGPFHSSLMRLACNEIGDFVDQLEMNPPEVEMVFNVSASTH 246

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
           S  + I  L+V QV  RVRWRE+I++    G     EVG G+VL GL KRID S+    +
Sbjct: 247 SDCNAIRNLMVRQVVSRVRWRESIEYLIGCGCSEFIEVGPGQVLVGLLKRIDNSVRGFGV 306

Query: 300 SKVEDI 305
             +E +
Sbjct: 307 DSMESV 312


>gi|222055702|ref|YP_002538064.1| malonyl CoA-acyl carrier protein transacylase [Geobacter sp.
           FRC-32]
 gi|221564991|gb|ACM20963.1| malonyl CoA-acyl carrier protein transacylase [Geobacter sp.
           FRC-32]
          Length = 311

 Score =  253 bits (646), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 139/309 (44%), Positives = 194/309 (62%), Gaps = 7/309 (2%)

Query: 5   LTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPA 64
             FPGQGSQ  GMG+DL D+F +A LVFEE D  LN  LS L ++G +E+L  T N QPA
Sbjct: 6   FIFPGQGSQFAGMGKDLADNFKKAALVFEEADDALNFKLSRLCFDGPEEDLRLTANTQPA 65

Query: 65  LTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQ 124
           +   S+A +RV+E+    +K D  ++AGHSLGEY+AL AA A   +D +R VRARG  MQ
Sbjct: 66  ILTASIAALRVLEEE-TSLKAD--FMAGHSLGEYSALVAAGAIKFADAVRTVRARGTFMQ 122

Query: 125 EAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAADT 184
           EAVP G+GSM AI+G++  V+  IC++A++  +   AN N  GQ+VI+G   AV  A + 
Sbjct: 123 EAVPVGVGSMAAILGVEPEVLAEICSEAAQGEVVAPANFNSPGQIVIAGNSGAVNRAIEI 182

Query: 185 CLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSIDE 244
              KG ++A+ LPVSAPFH +LM P  + +  +L+ V      VP++ N  AS  S    
Sbjct: 183 AKGKGFRKAMLLPVSAPFHCALMIPAGERLAGVLEPVVVSPLTVPVVTNVEASANSDAGR 242

Query: 245 ISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVED 304
           +  LLV QV+  V+W  ++      GV    E+G GKVL GL KRIDKS   ++ S V+D
Sbjct: 243 VKELLVRQVSAPVKWDASVGAMIAAGVDKFVEIGPGKVLAGLVKRIDKS---IATSNVQD 299

Query: 305 IDLALRSIV 313
            + +LR+++
Sbjct: 300 QE-SLRALI 307


>gi|39996702|ref|NP_952653.1| malonyl CoA-acyl carrier protein transacylase [Geobacter
           sulfurreducens PCA]
 gi|39983583|gb|AAR34976.1| malonyl CoA-acyl carrier protein transacylase [Geobacter
           sulfurreducens PCA]
 gi|298505713|gb|ADI84436.1| malonyl-CoA--acyl carrier protein transacylase [Geobacter
           sulfurreducens KN400]
          Length = 307

 Score =  253 bits (646), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 136/299 (45%), Positives = 185/299 (61%), Gaps = 8/299 (2%)

Query: 7   FPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPALT 66
           FPGQGSQ  GMG+DL D+FP AR VFEE D  L  +LS L + G +E+L  T N QPA+ 
Sbjct: 8   FPGQGSQYAGMGKDLADTFPVARQVFEEADDALGSSLSRLCFEGPEEQLKLTANTQPAIL 67

Query: 67  AVSMAFIRVME-KNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQE 125
             S+A  RV++ + GL       ++AGHSLGEY+AL AA A   +D +R VRARG  MQE
Sbjct: 68  TTSVAAFRVLQAETGLTA----DFLAGHSLGEYSALVAAGALGFADAVRTVRARGTFMQE 123

Query: 126 AVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAADTC 185
           AVP G G+M A++G++  V+  ICA+A++  +   AN N  GQ+VI+G   AV  A +  
Sbjct: 124 AVPVGEGAMAAMLGIEPAVLAEICAEAAQGEVVSPANFNSPGQIVIAGNTGAVNRAIEIA 183

Query: 186 LNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSIDEI 245
             KG ++A+ LPVSAPFHSSLM P  + +  +L +V   D V P++ N  A+P S    +
Sbjct: 184 KAKGFRKAMLLPVSAPFHSSLMVPAGERLAEVLAAVAVGDLVAPVVTNVEATPNSDKGRV 243

Query: 246 SRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVED 304
             LLV QV+  V W  +++   + GV    E+G GKVL+GL KRI+K       + VED
Sbjct: 244 KELLVRQVSAPVLWDASVREMVSLGVTRFVEIGPGKVLSGLVKRIEKE---AGTANVED 299


>gi|294102054|ref|YP_003553912.1| malonyl CoA-acyl carrier protein transacylase [Aminobacterium
           colombiense DSM 12261]
 gi|293617034|gb|ADE57188.1| malonyl CoA-acyl carrier protein transacylase [Aminobacterium
           colombiense DSM 12261]
          Length = 317

 Score =  253 bits (645), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 136/308 (44%), Positives = 188/308 (61%), Gaps = 3/308 (0%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M   L FPGQG+Q +GMG+ LYD+F  AR VF++ DH LN  LS L++ G +E+LT T  
Sbjct: 1   MRYALVFPGQGAQEVGMGKSLYDTFDAARDVFQKADHALNFKLSQLIFEGPEEKLTLTAF 60

Query: 61  AQPALTAVSMAFIRVM-EKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRAR 119
            QPA+   S+A  RV+ E  G+ +K   +++AGHSLGEYTAL AA A SL D +RLV  R
Sbjct: 61  TQPAILTASIAAYRVLTESMGVSLKP--AFLAGHSLGEYTALVAAGALSLEDGVRLVHLR 118

Query: 120 GKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVK 179
           G  MQEAVP G G+M A+IGL+  VV+ +C + +    C+ AN N  GQVVISG    V+
Sbjct: 119 GSLMQEAVPEGKGAMAALIGLEPDVVEEVCRRVAPNKECQAANFNSPGQVVISGETSFVE 178

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            A +    +GA++AV L VSAPFHS+LM PV+  ++   +      P  PI+ N  A PV
Sbjct: 179 KAVEEAKVQGARKAVMLKVSAPFHSNLMVPVADQLQKAFEKCQWNLPHCPIVANVSAQPV 238

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
            ++++I + L  Q    V W +++ + A+  V +  E+G G VL GL KR  K L   S 
Sbjct: 239 FTVEDIQKALFHQTYSPVLWADSVLYMASQEVDTYLELGPGTVLAGLIKRCQKGLKTYSA 298

Query: 300 SKVEDIDL 307
              ED+ +
Sbjct: 299 MNEEDLRI 306


>gi|56416438|ref|YP_153512.1| malonyl CoA-acyl carrier protein transacylase [Anaplasma marginale
           str. St. Maries]
 gi|222474808|ref|YP_002563223.1| malonyl CoA-acyl carrier protein transacylase (fabD) [Anaplasma
           marginale str. Florida]
 gi|56387670|gb|AAV86257.1| malonyl CoA-acyl carrier protein transacylase [Anaplasma marginale
           str. St. Maries]
 gi|222418944|gb|ACM48967.1| malonyl CoA-acyl carrier protein transacylase (fabD) [Anaplasma
           marginale str. Florida]
          Length = 339

 Score =  253 bits (645), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 136/306 (44%), Positives = 184/306 (60%), Gaps = 1/306 (0%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           +S V  FPGQGSQ +GMGR++YDS P AR VF EVD TL ++LS +++ G +E LT+TCN
Sbjct: 15  VSVVFMFPGQGSQFVGMGREVYDSSPAARRVFHEVDETLGRHLSRIIFQGPEEALTSTCN 74

Query: 61  AQPALTAVSMAFIRVMEKN-GLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRAR 119
           AQ AL  VS+A +R +E+N G  +   + YV GHS+GEYTAL  +K   L    RL+  R
Sbjct: 75  AQLALMTVSVALVRALEENLGGPITDAVKYVLGHSVGEYTALHVSKVIGLPSVARLLDVR 134

Query: 120 GKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVK 179
           GK+M  A     G M A+IG     V+++ A+AS  GICE+ANDN  GQVV+SG + A++
Sbjct: 135 GKAMHRASSLCCGGMAALIGGSLSEVEAVAARASEYGICEVANDNCTGQVVVSGTESALQ 194

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
                    G K+ + L VS PFHSSLM      +   +D +    P V ++ N  AS  
Sbjct: 195 QLPKLIEGTGIKKVIRLRVSGPFHSSLMRLACNEIGDFVDQLEMNPPEVEMVFNVSASTH 254

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
           S  + I  L+V QV  RVRWRE+I++    G     EVG G+VL GL KRID S+    +
Sbjct: 255 SDCNAIRNLMVRQVVSRVRWRESIEYLIGCGCSEFIEVGPGQVLVGLLKRIDNSVRGFGV 314

Query: 300 SKVEDI 305
             +E +
Sbjct: 315 DSMESV 320


>gi|99036102|ref|ZP_01315135.1| hypothetical protein Wendoof_01000025 [Wolbachia endosymbiont of
           Drosophila willistoni TSC#14030-0811.24]
          Length = 312

 Score =  253 bits (645), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 132/293 (45%), Positives = 178/293 (60%), Gaps = 3/293 (1%)

Query: 17  MGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPALTAVSMAFIRVM 76
           MG+ LY  F  AR VF EVD  L+  LS L++NG  EELT T NAQPA+ AVS+A +RVM
Sbjct: 1   MGKSLYSEFSVARQVFNEVDSILDGKLSHLIFNGPIEELTITENAQPAIMAVSIAMLRVM 60

Query: 77  EK---NGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQEAVPPGLGS 133
           E      L    ++ YV GHS+GEYTALCAA A +L   I+L++ R ++M EA     G 
Sbjct: 61  EHVFGKSLFTDHNVKYVCGHSVGEYTALCAAGALTLESAIKLLKVRSEAMHEASLKCKGG 120

Query: 134 MVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAADTCLNKGAKRA 193
           MVA++G +   V+ I       GICEIANDNGGGQVVISG ++A++   D   N   ++ 
Sbjct: 121 MVALLGAEINEVEDILKSVQIEGICEIANDNGGGQVVISGTREALEMLPDLFKNSSVRKL 180

Query: 194 VFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSIDEISRLLVEQV 253
           + L VS PFHSSLM P  + +   L  +    P+VP++ N  A   S    I  LL +QV
Sbjct: 181 IKLQVSGPFHSSLMKPADEKVLEFLKGIKITRPIVPLISNVTAKEESDPKVIKTLLAKQV 240

Query: 254 TGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVEDID 306
             RV+WRE + + ++ G+    E+G  KVL+ L KRID+S+S  +I  + DID
Sbjct: 241 VSRVKWREMVLYMSSRGINKFVEIGPNKVLSNLVKRIDQSISTKNIDSIGDID 293


>gi|312879970|ref|ZP_07739770.1| (Acyl-carrier-protein) S-malonyltransferase [Aminomonas paucivorans
           DSM 12260]
 gi|310783261|gb|EFQ23659.1| (Acyl-carrier-protein) S-malonyltransferase [Aminomonas paucivorans
           DSM 12260]
          Length = 315

 Score =  253 bits (645), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 131/305 (42%), Positives = 187/305 (61%), Gaps = 1/305 (0%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M+  L FPGQG+Q +GMGR  YD+ P AR VF+EVD  L  +LS +++ G +EEL  T  
Sbjct: 1   MTYALVFPGQGAQEVGMGRGFYDACPAARRVFDEVDEALGFSLSRVIFQGPEEELRKTAL 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
            QPA+  VS+A +  + +    +  + ++VAGHSLGEYTAL AA   S+ D  RLV  RG
Sbjct: 61  TQPAILTVSIAILEALREE-WNLSLEPAFVAGHSLGEYTALVAAGTLSVQDGARLVHLRG 119

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
             MQ AVP G GSM A++GLD   +  +CA+ S +G+CE+AN N  GQ+V+SG   AV+ 
Sbjct: 120 DRMQHAVPLGEGSMAAVLGLDAEAIREVCAEVSALGVCELANYNAPGQIVLSGQVQAVER 179

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A +    +GA + + L VSAPFH +LM PV++ ++   +      P  P+L N  A+P +
Sbjct: 180 AQELAKERGAAKVIPLKVSAPFHCALMRPVAEELERAFEGALWSPPRWPVLANVDAAPKT 239

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
            +  I + L  Q    V W E ++  A+ GV++  E+G G VL+GLAKR  K    +S+S
Sbjct: 240 DVLSIRKALYAQTYSPVLWAEEVRAMADQGVQAFVEIGPGNVLSGLAKRCVKGTKTLSVS 299

Query: 301 KVEDI 305
           K ED+
Sbjct: 300 KPEDV 304


>gi|284048729|ref|YP_003399068.1| malonyl CoA-acyl carrier protein transacylase [Acidaminococcus
           fermentans DSM 20731]
 gi|283952950|gb|ADB47753.1| malonyl CoA-acyl carrier protein transacylase [Acidaminococcus
           fermentans DSM 20731]
          Length = 315

 Score =  253 bits (645), Expect = 4e-65,   Method: Compositional matrix adjust.
 Identities = 132/307 (42%), Positives = 190/307 (61%), Gaps = 6/307 (1%)

Query: 5   LTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPA 64
             FPGQGSQ +GM ++LYD++   R VF+E D  L  +++DL + G +++L  T N QPA
Sbjct: 6   FVFPGQGSQTVGMMKELYDNYACVREVFKEADEALGFSMTDLCFKGPEDQLRLTYNTQPA 65

Query: 65  LTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQ 124
           +   S+A ++V+ +NG  V  D++  AGHSLGEY+AL  A +   +D +R VR RG+ MQ
Sbjct: 66  ILTCSIAAMKVLNENG--VFPDVA--AGHSLGEYSALVCAGSLKFADAVRTVRKRGQFMQ 121

Query: 125 EAVPPGLGSMVAIIGLDDCVVDSICA--QASRVGICEIANDNGGGQVVISGLQDAVKCAA 182
           EAVP G G+M AII LD   +  ICA  Q  R    +  N N  GQVVI+G  +AVK A 
Sbjct: 122 EAVPVGQGAMAAIIALDTARIREICAEIQERRGEAVQPVNFNCPGQVVIAGATEAVKEAC 181

Query: 183 DTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSI 242
           D     GAKRA+ LPVSAPFHS+LM P +  +K +LD +   D  +P++ N  A P    
Sbjct: 182 DALKAAGAKRAILLPVSAPFHSTLMQPAADRLKEVLDGIEVADAKIPVIANVTARPEQKG 241

Query: 243 DEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKV 302
           DEI ++LV+Q    V W +++++   +GV +  EVG GKVLTG  K+ID+S +  ++  +
Sbjct: 242 DEIRQVLVKQAASPVLWEDSVRYMMENGVDTFIEVGPGKVLTGFVKKIDRSYTGQNVEDL 301

Query: 303 EDIDLAL 309
             ++  L
Sbjct: 302 ASLEKTL 308


>gi|296285054|ref|ZP_06863052.1| malonyl CoA-acyl carrier protein transacylase [Citromicrobium
           bathyomarinum JL354]
          Length = 312

 Score =  252 bits (644), Expect = 4e-65,   Method: Compositional matrix adjust.
 Identities = 142/301 (47%), Positives = 188/301 (62%), Gaps = 2/301 (0%)

Query: 7   FPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPALT 66
           FPGQGSQ +GMG DL ++   AR  F+EVD  LNQ L  LM  G   ELT T NAQPA+ 
Sbjct: 6   FPGQGSQKVGMGADLAEASAAARETFQEVDDALNQKLFTLMREGPDAELTLTSNAQPAIM 65

Query: 67  AVSMAFIRVMEKN-GLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQE 125
           A ++A +RV+EK+ G+ +K     VAGHSLGEYTALCA  AFSL++T +L+R RG +MQ+
Sbjct: 66  ANAIAALRVLEKDFGMKLKDAGDCVAGHSLGEYTALCAVNAFSLTETAKLLRLRGIAMQD 125

Query: 126 AVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAADTC 185
           AVP G+GSM A++G D      +   A+   +CEIANDN   QVV+SG   A+    D  
Sbjct: 126 AVPIGVGSMAALLGSDIETAQKLAEAAAEGQVCEIANDNDPSQVVLSGHAQAIDRVLDMA 185

Query: 186 LNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSIDEI 245
              GAKRA+ + VSAPFH SLM P ++ MK  L++       +P+  N  A+ V+  DE 
Sbjct: 186 KEYGAKRAIKIAVSAPFHCSLMKPAAQRMKLALENTPPSAMDLPLYANVTAAKVADSDEE 245

Query: 246 SRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVEDI 305
             LLV+Q+TGRVRWRE++      GV+   E+G GKVL  +  R DK     S   +ED+
Sbjct: 246 KALLVDQITGRVRWRESVLAMRADGVEQFVELG-GKVLGPMVGRTDKDAKVTSAITMEDL 304

Query: 306 D 306
           +
Sbjct: 305 E 305


>gi|57239473|ref|YP_180609.1| malonyl CoA-acyl carrier protein transacylase [Ehrlichia
           ruminantium str. Welgevonden]
 gi|58579451|ref|YP_197663.1| malonyl CoA-acyl carrier protein transacylase [Ehrlichia
           ruminantium str. Welgevonden]
 gi|58617505|ref|YP_196704.1| malonyl CoA-acyl carrier protein transacylase [Ehrlichia
           ruminantium str. Gardel]
 gi|57161552|emb|CAH58479.1| putative malonyl CoA-acyl carrier protein transacylase [Ehrlichia
           ruminantium str. Welgevonden]
 gi|58417117|emb|CAI28230.1| Malonyl CoA-acyl carrier protein transacylase [Ehrlichia
           ruminantium str. Gardel]
 gi|58418077|emb|CAI27281.1| Malonyl CoA-acyl carrier protein transacylase [Ehrlichia
           ruminantium str. Welgevonden]
          Length = 320

 Score =  252 bits (643), Expect = 6e-65,   Method: Compositional matrix adjust.
 Identities = 135/314 (42%), Positives = 193/314 (61%), Gaps = 7/314 (2%)

Query: 4   VLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQP 63
           +L FPGQGSQ + MG+++YD+F  AR VF EVD  LN+ LS +M+ GS EELT+T NAQ 
Sbjct: 2   ILMFPGQGSQFVSMGKNIYDNFAVARYVFHEVDDILNKKLSKIMFEGSIEELTSTDNAQL 61

Query: 64  ALTAVSMAFIRVMEK---NGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
           AL   S+A +R +E      L + R I Y+AGHSLGE  ALCA+ A +L +  +L+  R 
Sbjct: 62  ALMVASIATLRAIEYVLGTPLHLFRQIKYMAGHSLGECVALCASGALTLFEVTQLLLVRS 121

Query: 121 KSMQEAVPPGLGSMVAIIG--LDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAV 178
           ++M +AVP G G M A++G  L+D  V+ + A A   GICEIANDN  GQVV+SG+ + +
Sbjct: 122 QAMYDAVPLGYGGMYALVGGTLED--VEKVVAAAQEYGICEIANDNCEGQVVVSGVNEVL 179

Query: 179 KCAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASP 238
           +   D       K+A+ L VS PFHSSLM+     ++  ++ +  + P+V I+ N  A  
Sbjct: 180 QQLPDLIKGTNIKKAIKLQVSGPFHSSLMSSACDKLQQFVEGIEIKMPLVDIVSNVSARE 239

Query: 239 VSSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVS 298
            +    I  L+ +QV  +VRWRE+I +    G  +  EVG G VL+ L KRI   ++ VS
Sbjct: 240 YTDCLMIKNLIAKQVISKVRWRESILYMIKQGCTNFVEVGPGTVLSSLMKRIHTGVTTVS 299

Query: 299 ISKVEDIDLALRSI 312
           I+  + IDL +R +
Sbjct: 300 INTADSIDLLMRHL 313


>gi|167037700|ref|YP_001665278.1| malonyl CoA-acyl carrier protein transacylase [Thermoanaerobacter
           pseudethanolicus ATCC 33223]
 gi|320116115|ref|YP_004186274.1| malonyl CoA-acyl carrier protein transacylase [Thermoanaerobacter
           brockii subsp. finnii Ako-1]
 gi|166856534|gb|ABY94942.1| malonyl CoA-acyl carrier protein transacylase [Thermoanaerobacter
           pseudethanolicus ATCC 33223]
 gi|319929206|gb|ADV79891.1| malonyl CoA-acyl carrier protein transacylase [Thermoanaerobacter
           brockii subsp. finnii Ako-1]
          Length = 309

 Score =  251 bits (641), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 128/305 (41%), Positives = 193/305 (63%), Gaps = 5/305 (1%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M     +PGQG+Q  GMG+++Y  + EAR +FE  D  L  ++S+L + G +EEL  T N
Sbjct: 1   MKVAFIYPGQGAQYAGMGKEIYQKYQEAREIFERADEALGFSISELCFEGPEEELMKTEN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
            QPA+  VS+A  +V++K G  +K +++  AG SLGEY++L  A+A    D +RLV+ RG
Sbjct: 61  TQPAILTVSVALTKVLQKRG--IKAEVT--AGLSLGEYSSLVLAEALDFEDAVRLVKNRG 116

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           K MQE VP G+G+M AI+GL++ VV+ IC   S+VGI E AN N  GQ+VISG   AV+ 
Sbjct: 117 KYMQEVVPQGVGTMAAILGLENEVVEEICRTVSQVGIVEPANYNCPGQLVISGEVKAVEK 176

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A +    KGAKRAV L VSAPFH S++    ++++  L+ +  +D  +P++ N  A   +
Sbjct: 177 AVELAKEKGAKRAVVLAVSAPFHCSMLKKAGELLERDLEKIEIKDLKIPVVSNVTAD-YA 235

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
           S D++  LL++QV+  V W ++++     GV +  E+G GK LTG  K+IDK+ +A +  
Sbjct: 236 SKDQVKDLLIKQVSHPVLWEQSVKRMIEDGVDTFVEIGPGKTLTGFVKKIDKTKNAYNFE 295

Query: 301 KVEDI 305
             E +
Sbjct: 296 DEESL 300


>gi|134299919|ref|YP_001113415.1| malonyl CoA-acyl carrier protein transacylase [Desulfotomaculum
           reducens MI-1]
 gi|134052619|gb|ABO50590.1| [Acyl-carrier-protein] S-malonyltransferase [Desulfotomaculum
           reducens MI-1]
          Length = 314

 Score =  251 bits (641), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 135/312 (43%), Positives = 194/312 (62%), Gaps = 5/312 (1%)

Query: 5   LTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPA 64
             FPGQGSQ +GMGR+LY++F   R   EE D +L   L+ L + G  EEL +T N QPA
Sbjct: 6   FVFPGQGSQYVGMGRELYNNFQVVRETMEEADDSLGFGLTKLCFEGPVEELNSTVNTQPA 65

Query: 65  LTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQ 124
           L AVS+A +RV+++    +    S +AGHSLGEY+AL AA +   SD +++VR RG  MQ
Sbjct: 66  LLAVSVAALRVLQQECGILP---SVLAGHSLGEYSALVAAGSVHFSDAVKVVRQRGLFMQ 122

Query: 125 EAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAADT 184
           EA P G G M A++GL    V + C +AS  G+ E  N N  GQVVI+G Q+A++ A + 
Sbjct: 123 EAAPVGSGGMAAVLGLAREKVVACCLEASSHGVVEPVNFNCPGQVVIAGEQEALQQAMEL 182

Query: 185 CLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSIDE 244
           C   GAKRA+ L VS PFHSSLM P  + +  +L+ +   DP +P++ N  A  V ++ E
Sbjct: 183 CRAAGAKRAIALAVSGPFHSSLMRPAGERLAPILEEIEICDPAIPVIANVSADYVRTVQE 242

Query: 245 ISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVED 304
           + + L +QV+G V W ++IQ  A  G+ ++ E+G GKVL GL K+I K ++  ++  +  
Sbjct: 243 VKQSLAKQVSGAVLWEDSIQRMATEGINTLVELGPGKVLCGLVKKISKEITTSNLEDLAS 302

Query: 305 ID--LALRSIVG 314
           ++  LAL   VG
Sbjct: 303 LEKVLALFKEVG 314


>gi|157826192|ref|YP_001493912.1| acyl-carrier-protein S-malonyltransferase [Rickettsia akari str.
           Hartford]
 gi|157800150|gb|ABV75404.1| acyl-carrier-protein S-malonyltransferase [Rickettsia akari str.
           Hartford]
          Length = 314

 Score =  251 bits (641), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 130/313 (41%), Positives = 189/313 (60%), Gaps = 2/313 (0%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M T   FPGQG+Q+IGMG+D YD+F  A+  F+ V+  LN+ L+++++NG   ELT T N
Sbjct: 1   MKTAFIFPGQGAQLIGMGKDFYDNFKPAKETFQVVNEVLNRKLTNIIFNGPSAELTLTTN 60

Query: 61  AQPALTAVSMAFIRVME-KNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRAR 119
           AQPAL AVSMA I +++ + G  +     Y AGHSLGEY+ALC+ ++ SL    +L+  R
Sbjct: 61  AQPALMAVSMAIINIIKAETGKNLDSFCDYAAGHSLGEYSALCSTESISLETAAKLLHIR 120

Query: 120 GKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVK 179
             SMQEA P G GSM A I +    ++ I    +++ +C+IANDN  GQ+VISG   A+ 
Sbjct: 121 STSMQEACPEGEGSMAACINIPLQKLEEILEDINKINVCQIANDNIKGQIVISGKTTAID 180

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            A     + G K A+ L VSAPFH SLM P  + M+  LD      P++PI+ N  A   
Sbjct: 181 HAISIIKDLGYK-AIKLKVSAPFHCSLMKPAEEKMRVALDKSVINKPIIPIIQNCTAKLT 239

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
               EI + L+ Q+  RVRWRET++ F    V  + E+G+G VLT + ++I+      +I
Sbjct: 240 LDPTEIKQNLILQICRRVRWRETLKLFNQLDVTHIVEIGAGNVLTNMLRKINYPYKLSNI 299

Query: 300 SKVEDIDLALRSI 312
           S +E++   L ++
Sbjct: 300 SNLEELQNFLENV 312


>gi|307264832|ref|ZP_07546394.1| malonyl CoA-acyl carrier protein transacylase [Thermoanaerobacter
           wiegelii Rt8.B1]
 gi|306920090|gb|EFN50302.1| malonyl CoA-acyl carrier protein transacylase [Thermoanaerobacter
           wiegelii Rt8.B1]
          Length = 309

 Score =  251 bits (640), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 127/305 (41%), Positives = 190/305 (62%), Gaps = 5/305 (1%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M     +PGQG+Q  GMG+++Y  + EAR +FE  D  L  ++S+L + G +EEL  T N
Sbjct: 1   MKVAFIYPGQGAQYAGMGKEIYQKYQEAREIFERADEALGFSISELCFEGPEEELMKTEN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
            QPA+  VS+A  +V++K G+    +    AG SLGEY++L  A+A    D +RLV+ RG
Sbjct: 61  TQPAILTVSVALTKVLQKRGI----NAEVTAGLSLGEYSSLVLAEALDFEDAVRLVKNRG 116

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           K MQE VP G+G+M AI+GL++ VV+ IC   S+VGI E AN N  GQ+VISG   AV+ 
Sbjct: 117 KYMQEVVPQGVGTMAAILGLENEVVEEICRTVSQVGIVEPANYNCPGQLVISGEVKAVEK 176

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A +    KGAKRAV L VSAPFH S++    ++++  L+ +  +D  +P++ N  A   +
Sbjct: 177 AVELAKEKGAKRAVVLAVSAPFHCSMLKKAGELLERDLEKIEIKDLKIPVVSNVTAD-YA 235

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
           S D++  LL++QV+  V W ++++     GV +  E+G GK LTG  K+IDK+ +A +  
Sbjct: 236 SKDQVKDLLIKQVSHPVLWEQSVKRMIEDGVDTFVEIGPGKTLTGFVKKIDKTKNAYNFE 295

Query: 301 KVEDI 305
             E +
Sbjct: 296 DEESL 300


>gi|239826582|ref|YP_002949206.1| malonyl CoA-acyl carrier protein transacylase [Geobacillus sp.
           WCH70]
 gi|239806875|gb|ACS23940.1| malonyl CoA-acyl carrier protein transacylase [Geobacillus sp.
           WCH70]
          Length = 313

 Score =  251 bits (640), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 127/309 (41%), Positives = 194/309 (62%), Gaps = 5/309 (1%)

Query: 7   FPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPALT 66
           FPGQGSQ +GMG+D+  S      VF+  D  L  +LS L++ G QE LT T NAQPAL 
Sbjct: 8   FPGQGSQTVGMGKDVAQSDANIAAVFQSADERLGFSLSSLIFEGPQETLTLTYNAQPALL 67

Query: 67  AVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQEA 126
             S+A +  +++ G+       YVAGHSLGEYTAL AA A S +D +  VR RG+ M+EA
Sbjct: 68  TTSIALLEKVKEAGITA----DYVAGHSLGEYTALVAAGAISFTDAVYAVRKRGEFMEEA 123

Query: 127 VPPGLGSMVAIIGLDDCVVDSICAQASRVG-ICEIANDNGGGQVVISGLQDAVKCAADTC 185
           VP G G+M A++G+D   ++++  + S  G   ++AN N  GQ+VISG +  V+ A    
Sbjct: 124 VPAGEGTMAAVLGMDAAALEAVTKEVSEQGDPVQLANLNCPGQIVISGSKAGVEKAGQLA 183

Query: 186 LNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSIDEI 245
             +GAKR + L VS PFHSSLM P +  ++ +L+++  +D  +P++ N  A PV   +EI
Sbjct: 184 KERGAKRVIPLEVSGPFHSSLMKPAASKLQDVLNTIAIRDAEIPVISNVTAQPVVKKEEI 243

Query: 246 SRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVEDI 305
            RLL+EQ+   VRW ++++     GV +  E+G GKVL+GL K+I++++S  +++ +E +
Sbjct: 244 LRLLIEQLYSPVRWEQSVEMMIGLGVDTFIEIGPGKVLSGLVKKINRNVSVYAVNDLESL 303

Query: 306 DLALRSIVG 314
              + ++ G
Sbjct: 304 QATVAALKG 312


>gi|253573482|ref|ZP_04850825.1| malonyl CoA-acyl carrier protein transacylase [Paenibacillus sp.
           oral taxon 786 str. D14]
 gi|251847010|gb|EES75015.1| malonyl CoA-acyl carrier protein transacylase [Paenibacillus sp.
           oral taxon 786 str. D14]
          Length = 312

 Score =  250 bits (639), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 130/305 (42%), Positives = 182/305 (59%), Gaps = 5/305 (1%)

Query: 3   TVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQ 62
           T   FPGQGSQ +GMG+D+YD+ PEAR  FE  D  L+  L+DL++ G   EL  T N Q
Sbjct: 4   TAFVFPGQGSQSVGMGKDIYDALPEARARFEAADEQLDFKLTDLIFGGPDTELKQTANTQ 63

Query: 63  PALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKS 122
           PAL   S+A        G        YVAGHSLGEY+AL AA   +  D ++LVRARG+ 
Sbjct: 64  PALLTTSVALYEAFAAKGF----QPDYVAGHSLGEYSALTAAGVLNFEDAVKLVRARGEY 119

Query: 123 MQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVG-ICEIANDNGGGQVVISGLQDAVKCA 181
           M++AVP G G+M A++G +   +  +CA  +  G + E+AN N  GQ+V+SG ++ V   
Sbjct: 120 MEQAVPGGQGAMAAVLGGERDALAKLCADITAGGALVELANVNCPGQIVVSGSREGVDLV 179

Query: 182 ADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSS 241
            +     GAKRA+ L VS PFHSSLM   ++ +   L + +  D  VP++ N  A PV S
Sbjct: 180 IERVKEIGAKRAIPLEVSGPFHSSLMKTAAERLGERLAAASFSDAKVPVVANVTARPVQS 239

Query: 242 IDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISK 301
             EI+ LLV QV   V W +++ W  + GV +  E+G G VLTGL K+IDKS    ++S 
Sbjct: 240 GAEIAELLVRQVYSPVLWEDSVSWLLSQGVDTFVEIGPGSVLTGLIKKIDKSARLFNVSG 299

Query: 302 VEDID 306
           ++ ++
Sbjct: 300 LDSLE 304


>gi|317121785|ref|YP_004101788.1| (acyl-carrier-protein) S-malonyltransferase [Thermaerobacter
           marianensis DSM 12885]
 gi|315591765|gb|ADU51061.1| (Acyl-carrier-protein) S-malonyltransferase [Thermaerobacter
           marianensis DSM 12885]
          Length = 317

 Score =  250 bits (638), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 137/310 (44%), Positives = 190/310 (61%), Gaps = 7/310 (2%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
            T + FPGQG+Q +GMGRDLY+ FPEAR VFE+       +++ L + G +E+L  T   
Sbjct: 3   KTAVVFPGQGAQYVGMGRDLYEQFPEARQVFEQASEAAGFDVARLCFEGPEEQLQLTEFQ 62

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPAL AV +A  RV+E  GL      +  AG SLGEY AL AA    L D  R+VR RGK
Sbjct: 63  QPALLAVGVACWRVLEARGLVP----ALAAGLSLGEYGALVAAGVLDLGDAARVVRLRGK 118

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQASR--VGICEIANDNGGGQVVISGLQDAVK 179
            MQEAVPPG G+M A++GL+  VV+ +C Q      G+ E AN N  GQ+V++G + AV+
Sbjct: 119 FMQEAVPPGEGAMAALLGLEAGVVEDLCRQVMEGGTGVVEPANYNCPGQIVVAGHRAAVE 178

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            A +     GA+++V LPVSAPFH  LM P ++ +  +L  V  +   VP++ N  A PV
Sbjct: 179 AAVERAREAGARKSVLLPVSAPFHCRLMEPAARRLAEVLAEVPMRPARVPVVANVTAEPV 238

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
           +  + I  LL++QV   VRW ++++     G+  + E+G GK LTG A+RID++L AV  
Sbjct: 239 TDPERIRELLIQQVHHPVRWEQSVRRMQQEGITRLVEMGPGKTLTGFARRIDRALEAVPA 298

Query: 300 SKVEDIDLAL 309
              E+I LAL
Sbjct: 299 GTAEEI-LAL 307


>gi|20807920|ref|NP_623091.1| acyl-carrier-protein S-malonyltransferase [Thermoanaerobacter
           tengcongensis MB4]
 gi|20516488|gb|AAM24695.1| (acyl-carrier-protein) S-malonyltransferase [Thermoanaerobacter
           tengcongensis MB4]
          Length = 309

 Score =  249 bits (637), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 130/312 (41%), Positives = 193/312 (61%), Gaps = 5/312 (1%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M     +PGQG+Q  GMG+++Y+ + EA+ +FE  D  L  N+S L + G +EEL  T N
Sbjct: 1   MKIAFIYPGQGAQYAGMGKEIYEKYEEAKEIFERADEALGFNISKLCFEGPEEELMKTEN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
            QPA+  VS+A  RV++K G  VK D++  AG SLGEY++L  A+A    D +RLV+ RG
Sbjct: 61  TQPAILTVSVALTRVLQKRG--VKPDVT--AGLSLGEYSSLVLAEALDFEDAVRLVKKRG 116

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           K MQE VP G+G+M AI+GL +  V+ IC  AS VG+ E AN N  GQ+V+SG   AV+ 
Sbjct: 117 KYMQEVVPEGVGTMAAILGLPNEEVEEICRIASEVGVVEPANYNCPGQLVVSGEVKAVER 176

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A +    +GAK+AV L VSAPFH S++    +++   LD V  +D  VP++ N  A  V 
Sbjct: 177 AVELAKERGAKKAVVLAVSAPFHCSMLKEAGELLAKELDKVEIKDLKVPVISNVTADYVQ 236

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
             D++  LL++QV+  V W ++++     GV +  E+G GK L+G  K+ID+S + ++  
Sbjct: 237 K-DKVKELLIKQVSHPVLWEQSVRKMIEDGVDTFIEIGPGKTLSGFVKKIDRSRTVLNFE 295

Query: 301 KVEDIDLALRSI 312
             E +  AL ++
Sbjct: 296 DEESLMKALSAL 307


>gi|167040361|ref|YP_001663346.1| malonyl CoA-acyl carrier protein transacylase [Thermoanaerobacter
           sp. X514]
 gi|300914445|ref|ZP_07131761.1| malonyl CoA-acyl carrier protein transacylase [Thermoanaerobacter
           sp. X561]
 gi|307724319|ref|YP_003904070.1| malonyl CoA-acyl carrier protein transacylase [Thermoanaerobacter
           sp. X513]
 gi|166854601|gb|ABY93010.1| malonyl CoA-acyl carrier protein transacylase [Thermoanaerobacter
           sp. X514]
 gi|300889380|gb|EFK84526.1| malonyl CoA-acyl carrier protein transacylase [Thermoanaerobacter
           sp. X561]
 gi|307581380|gb|ADN54779.1| malonyl CoA-acyl carrier protein transacylase [Thermoanaerobacter
           sp. X513]
          Length = 309

 Score =  249 bits (636), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 128/314 (40%), Positives = 197/314 (62%), Gaps = 5/314 (1%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M     +PGQG+Q  GMG+++Y  + EAR +FE  D  L  ++S L + G +EEL  T N
Sbjct: 1   MKVAFIYPGQGAQYAGMGKEIYQKYQEAREIFERADEALGFSISKLCFEGPEEELMKTEN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
            QPA+  VS+A  +V++K G  +K +++  AG SLGEY++L  A+A    D +RLV+ RG
Sbjct: 61  TQPAILTVSVALTKVLQKRG--IKAEVT--AGLSLGEYSSLVLAEALDFEDAVRLVKNRG 116

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           K MQE VP G+G+M AI+GL++  V+ IC  AS+VGI E AN N  GQ+VISG   AV+ 
Sbjct: 117 KYMQEVVPQGVGTMAAILGLENEAVEEICRIASQVGIVEPANYNCPGQLVISGEVKAVEK 176

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A +    KGAKRAV L VSAPFH S++    ++++  L+ +  ++  +P++ N  A+ V+
Sbjct: 177 AVELAKEKGAKRAVVLAVSAPFHCSMLKKAGELLEKDLEKIEIKELKIPVISNVTANYVT 236

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
             +E+  LL++QV+  V W ++++     GV +  E+G GK LTG  K+ID++ +A +  
Sbjct: 237 R-EEVKDLLIKQVSHPVLWEQSVKRMIEDGVDTFVEIGPGKTLTGFVKKIDRTKAAYNFE 295

Query: 301 KVEDIDLALRSIVG 314
             E +   L ++ G
Sbjct: 296 DEESLLKTLSALEG 309


>gi|322382552|ref|ZP_08056432.1| malonyl CoA:acyl carrier protein transacylase-like protein
           [Paenibacillus larvae subsp. larvae B-3650]
 gi|321153468|gb|EFX45873.1| malonyl CoA:acyl carrier protein transacylase-like protein
           [Paenibacillus larvae subsp. larvae B-3650]
          Length = 311

 Score =  249 bits (635), Expect = 5e-64,   Method: Compositional matrix adjust.
 Identities = 127/303 (41%), Positives = 192/303 (63%), Gaps = 6/303 (1%)

Query: 5   LTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPA 64
             FPGQG+Q +GM RD+YD    A+ + ++ D  L  +L+D+M+NG +E+L  T + QPA
Sbjct: 6   FIFPGQGAQSVGMARDIYDHHAGAKALLDQADEALGYSLTDIMFNGPEEKLKLTIHTQPA 65

Query: 65  LTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQ 124
           L A S+A +    + G  +K D  +VAGHSLGEY+AL AA      D +R VRARG+ M 
Sbjct: 66  LLAASIACLEAFREKG--IKPD--FVAGHSLGEYSALVAAGVLPFEDAVRTVRARGEFMD 121

Query: 125 EAVPPGLGSMVAIIGLDDCVVDSICAQASR-VGICEIANDNGGGQVVISGLQDAVKCAAD 183
           +AVP GLG+M A++G +   +  +CA  SR V   E+AN N  GQ+V+SG ++ V+  A+
Sbjct: 122 QAVPAGLGAMAAVLGAERQSLSELCATISRDVSPVELANVNCPGQIVVSGGKEGVQAIAE 181

Query: 184 TC-LNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSI 242
                 GAKR + L VS PFHSSLM P S+ ++ +L SV  Q+  + ++ N  A PV + 
Sbjct: 182 RAKAEAGAKRVIPLEVSGPFHSSLMQPASEKLEGVLSSVKMQEAAIQVIANVHAEPVRNP 241

Query: 243 DEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKV 302
           DEI +LLV+QV   V W +++++    GV +  E+G+G VL+GL K+ D+++  +S++ +
Sbjct: 242 DEIRKLLVKQVYSAVLWEDSVRYLIGQGVDTFIELGAGSVLSGLVKKTDRTVKTISLNNL 301

Query: 303 EDI 305
           E I
Sbjct: 302 EAI 304


>gi|311068111|ref|YP_003973034.1| malonyl CoA-acyl carrier protein transacylase [Bacillus atrophaeus
           1942]
 gi|310868628|gb|ADP32103.1| malonyl CoA-acyl carrier protein transacylase [Bacillus atrophaeus
           1942]
          Length = 318

 Score =  248 bits (634), Expect = 6e-64,   Method: Compositional matrix adjust.
 Identities = 130/314 (41%), Positives = 192/314 (61%), Gaps = 6/314 (1%)

Query: 1   MSTV-LTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATC 59
           MS V   FPGQGSQ IGMG++LY+    ++ +F+E D  L   LS L++ G  EELT T 
Sbjct: 1   MSKVAFLFPGQGSQFIGMGKELYERESVSKRIFDEADEALETKLSSLIFEGDAEELTLTY 60

Query: 60  NAQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRAR 119
           NAQPAL   S+A +   ++ G+       + AGHSLGEY+AL AA A S  D +  VR R
Sbjct: 61  NAQPALLTTSIAILEKFKEAGITP----DFTAGHSLGEYSALVAAGAISFKDAVYAVRKR 116

Query: 120 GKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVG-ICEIANDNGGGQVVISGLQDAV 178
           G+ M EAVP G G+M AI+G+D   +  +  + +  G + ++AN N  GQ+VISG    V
Sbjct: 117 GEFMNEAVPAGEGAMAAILGMDAEALQQVTDKVTEEGNLVQLANLNCPGQIVISGTAKGV 176

Query: 179 KCAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASP 238
           + A++     GAKRA+ L VS PFHS LM P ++ +  +LD+   +D  VP++ N  A  
Sbjct: 177 ELASEQAKENGAKRAIPLEVSGPFHSELMKPAAEKLAEVLDACELKDTNVPVISNVSADV 236

Query: 239 VSSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVS 298
           ++  ++I   L+EQ+   VR+ ETI    + GV    E+G GKVL+GL K++++ L  ++
Sbjct: 237 MTEKEDIKAKLIEQLYSPVRFEETINKLIDEGVTVFIEIGPGKVLSGLVKKVNRRLKTIA 296

Query: 299 ISKVEDIDLALRSI 312
           +S  E I+LAL+++
Sbjct: 297 VSDPETIELALQTL 310


>gi|311029992|ref|ZP_07708082.1| malonyl CoA-acyl carrier protein transacylase [Bacillus sp. m3-13]
          Length = 318

 Score =  248 bits (634), Expect = 6e-64,   Method: Compositional matrix adjust.
 Identities = 128/306 (41%), Positives = 191/306 (62%), Gaps = 5/306 (1%)

Query: 5   LTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPA 64
             FPGQGSQ++GM  +L   + E + V ++ D  L   LS LM+ G QEELT T NAQPA
Sbjct: 6   FVFPGQGSQIVGMAHELATEYKEVQAVIDQADEKLGYKLSSLMFEGPQEELTLTYNAQPA 65

Query: 65  LTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQ 124
           L   S+A +++++++G  +K D  Y AGHSLGEY+AL AA A S  D +  V  RGK M+
Sbjct: 66  LLTSSIAILQLLKQSG--IKAD--YTAGHSLGEYSALVAADAISFEDAVYTVHMRGKYME 121

Query: 125 EAVPPGLGSMVAIIGLDDCVVDSICAQAS-RVGICEIANDNGGGQVVISGLQDAVKCAAD 183
           EAVP G+GSM A++GL++ ++   C ++S   G  ++AN N  GQ+VISG    V  A++
Sbjct: 122 EAVPAGVGSMAAVLGLEERLLKEACEESSSEAGPVQLANLNCPGQIVISGSAKGVSLASE 181

Query: 184 TCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSID 243
               KGAKR + L VS PFHSSLM P +  ++  L S++ +D  +P++ N  A+ ++S  
Sbjct: 182 KAKEKGAKRVIPLVVSGPFHSSLMKPAASKLEDTLTSISIKDSKIPVIANVDANEMTSAS 241

Query: 244 EISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVE 303
           EI   LVEQ+   VRW ++++     GV +  EVG GKVL+GL K++++  + + +   E
Sbjct: 242 EIPVKLVEQLYSPVRWEQSVEKLIELGVDTFIEVGPGKVLSGLIKKVNRRATTIPVYDKE 301

Query: 304 DIDLAL 309
            +  A+
Sbjct: 302 TLQKAI 307


>gi|299136310|ref|ZP_07029494.1| malonyl CoA-acyl carrier protein transacylase [Acidobacterium sp.
           MP5ACTX8]
 gi|298602434|gb|EFI58588.1| malonyl CoA-acyl carrier protein transacylase [Acidobacterium sp.
           MP5ACTX8]
          Length = 365

 Score =  248 bits (634), Expect = 7e-64,   Method: Compositional matrix adjust.
 Identities = 143/346 (41%), Positives = 187/346 (54%), Gaps = 41/346 (11%)

Query: 5   LTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPA 64
           L FPGQGSQ +GMGR LYD+FP AR VFEE D  L   LS +++ G +EEL  T + QPA
Sbjct: 16  LLFPGQGSQTVGMGRALYDTFPAARAVFEEADDALGFALSKIIFEGPEEELKRTEHTQPA 75

Query: 65  LTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQ 124
           +  VS+A +RV+E         I++ AGHSLGEY+A  AA  F  +D +R VR RG+ MQ
Sbjct: 76  ILTVSIAALRVLEPELKSRGLSIAFAAGHSLGEYSAHVAAGTFGFADAVRTVRLRGQYMQ 135

Query: 125 EAVPPGLGSMVAIIGLDDCVVDSICAQ--------------------------------- 151
            AVP G G+M AI+GL    ++ ICA+                                 
Sbjct: 136 SAVPAGQGAMAAILGLPVEQINDICARVADDLTQAPPQDPGNPSTQAAAAVDALADPNNP 195

Query: 152 -------ASRV-GICEIANDNGGGQVVISGLQDAVKCAADTCLNKGAKRAVFLPVSAPFH 203
                  ASRV  I   AN N   Q+VISG   AV+ AA+ C   GAKR V L VS PFH
Sbjct: 196 ASTPVEAASRVSAIVAPANINSPDQIVISGTTAAVERAAELCKEAGAKRTVMLSVSGPFH 255

Query: 204 SSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSIDEISRLLVEQVTGRVRWRETI 263
           S+LM P    +   L+S+   DP  PI  N  A  ++   E+   L+ QVTG VRW E I
Sbjct: 256 SALMQPAQDELTSRLESIAFNDPSFPIAANVDARLMTRGSEVRDALIRQVTGAVRWVECI 315

Query: 264 QWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVEDIDLAL 309
           Q     G  +  EVG GKVL+GL ++ID++L+  ++     ++ AL
Sbjct: 316 QLLQQSGATNYIEVGPGKVLSGLNRQIDRALATTNVEDPASLEKAL 361


>gi|326389514|ref|ZP_08211081.1| malonyl CoA-acyl carrier protein transacylase [Thermoanaerobacter
           ethanolicus JW 200]
 gi|325994519|gb|EGD52944.1| malonyl CoA-acyl carrier protein transacylase [Thermoanaerobacter
           ethanolicus JW 200]
          Length = 309

 Score =  248 bits (633), Expect = 8e-64,   Method: Compositional matrix adjust.
 Identities = 126/305 (41%), Positives = 189/305 (61%), Gaps = 5/305 (1%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M     +PGQG+Q  GMG+++Y  + EAR +FE  D  L  ++S+L + G +EEL  T N
Sbjct: 1   MKVAFIYPGQGAQYAGMGKEIYQKYQEAREIFERADEALGFSISELCFEGPEEELMKTEN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
            QPA+  VS+A  +V++K G+    +    AG SLGEY++L  A+A    D +RLV+ RG
Sbjct: 61  TQPAILTVSVALTKVLQKRGI----NAEVTAGLSLGEYSSLVLAEALDFEDAVRLVKNRG 116

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           K MQE VP G+G+M AI+GL++ VV+ IC   S+VG  E AN N  GQ+VISG   AV+ 
Sbjct: 117 KYMQEVVPQGVGTMAAILGLENEVVEEICRTVSQVGKVEPANYNCPGQLVISGEVKAVEK 176

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A +    KGAKRAV L VSAPFH S++    ++++  L+ +  +D  +P++ N  A   +
Sbjct: 177 AVELAKEKGAKRAVVLAVSAPFHCSMLKKAGELLERDLEKIEIKDLKIPVVSNVTAD-YA 235

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
           S D++  LL++QV+  V W ++++     GV +  E+G GK LTG  K+IDK+ +A +  
Sbjct: 236 SKDQVKDLLIKQVSHPVLWEQSVKRMIEDGVDTFVEIGPGKTLTGFVKKIDKTKNAYNFE 295

Query: 301 KVEDI 305
             E +
Sbjct: 296 DEESL 300


>gi|254797279|ref|YP_003082121.1| malonyl CoA-acyl carrier protein transacylase [Neorickettsia
           risticii str. Illinois]
 gi|254590520|gb|ACT69882.1| malonyl CoA-acyl carrier protein transacylase [Neorickettsia
           risticii str. Illinois]
          Length = 311

 Score =  248 bits (632), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 133/312 (42%), Positives = 194/312 (62%), Gaps = 13/312 (4%)

Query: 7   FPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPALT 66
           FPGQGSQ +GMG+ LY++F  AR VF EVD +L  NLS +M+ G +  L+ T N QPAL 
Sbjct: 6   FPGQGSQRVGMGKSLYENFSVAREVFSEVDESLGMNLSKIMFEGPENILSNTENTQPALM 65

Query: 67  AVSMAFIRVM-EKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQE 125
           A SMA ++V+  ++G  V     Y+AGHSLGEYTALCA+ A ++S   R+++ RGKSMQE
Sbjct: 66  ATSMAALKVLLSESGKSVSELSKYLAGHSLGEYTALCASGAITISQVARVLKIRGKSMQE 125

Query: 126 AVPPGLGSMVAIIGL-----DDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           AVP G G M+A++ +      D +V+S  +       CEI+NDN   QVV+SGL   +  
Sbjct: 126 AVPMGEGGMLALLKVTFEEVQDLIVESKVS-------CEISNDNSNEQVVVSGLIPEIDK 178

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
             +     G +R V L VSAPFH  LM      +K  LD+     P VPI+ N  ASPV+
Sbjct: 179 FEEYAKQNGIRRMVRLKVSAPFHCKLMQHAVIPVKDALDNAEIVTPSVPIVSNVTASPVT 238

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
            +  I  LLV+Q+T  VRWRE++ +    GV++  E+G+G VL+ +  R++  ++ +++ 
Sbjct: 239 EVQRIRELLVQQITSCVRWRESMLFSIETGVETFIEIGAGNVLSKMLSRMNPHVTTLNLG 298

Query: 301 KVEDIDLALRSI 312
           +V+D+D  + +I
Sbjct: 299 EVDDLDRIIATI 310


>gi|299821770|ref|ZP_07053658.1| malonyl-CoA-[acyl-carrier-protein] transacylase [Listeria grayi DSM
           20601]
 gi|299817435|gb|EFI84671.1| malonyl-CoA-[acyl-carrier-protein] transacylase [Listeria grayi DSM
           20601]
          Length = 313

 Score =  248 bits (632), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 133/311 (42%), Positives = 191/311 (61%), Gaps = 5/311 (1%)

Query: 5   LTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPA 64
             FPGQGSQ IGMG D+ + +PEA  +FE  D  L  +LS+L+  G  E+LT + NAQPA
Sbjct: 6   FVFPGQGSQKIGMGLDVAEKYPEAAAIFEAADKRLGFSLSELIQEGPIEKLTKSENAQPA 65

Query: 65  LTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQ 124
           L   S A +RV+E +   +K D  YVAGHSLGEY+AL A       D I LV  RG+ M+
Sbjct: 66  LVTNSTAILRVLEAH--AIKAD--YVAGHSLGEYSALVAGGYLKAEDAIYLVNKRGQLME 121

Query: 125 EAVPPGLGSMVAIIGLDDCVVDSICAQASRVGI-CEIANDNGGGQVVISGLQDAVKCAAD 183
            AVP G G+M AI+GLD   + S+  + +  G   ++AN N  GQ+VISG    V+ A++
Sbjct: 122 AAVPNGQGAMAAILGLDRETLTSVTEEVTAGGDDVQLANLNCPGQIVISGSVAGVEKASE 181

Query: 184 TCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSID 243
               KGAKRA+ L VS PFHS+LM P S+    +L  VT QD  +P++ N  A   +S D
Sbjct: 182 LAKEKGAKRAMPLAVSGPFHSTLMKPASEAFVPVLQEVTIQDGAIPVVANSNAEATTSSD 241

Query: 244 EISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVE 303
            +++ L+EQ+   V W +T+++  + GV +  E+G+GKVL GL K+ID+ ++ +S   V 
Sbjct: 242 TVAKNLIEQIYSPVLWEDTVRYLIDQGVDTFVEIGAGKVLAGLIKKIDRGVTVLSAGDVA 301

Query: 304 DIDLALRSIVG 314
            +D  + ++ G
Sbjct: 302 SVDTVIETLKG 312


>gi|323702689|ref|ZP_08114350.1| malonyl CoA-acyl carrier protein transacylase [Desulfotomaculum
           nigrificans DSM 574]
 gi|323532352|gb|EGB22230.1| malonyl CoA-acyl carrier protein transacylase [Desulfotomaculum
           nigrificans DSM 574]
          Length = 314

 Score =  248 bits (632), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 135/301 (44%), Positives = 182/301 (60%), Gaps = 6/301 (1%)

Query: 5   LTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPA 64
             FPGQGSQ +GMG++LY +F   R   EE D  LN  L+ L + G  EEL  T N QPA
Sbjct: 6   FIFPGQGSQYVGMGQELYKNFTVCRQTLEEADDALNFGLTKLCFEGPAEELNKTANTQPA 65

Query: 65  LTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQ 124
           + AVS+A +RV+ +   C  R    VAGHSLGEY+AL AA A   +D IR+VR RG+ MQ
Sbjct: 66  ILAVSIAALRVLTQE--CGLRP-EAVAGHSLGEYSALVAAGAIKFADAIRVVRQRGQFMQ 122

Query: 125 EAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAADT 184
           EA P G G M A++GLD   V + C +A+  G+ E  N N  GQVVI+G + A++ A + 
Sbjct: 123 EAAPIGSGGMAAVLGLDRAKVIACCQEAAASGVIEPVNFNCPGQVVIAGQKGALQRAMEL 182

Query: 185 CLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSIDE 244
           C   GAKR + L VS PFHSSLM P  + +  +L  V  +DP  P++ N  A  V++  E
Sbjct: 183 CRQAGAKRVIELAVSGPFHSSLMRPAGERLAQVLAEVEIKDPQTPVMANVSARYVTNAGE 242

Query: 245 ISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVED 304
           I   L +QV G V W ++I   A  G+ ++ E+G GKVL GL K+I+K    ++   VED
Sbjct: 243 IRDSLAKQVYGAVLWEDSIAKLAQDGIDTMVEIGPGKVLCGLVKKINKD---IATHNVED 299

Query: 305 I 305
           +
Sbjct: 300 L 300


>gi|269792708|ref|YP_003317612.1| malonyl CoA-acyl carrier protein transacylase [Thermanaerovibrio
           acidaminovorans DSM 6589]
 gi|269100343|gb|ACZ19330.1| malonyl CoA-acyl carrier protein transacylase [Thermanaerovibrio
           acidaminovorans DSM 6589]
          Length = 316

 Score =  248 bits (632), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 137/310 (44%), Positives = 193/310 (62%), Gaps = 1/310 (0%)

Query: 5   LTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPA 64
           L FPGQG+Q +GMGRD Y+++P AR VFEE +  L+ +L+ +++ G +EEL  T   QPA
Sbjct: 6   LVFPGQGAQEVGMGRDFYEAYPAARRVFEEANRALDFDLTKVIFEGPEEELKKTAITQPA 65

Query: 65  LTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQ 124
           +  VS+A +    ++   +  +  +VAGHSLGEYTAL AA A S++D +RLV  RG  MQ
Sbjct: 66  ILTVSVAILSAAREDA-GIPLEPMFVAGHSLGEYTALAAAGAISVADAVRLVHLRGSRMQ 124

Query: 125 EAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAADT 184
           +AVP G+G+M A++GL+   +  IC +AS  G+CE+AN N  GQ+VISG   AV+ AA+ 
Sbjct: 125 DAVPLGVGAMAAVMGLEGEAIREICQRASTKGVCEMANYNAPGQIVISGEAPAVEAAAEM 184

Query: 185 CLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSIDE 244
               GA + + L VSAPFH SLM PV+  ++    SV   +   P++ N  A P   + E
Sbjct: 185 LKEAGASKVIPLKVSAPFHCSLMRPVADHLREAFTSVRWGELSCPLVSNVDAKPRRDMGE 244

Query: 245 ISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVED 304
           I   L+EQ    V W ++++  A+ GV +  E G G VLTGLAKR  K   A S+SKV D
Sbjct: 245 IRERLLEQTYSPVLWLDSMRAMADSGVDAFIEFGPGNVLTGLAKRCVKGKRAKSVSKVSD 304

Query: 305 IDLALRSIVG 314
           ++  L  I G
Sbjct: 305 LEGLLDFIKG 314


>gi|320108660|ref|YP_004184250.1| malonyl CoA-acyl carrier protein transacylase [Terriglobus
           saanensis SP1PR4]
 gi|319927181|gb|ADV84256.1| malonyl CoA-acyl carrier protein transacylase [Terriglobus
           saanensis SP1PR4]
          Length = 328

 Score =  248 bits (632), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 132/308 (42%), Positives = 183/308 (59%), Gaps = 6/308 (1%)

Query: 7   FPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPALT 66
           FPGQGSQ +GMG DL D FP A+  F E D  L  +LSDL +NG +E+L  T + QPA+ 
Sbjct: 23  FPGQGSQTVGMGHDLADRFPVAKDTFAEADEALGFSLSDLCFNGPEEQLKQTEHTQPAIL 82

Query: 67  AVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQEA 126
            VS+A  RV+ ++G+      +  AGHSLGEY+A  AA   S +D +R VR+RG+ MQ+A
Sbjct: 83  TVSVAVARVLAEHGISA----AMTAGHSLGEYSAYVAAGTISFADAVRTVRSRGQFMQQA 138

Query: 127 VPPGLGSMVAIIGLDDCVVDSICAQASR--VGICEIANDNGGGQVVISGLQDAVKCAADT 184
           VP G G+M AI+GL    +  +CAQAS     +   AN N   Q VISG   AV+ AA+ 
Sbjct: 139 VPAGQGTMAAILGLSVERISDMCAQASSETSAVVAPANLNSPDQTVISGATAAVERAAEL 198

Query: 185 CLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSIDE 244
           C   GAKRAV LPVSAPFH  LM P +  +   L++V+  DP  P+  N  A  ++   +
Sbjct: 199 CKESGAKRAVMLPVSAPFHCQLMAPAAHQLTTTLEAVSLVDPAFPVASNVDARLITRQGD 258

Query: 245 ISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVED 304
           +   L+ QVTG VRW E I+     G     E G GKVL GL ++ID++ + +++     
Sbjct: 259 VRDTLIRQVTGAVRWVECIELLKTSGATHFIEAGPGKVLCGLMRQIDRTQTCLNVEDSAS 318

Query: 305 IDLALRSI 312
           ++  L ++
Sbjct: 319 LEKTLAAL 326


>gi|148284428|ref|YP_001248518.1| acyl-carrier-protein S-malonyltransferase [Orientia tsutsugamushi
           str. Boryong]
 gi|146739867|emb|CAM79809.1| acyl-carrier-protein S-malonyltransferase [Orientia tsutsugamushi
           str. Boryong]
          Length = 312

 Score =  247 bits (631), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 135/314 (42%), Positives = 189/314 (60%), Gaps = 4/314 (1%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M TV  FPGQG Q +GMG+DLYD+FP AR VF EV+  + + L+D+++NG    LT T N
Sbjct: 1   MYTVFVFPGQGVQFVGMGKDLYDNFPVARDVFHEVNDIIAEKLTDIIFNGPISTLTLTKN 60

Query: 61  AQPALTAVSMAFIRVMEKNGL--CVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRA 118
           AQ A+ AVSMA IRV+E+     C +    YVAGHSLGEY+ALCAA A SL +  ++++ 
Sbjct: 61  AQLAIIAVSMAIIRVLEQQATMECYQMA-DYVAGHSLGEYSALCAAGALSLDEVTKILKV 119

Query: 119 RGKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAV 178
           R  +M        GSM A +G+    ++ I    S +G+CEIANDN  GQVVISG   A+
Sbjct: 120 RANAMHAVASRCDGSMAACLGVTMEELNPILDYCSTIGVCEIANDNILGQVVISGHTTAI 179

Query: 179 KCAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASP 238
             A +    KG KRA+ L VS PFH SLM   + + +  +D V  Q   + ++ N+ A+ 
Sbjct: 180 NLAMNMLRAKG-KRAIKLNVSGPFHCSLMADATSIFRQAIDKVNIQPTKMIVVANYSANI 238

Query: 239 VSSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVS 298
           V++  +I   L+ Q+ G+VRWRET+       V  + E+G GKVL  LAK+   +    S
Sbjct: 239 VTTPIDIKNCLIRQIEGKVRWRETLDLLQQKNVSRLIEIGPGKVLINLAKKGQYTFKCSS 298

Query: 299 ISKVEDIDLALRSI 312
           I+ + +ID  L +I
Sbjct: 299 INSIFEIDAFLNNI 312


>gi|254420563|ref|ZP_05034287.1| malonyl CoA-acyl carrier protein transacylase [Brevundimonas sp.
           BAL3]
 gi|196186740|gb|EDX81716.1| malonyl CoA-acyl carrier protein transacylase [Brevundimonas sp.
           BAL3]
          Length = 320

 Score =  247 bits (630), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 157/322 (48%), Positives = 205/322 (63%), Gaps = 11/322 (3%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M+  L FPGQGSQ +GMG  L D+F  AR VF EVD  L Q LS LM  G +++LT T N
Sbjct: 1   MTLALLFPGQGSQAVGMGAQLADAFASAREVFAEVDEALGQKLSVLMREGPEDQLTLTEN 60

Query: 61  AQPALTAVSMAFIRVME-KNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRAR 119
           AQPAL AVS+A IR ++ + G  V    +YVAGHSLGEY+AL AA A SLSDT RL++ R
Sbjct: 61  AQPALMAVSVAAIRALKVEFGFDVA-TAAYVAGHSLGEYSALAAAGAISLSDTARLLKLR 119

Query: 120 GKSMQEAVPPGLGSMVAIIG--LDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDA 177
           G++MQ AVP G G+M ++IG   D  + ++  A  + +G+C +ANDN  G +VISG + A
Sbjct: 120 GQAMQRAVPVGQGAMASLIGPKTDLALAEAAAAAGAELGVCVVANDNNAGNIVISGEKAA 179

Query: 178 VKCAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCAS 237
           V  A +     GA RA+ L VSAPFH  LM P +  M   L S T   PVVP++ N  A 
Sbjct: 180 VDRAIEKAKELGA-RAIPLNVSAPFHCPLMQPAADEMAAALASATILAPVVPVVANVLAR 238

Query: 238 PVSSIDEISRLLVEQVTGRVRWRETIQWFANH------GVKSVYEVGSGKVLTGLAKRID 291
           P S  + I RLLVEQVTGRVRWRE+++W A        GV    E+GSGKVLTG+AKRI 
Sbjct: 239 PESDPEVIRRLLVEQVTGRVRWRESMEWMATPDSQDGGGVTRFVEIGSGKVLTGMAKRIA 298

Query: 292 KSLSAVSISKVEDIDLALRSIV 313
                + ++  E+++   +++V
Sbjct: 299 PDAECLPLNTPEELEAFAKALV 320


>gi|94497418|ref|ZP_01303988.1| malonyl CoA-acyl carrier protein transacylase [Sphingomonas sp.
           SKA58]
 gi|94423049|gb|EAT08080.1| malonyl CoA-acyl carrier protein transacylase [Sphingomonas sp.
           SKA58]
          Length = 312

 Score =  247 bits (630), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 143/312 (45%), Positives = 197/312 (63%), Gaps = 6/312 (1%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M     FPGQGSQ +GMG+ L D+   A+ +F+EVD  L+Q+L  +M  G   +LT T N
Sbjct: 1   MMRAFLFPGQGSQSVGMGKALADASGAAKELFQEVDEALSQHLFRIMVEGPDSDLTLTEN 60

Query: 61  AQPALTAVSMAFIRVMEKNG---LCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVR 117
           AQPA+ A ++A +RVM+K G   L  K D  YVAGHSLGEY+ALCAA+AF +  T RL++
Sbjct: 61  AQPAIMANAIATLRVMQKEGGFSLADKGD--YVAGHSLGEYSALCAAEAFDIGTTARLLK 118

Query: 118 ARGKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDA 177
            RG++MQ AVP G G+M A++G D     ++   A++  +C +ANDN   QVVISG + A
Sbjct: 119 LRGQAMQAAVPVGEGAMAALLGADIDKAQALADAAAQGEVCTVANDNDPTQVVISGHRGA 178

Query: 178 VKCAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCAS 237
           ++ A     + G KR V LPVSAPFH  LM P ++ M+  L +     P++P+  N  A+
Sbjct: 179 IERAVAMVKDHGIKRGVLLPVSAPFHCPLMQPAAEAMEAALANAAINAPLLPVYANVLAA 238

Query: 238 PVSSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAV 297
           P++  +EI   LVEQVTGRVRWRE++    + GV    EVG GKVL  + KRI    +  
Sbjct: 239 PIADGEEIKARLVEQVTGRVRWRESVAAMWDAGVTDFVEVG-GKVLGPMVKRIAPDATVR 297

Query: 298 SISKVEDIDLAL 309
           SI  ++DI+ AL
Sbjct: 298 SIVTMDDIEGAL 309


>gi|258592187|emb|CBE68496.1| Malonyl CoA-acyl carrier protein transacylase (MCT) [NC10 bacterium
           'Dutch sediment']
          Length = 296

 Score =  247 bits (630), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 130/281 (46%), Positives = 180/281 (64%), Gaps = 4/281 (1%)

Query: 17  MGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPALTAVSMAFIRVM 76
           MG+D +   PEAR++FE+    L  +L  L + G +E+LT T NAQPA+  VSMA +  +
Sbjct: 1   MGQDFWSQIPEARILFEKASEALGIDLGHLCFKGPEEQLTLTANAQPAIMTVSMAAVAAL 60

Query: 77  EKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQEAVPPGLGSMVA 136
           ++ G  +K D  YVAGHSLGEY+AL A+ + +  D IR+VR RG+ MQEAV PG G+M A
Sbjct: 61  QREG--IKPD--YVAGHSLGEYSALVASGSLAFEDAIRIVRKRGEFMQEAVAPGAGAMAA 116

Query: 137 IIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAADTCLNKGAKRAVFL 196
           I+GLD   V +IC +A++ GI E+AN NG GQVVI+G   AV  A +    +GAKRAV L
Sbjct: 117 ILGLDRQSVYAICEEAAQYGIVEVANLNGPGQVVIAGKTGAVDRAVELAKQRGAKRAVRL 176

Query: 197 PVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSIDEISRLLVEQVTGR 256
            VSAPFH SLM P ++ +  +L +    DP VP++ N  A  +++ D ++  LV QVT  
Sbjct: 177 QVSAPFHCSLMEPAAQRLAGVLQATPIADPTVPLVNNADAELLTTRDAVADSLVRQVTRP 236

Query: 257 VRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAV 297
           VRW + ++     GV    E+G GKVLTGL +RI    +A+
Sbjct: 237 VRWEDVVRRLVKEGVTIFLELGPGKVLTGLIRRIAPEATAL 277


>gi|261408037|ref|YP_003244278.1| malonyl CoA-acyl carrier protein transacylase [Paenibacillus sp.
           Y412MC10]
 gi|261284500|gb|ACX66471.1| malonyl CoA-acyl carrier protein transacylase [Paenibacillus sp.
           Y412MC10]
          Length = 310

 Score =  247 bits (630), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 130/312 (41%), Positives = 185/312 (59%), Gaps = 6/312 (1%)

Query: 3   TVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQ 62
           T   FPGQG+Q +GMG+D YD+ P AR +F   D  L   LS +++NG  E+L  T N Q
Sbjct: 4   TAFIFPGQGAQSVGMGKDAYDAVPSARDLFLTADAQLGFPLSSIIFNGPDEDLKQTVNTQ 63

Query: 63  PALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKS 122
           PAL A SMA++  +   G+       YVAGHSLGEY+AL  A   S  + + +VRARG+ 
Sbjct: 64  PALLATSMAYLEAIRGKGIVP----DYVAGHSLGEYSALVCAGVLSFEEAVSIVRARGEY 119

Query: 123 MQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVG-ICEIANDNGGGQVVISGLQDAVKCA 181
           M+ AVP G G+M A++G D   +  +C   S  G + E+AN N  GQ+VISG    V  A
Sbjct: 120 MEAAVPGGQGAMAAVLGADREALAELCKGISAEGHVVELANMNCPGQIVISGSAQGVAAA 179

Query: 182 ADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSS 241
           A+     G KRA+ L VS PFHSSLM   ++ +   L+  +   P VP++ N  A PV  
Sbjct: 180 AERVKEAGGKRAIPLEVSGPFHSSLMKEAAERLAGKLEQASFNAPSVPVVANVTARPVED 239

Query: 242 IDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISK 301
              I  LLVEQV   V W ++++W    GV +  E+G G VL+GL K+IDKS+  ++++ 
Sbjct: 240 AAAIRGLLVEQVYSPVLWHDSVEWMIAQGVDTFVEIGPGSVLSGLIKKIDKSVKVINVNS 299

Query: 302 VEDIDLALRSIV 313
           +E ++ +L ++V
Sbjct: 300 LESVN-SLETVV 310


>gi|15896809|ref|NP_350158.1| acyl-carrier-protein S-malonyltransferase [Clostridium
           acetobutylicum ATCC 824]
 gi|15026671|gb|AAK81498.1|AE007854_5 Malonyl CoA-acyl carrier protein transacylase [Clostridium
           acetobutylicum ATCC 824]
 gi|325510983|gb|ADZ22619.1| acyl-carrier-protein S-malonyltransferase [Clostridium
           acetobutylicum EA 2018]
          Length = 308

 Score =  247 bits (630), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 126/302 (41%), Positives = 187/302 (61%), Gaps = 3/302 (0%)

Query: 5   LTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPA 64
             F GQGSQ +GMG+DLYD++  A+  F++ D  L   +S+L + G  EEL  T N QPA
Sbjct: 6   FVFSGQGSQYVGMGKDLYDNYQSAKETFDKADEVLGFKISELCFEGKDEELNLTENTQPA 65

Query: 65  LTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQ 124
           +   S+A +R +E+    +K D+  VAG SLGEY+A   + +FS  D +RLV+ RG+ MQ
Sbjct: 66  VLITSIAALRALEEEK-GIKPDV--VAGLSLGEYSAHVCSGSFSFEDAVRLVKKRGRYMQ 122

Query: 125 EAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAADT 184
           EAVP G+G+M AIIGL+  VV  ICA+ S+ GI E+AN N  GQ+VI+G   AV+ A   
Sbjct: 123 EAVPKGIGTMAAIIGLEGDVVRGICAEQSKEGIVEVANYNCPGQIVIAGEVKAVESACTK 182

Query: 185 CLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSIDE 244
               GA+R V L VS PFH+S++   ++ ++  L ++  +D  VP++ N     V   D+
Sbjct: 183 LKESGARRTVMLSVSGPFHTSMLKSAAEKLEEELKNINIEDMKVPVITNVTGDYVEDKDQ 242

Query: 245 ISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVED 304
           I  LL +QV   VRW +TI+   + GV +  E+G GK L+   K+I++ ++  +I K ED
Sbjct: 243 IKGLLKKQVMSSVRWEDTIRRMMDDGVDTFIELGPGKTLSSFIKKINRKMTIFNIEKAED 302

Query: 305 ID 306
           ++
Sbjct: 303 LN 304


>gi|150390517|ref|YP_001320566.1| malonyl CoA-acyl carrier protein transacylase [Alkaliphilus
           metalliredigens QYMF]
 gi|149950379|gb|ABR48907.1| malonyl CoA-acyl carrier protein transacylase [Alkaliphilus
           metalliredigens QYMF]
          Length = 314

 Score =  247 bits (630), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 130/307 (42%), Positives = 183/307 (59%), Gaps = 7/307 (2%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
            T   FPGQG+Q +GMG+D  D FP A+ ++EE    L  ++  L  +G +EEL  T N 
Sbjct: 3   KTAFVFPGQGAQYVGMGKDFVDVFPVAKRIYEEASDYLKMDMYRLCSDGPKEELIKTENT 62

Query: 62  QPALTAVSMAFIRVMEKNGL-CVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
           QPA+   S A ++V+E+ G+ C        AG SLGEYT+L  A+  S  D ++LV+ RG
Sbjct: 63  QPAILTTSFAMLKVIEEVGIPC-----HMTAGLSLGEYTSLVKAEVLSFRDAVQLVKKRG 117

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           K MQEAVP G+G+M AI+GLD   +          GI E AN N  GQ+VISG   AV+ 
Sbjct: 118 KYMQEAVPVGVGTMAAILGLDRDTLQKCLVNCQEYGIVETANYNSPGQIVISGEVKAVER 177

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A    +N GAK+AV LPVSAPFHSSL+ P  + ++  L+     DP +P++ N  A  + 
Sbjct: 178 AVKEAMNFGAKKAVILPVSAPFHSSLLIPAGEKLRMDLEGYHFSDPEIPVVTNVKAKILK 237

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSA-VSI 299
           + +E+   LV+QV+  V W ++I    N GV++  E+G GK LTG  KRI K L   V+ 
Sbjct: 238 NKEEVVSSLVQQVSQSVLWEDSIVLMLNEGVETFVEIGPGKALTGFIKRIAKQLGKNVTT 297

Query: 300 SKVEDID 306
            ++ED++
Sbjct: 298 HQIEDVE 304


>gi|256750705|ref|ZP_05491590.1| malonyl CoA-acyl carrier protein transacylase [Thermoanaerobacter
           ethanolicus CCSD1]
 gi|256750288|gb|EEU63307.1| malonyl CoA-acyl carrier protein transacylase [Thermoanaerobacter
           ethanolicus CCSD1]
          Length = 309

 Score =  246 bits (628), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 127/314 (40%), Positives = 196/314 (62%), Gaps = 5/314 (1%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M     +PGQG+Q  GMG+++Y  + EAR +FE  D  L  ++S L + G +EEL  T N
Sbjct: 1   MKVAFIYPGQGAQYAGMGKEIYQKYQEAREIFERADEALGFSISKLCFEGPEEELMKTEN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
            QPA+  VS+A  +V++K G  +K +++  AG SLGEY++L  A+A    D +RLV+ RG
Sbjct: 61  TQPAILTVSVALTKVLQKRG--IKAEVT--AGLSLGEYSSLVLAEALDFEDAVRLVKNRG 116

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           K MQE VP  +G+M AI+GL++  V+ IC  AS+VGI E AN N  GQ+VISG   AV+ 
Sbjct: 117 KYMQEVVPQEVGTMAAILGLENEAVEEICRIASQVGIVEPANYNCPGQLVISGEVKAVEK 176

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A +    KGAKRAV L VSAPFH S++    ++++  L+ +  ++  +P++ N  A+ V+
Sbjct: 177 AVELAKEKGAKRAVVLAVSAPFHCSMLKKAGELLEKDLEKIEIKELKIPVISNVTANYVT 236

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
             +E+  LL++QV+  V W ++++     GV +  E+G GK LTG  K+ID++ +A +  
Sbjct: 237 R-EEVKDLLIKQVSHPVLWEQSVKRMIEDGVDTFVEIGPGKTLTGFVKKIDRTKAAYNFE 295

Query: 301 KVEDIDLALRSIVG 314
             E +   L ++ G
Sbjct: 296 DEESLLKTLSALEG 309


>gi|94499601|ref|ZP_01306138.1| acyl carrier protein S-malonyltransferase [Oceanobacter sp. RED65]
 gi|94428355|gb|EAT13328.1| acyl carrier protein S-malonyltransferase [Oceanobacter sp. RED65]
          Length = 306

 Score =  246 bits (628), Expect = 4e-63,   Method: Compositional matrix adjust.
 Identities = 139/306 (45%), Positives = 181/306 (59%), Gaps = 6/306 (1%)

Query: 1   MSTV-LTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATC 59
           MS V + FPGQGSQ +GM  D+      A+    E +  L  +L  L+ +G  +EL +T 
Sbjct: 1   MSKVAVVFPGQGSQSVGMISDVIAQHAIAKDTLSEANEVLGFDLQTLIESGPADELNSTE 60

Query: 60  NAQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRAR 119
           N QPAL AV +A  R + +     K     +AGHSLGEY+AL  A A S  D ++LVR R
Sbjct: 61  NTQPALVAVEVALWRALNE-----KLAADIMAGHSLGEYSALVCAGALSFCDALKLVRRR 115

Query: 120 GKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVK 179
           G+ MQEAVP G G M A++G+ D  V++ICAQ S   I + AN NG GQ+VI+G  DAV+
Sbjct: 116 GQLMQEAVPAGEGGMAAVLGMQDDQVEAICAQLSSYKIVQPANYNGPGQLVIAGHADAVE 175

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            AA  C   GAKRA+ LPVS PFHS+LM P +      +  V  + P VP+L N      
Sbjct: 176 KAAAQCKEAGAKRAMILPVSGPFHSALMQPAADAFAGFIAEVDIKTPSVPVLQNASIELE 235

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
           +    I   LV Q+   V W  T++  A  GV+S++EVG GKVLTGL KRIDKSLS+  I
Sbjct: 236 TDPKRIRSNLVAQIASPVNWTRTVELLAEQGVESIFEVGPGKVLTGLNKRIDKSLSSSVI 295

Query: 300 SKVEDI 305
           +  E I
Sbjct: 296 NNSESI 301


>gi|295111287|emb|CBL28037.1| [Acyl-carrier-protein] S-malonyltransferase [Synergistetes
           bacterium SGP1]
          Length = 315

 Score =  246 bits (627), Expect = 4e-63,   Method: Compositional matrix adjust.
 Identities = 138/307 (44%), Positives = 194/307 (63%), Gaps = 3/307 (0%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M   L FPGQG+Q +GMG++LY +FP A+ VF+E D  L+ +L+ L++ G + ELT T N
Sbjct: 1   MKYALCFPGQGAQQVGMGQELYRAFPSAKAVFDEADDALSAHLTKLIFEGPEGELTLTAN 60

Query: 61  AQPALTAVSMAFIRVMEKN-GLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRAR 119
           AQPA+  VS+A + V+EK  G+ +K      AGHSLGEYTAL AA   S SD +RLV  R
Sbjct: 61  AQPAIMTVSVAALSVLEKEMGVALKPACG--AGHSLGEYTALVAAGVLSFSDAVRLVNKR 118

Query: 120 GKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVK 179
           G+ MQEA P G+G+M AI+GL    V ++CA+A+  G C+ AN N  GQVVISG+++ V+
Sbjct: 119 GRWMQEAAPEGVGAMAAILGLGSDEVKALCAEAAPGGECQAANFNSPGQVVISGVKEFVE 178

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            AA     KGA++ V L VSAPFHS LM P ++ +K   +  +  +P  PI+ N  AS V
Sbjct: 179 KAAAAAKAKGARKTVMLNVSAPFHSRLMLPAAEKLKEEFERCSWAEPKWPIVANVSASAV 238

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
            S +EI   L EQ    V W  ++ +  ++GV +  E+G G+VL GL KR  K L  ++ 
Sbjct: 239 VSAEEIRDALYEQTFSPVLWESSVLYMVDYGVDTFLELGPGEVLCGLIKRCRKGLKQMAA 298

Query: 300 SKVEDID 306
            + E ++
Sbjct: 299 GEPEALE 305


>gi|189424997|ref|YP_001952174.1| malonyl CoA-acyl carrier protein transacylase [Geobacter lovleyi
           SZ]
 gi|189421256|gb|ACD95654.1| malonyl CoA-acyl carrier protein transacylase [Geobacter lovleyi
           SZ]
          Length = 307

 Score =  245 bits (626), Expect = 6e-63,   Method: Compositional matrix adjust.
 Identities = 132/308 (42%), Positives = 186/308 (60%), Gaps = 5/308 (1%)

Query: 3   TVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQ 62
           T   FPGQGSQ  GMG+DL ++FP AR  FEE D  L   LS L +NG +E+L  T N Q
Sbjct: 4   TSFLFPGQGSQYAGMGKDLAENFPIARHTFEEADEALGFKLSSLCFNGPEEDLKLTFNTQ 63

Query: 63  PALTAVSMAFIRVMEK-NGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           PA+   S+A +RV+++  GL        VAGHSLGEY+AL    A +L+D +R VR+RG 
Sbjct: 64  PAILTASVAALRVVQQETGL----QADCVAGHSLGEYSALVCGGALTLADAVRTVRSRGT 119

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCA 181
            MQEAVP G+G+M A++ ++   + +ICA+A++  +   AN N  GQ+VI+G   AV   
Sbjct: 120 FMQEAVPVGVGAMAAMLSIEAEELAAICAEAAQGEVVAPANFNSPGQIVIAGHATAVNRT 179

Query: 182 ADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSS 241
            +    KG ++A+ LPVSAPFH +LM P +  +K +LD VT     +P++ N  A+    
Sbjct: 180 IELAKAKGFRKAMLLPVSAPFHCALMQPAADRLKEVLDCVTIHPLTLPVVTNVEAAANQD 239

Query: 242 IDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISK 301
              +  LLV QV   VRW +++    N GV    E+G GKVLTGL KRI+K ++ V+I  
Sbjct: 240 AGRVRELLVAQVCAPVRWEQSVHAMINQGVSRFVEIGPGKVLTGLVKRINKEMALVNIED 299

Query: 302 VEDIDLAL 309
              +  A+
Sbjct: 300 TAGVKAAV 307


>gi|147678078|ref|YP_001212293.1| (acyl-carrier-protein) S-malonyltransferase [Pelotomaculum
           thermopropionicum SI]
 gi|146274175|dbj|BAF59924.1| (acyl-carrier-protein) S-malonyltransferase [Pelotomaculum
           thermopropionicum SI]
          Length = 313

 Score =  245 bits (626), Expect = 6e-63,   Method: Compositional matrix adjust.
 Identities = 140/319 (43%), Positives = 184/319 (57%), Gaps = 11/319 (3%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M     FPGQGSQ +GMGR+LY SF EA+ VF+  D  L   +S L + G ++EL  T N
Sbjct: 1   MKVAFVFPGQGSQYVGMGRELYSSFSEAKEVFKRADEALGFPISSLCFEGPEDELNKTVN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
            QPA+  VS+A + V++  G  V    + VAGHSLGEYTAL AA + +  D +RLV  RG
Sbjct: 61  TQPAVLTVSVACLEVLKVKGGGVP---AAVAGHSLGEYTALVAAGSLTFEDAVRLVHKRG 117

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           + MQEAVP G G M A++GL    V  +C +AS  GI E  N N   QVV++G    +K 
Sbjct: 118 RYMQEAVPLGKGGMAAVLGLSAEAVAEVCRKASSEGIVEPVNLNCPCQVVVAGDIAGLKA 177

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A       GA+R + LPVSAPFHSSLM P  + +   L  V   DP +P++ N  A  V 
Sbjct: 178 AELLSKEAGARRFISLPVSAPFHSSLMKPAGERLAMDLAEVVVGDPAIPVVANVSADFVH 237

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
           +  E+   L+ QV   VRW E+I    + G+ +  EVG GKVL+GL K+I +    VS+ 
Sbjct: 238 TGKEVKEALIRQVYSPVRWEESILRLISSGINTFVEVGPGKVLSGLIKKISRE---VSVY 294

Query: 301 KVEDID-----LALRSIVG 314
            +ED D     LAL   VG
Sbjct: 295 NIEDKDSLEKVLALTGEVG 313


>gi|260654630|ref|ZP_05860120.1| malonyl CoA-acyl carrier protein transacylase [Jonquetella anthropi
           E3_33 E1]
 gi|260630646|gb|EEX48840.1| malonyl CoA-acyl carrier protein transacylase [Jonquetella anthropi
           E3_33 E1]
          Length = 317

 Score =  245 bits (625), Expect = 7e-63,   Method: Compositional matrix adjust.
 Identities = 134/306 (43%), Positives = 183/306 (59%), Gaps = 3/306 (0%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M   L FPGQGSQ +GMG DL  ++P A+  F E D+ L   LSD+++NG +E LT T  
Sbjct: 1   MKYALIFPGQGSQNVGMGSDLCGTYPAAKAAFSEADNALGFKLSDIIFNGPEERLTLTAY 60

Query: 61  AQPALTAVSMAFIRVMEKNGLC-VKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRAR 119
            QPA+   S+A  R +  +  C VK     VAGHSLGEYTAL A+   SL+D +RLV +R
Sbjct: 61  TQPAILVTSIALYRALTVD--CGVKLSPECVAGHSLGEYTALVASGVLSLADGVRLVHSR 118

Query: 120 GKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVK 179
           G  MQEA P G G+M AI+G+D   V+ IC++  +  +CE AN N   Q+VISG  +AVK
Sbjct: 119 GSFMQEAAPEGQGAMAAIMGMDPDQVEIICSEVGKASVCEPANYNTPVQLVISGETEAVK 178

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            AAD    +GA+RAV L VSAPFH SLM PV+  +   + + T      P++ N     V
Sbjct: 179 RAADLATQRGARRAVMLNVSAPFHCSLMRPVADRLAESMKACTWNQGAFPLVANVSGQLV 238

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
           SS+ +I   L EQ    V+W ++++     GV    E+G GKVL+G+ K+I K  S +S+
Sbjct: 239 SSVSDIRDGLYEQTYSPVQWVKSVRTMCGLGVSRFVEIGPGKVLSGMIKKIQKDASCLSV 298

Query: 300 SKVEDI 305
               D+
Sbjct: 299 ETAGDL 304


>gi|148263933|ref|YP_001230639.1| malonyl CoA-acyl carrier protein transacylase [Geobacter
           uraniireducens Rf4]
 gi|146397433|gb|ABQ26066.1| [Acyl-carrier-protein] S-malonyltransferase [Geobacter
           uraniireducens Rf4]
          Length = 311

 Score =  245 bits (625), Expect = 7e-63,   Method: Compositional matrix adjust.
 Identities = 132/309 (42%), Positives = 188/309 (60%), Gaps = 7/309 (2%)

Query: 5   LTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPA 64
             FPGQGSQ  GMG+DL D+F  A  VF E D  L   LS L + G +E+L  T N QPA
Sbjct: 6   FIFPGQGSQYAGMGKDLADNFKAAAHVFAEADDALGFKLSKLCFEGPEEDLKLTANTQPA 65

Query: 65  LTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQ 124
           +  VS+A +RV+++          ++AGHSLGEY+AL AA A   +D +R VRARG  MQ
Sbjct: 66  ILTVSIAALRVLQEE---TSLTADFLAGHSLGEYSALVAAGAMQFADAVRTVRARGTFMQ 122

Query: 125 EAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAADT 184
           EAVP G+GSM AI+G++  ++  ICA+A++  +   AN N  GQ+V++G   AV  A + 
Sbjct: 123 EAVPVGVGSMAAILGVEADILAQICAEAAQGEVVSPANFNSPGQIVVAGHSGAVNRAIEI 182

Query: 185 CLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSIDE 244
              +G ++A+ LPVSAPFHSSLM P    +  +L+++       P++ N  A   S +  
Sbjct: 183 AKARGFRKAMLLPVSAPFHSSLMEPAGARLAGVLEAIEISSLQAPVVSNVEAKANSDMKR 242

Query: 245 ISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVED 304
           +  LLV+QV+  V W  ++Q  A  GV +  E+G GKVL GL KRIDK+        V+D
Sbjct: 243 VKELLVKQVSAPVLWDASVQEMAACGVTAFVEIGPGKVLAGLVKRIDKT---AETRNVQD 299

Query: 305 IDLALRSIV 313
           +D +L+++V
Sbjct: 300 VD-SLKALV 307


>gi|315648185|ref|ZP_07901286.1| malonyl CoA-acyl carrier protein transacylase [Paenibacillus vortex
           V453]
 gi|315276831|gb|EFU40174.1| malonyl CoA-acyl carrier protein transacylase [Paenibacillus vortex
           V453]
          Length = 310

 Score =  244 bits (623), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 125/312 (40%), Positives = 189/312 (60%), Gaps = 6/312 (1%)

Query: 3   TVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQ 62
           T   FPGQG+Q +GMG+D YD+ P  + +F+  D  L  +LS +++NG   EL  T N Q
Sbjct: 4   TAFIFPGQGAQSVGMGKDAYDALPSVQDMFQTADDKLGFSLSSIIFNGPDAELKQTVNTQ 63

Query: 63  PALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKS 122
           PAL A S+A++  +   G+    +  YVAGHSLGEY+AL  A   S  + + +VRARG+ 
Sbjct: 64  PALLATSLAYLEAIRGKGI----EPDYVAGHSLGEYSALVCAGVLSFEEAVSIVRARGEY 119

Query: 123 MQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVG-ICEIANDNGGGQVVISGLQDAVKCA 181
           M+ AVP G G+M A++G D   + ++C+  +  G + E+AN N  GQ+VISG    V  A
Sbjct: 120 MEAAVPGGQGAMAAVLGADRDALTTLCSGITAEGHVVELANMNCPGQIVISGSAQGVAAA 179

Query: 182 ADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSS 241
           A+     G KRA+ L VS PFHSSLM   +  +   L+  +   P VP++ N  A PV  
Sbjct: 180 AERIKEAGGKRAIPLEVSGPFHSSLMKEAANRLADKLEQASFHTPSVPVVANVTARPVDD 239

Query: 242 IDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISK 301
              I  LLVEQV   V W+++++W  + GV +  E+G G VL+GL K+IDKS+  ++++ 
Sbjct: 240 AAAIRGLLVEQVYSPVLWQDSVEWMISQGVDTFVEIGPGSVLSGLIKKIDKSVKVINVNS 299

Query: 302 VEDIDLALRSIV 313
           ++ ++ +L ++V
Sbjct: 300 LDSVN-SLETVV 310


>gi|282856660|ref|ZP_06265928.1| [acyl-carrier-protein] S-malonyltransferase [Pyramidobacter
           piscolens W5455]
 gi|282585509|gb|EFB90809.1| [acyl-carrier-protein] S-malonyltransferase [Pyramidobacter
           piscolens W5455]
          Length = 316

 Score =  244 bits (623), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 131/305 (42%), Positives = 186/305 (60%), Gaps = 2/305 (0%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M   + FPGQGSQ +GMG++L      A+  F E D  L  +LSD+++NG +++L  T  
Sbjct: 1   MKYAIVFPGQGSQAVGMGKELCGVSRAAKETFAEADEALGFSLSDIIFNGPEDKLVLTAY 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
            QPA+ A+S+A  R +++ G+ +  D ++VAGHSLGEYTAL A+   SL+D +RLV  RG
Sbjct: 61  TQPAILAMSIAVFRALQEKGMTL--DPAFVAGHSLGEYTALVASGVLSLADGVRLVHKRG 118

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
             MQEAVP G+G+M AI+GL+   V +ICA+A++  +CE AN N   Q VISG   AV+ 
Sbjct: 119 SFMQEAVPQGVGAMAAILGLEADAVRAICAEAAQEEVCEAANYNTPVQTVISGHTAAVER 178

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A      KGAKR+V L VSAPFH SLM PV+  +   ++         P++ N  A PVS
Sbjct: 179 AVALASAKGAKRSVMLNVSAPFHCSLMRPVADRLAAEMEKCVWSTGRCPLVANVSARPVS 238

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
            +  I   L  Q    VRW E++Q  A+ GV+   E+G GKVL G  K+ID+    +++ 
Sbjct: 239 DVSAIRDGLYAQTYSPVRWVESVQTMASRGVEGFIEMGPGKVLAGTIKKIDRHAPTLNVE 298

Query: 301 KVEDI 305
           +  D+
Sbjct: 299 QPADL 303


>gi|229162788|ref|ZP_04290745.1| Malonyl CoA-acyl carrier protein transacylase [Bacillus cereus
           R309803]
 gi|228620670|gb|EEK77539.1| Malonyl CoA-acyl carrier protein transacylase [Bacillus cereus
           R309803]
          Length = 314

 Score =  244 bits (623), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 126/309 (40%), Positives = 186/309 (60%), Gaps = 5/309 (1%)

Query: 7   FPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPALT 66
           FPGQGSQ +GMGR L D+  E   VFE+ D  L  +LS++++ G QE+LT T NAQPAL 
Sbjct: 8   FPGQGSQAVGMGRQLADNNKEVAKVFEKADEVLQDSLSEVIFEGPQEKLTLTTNAQPALL 67

Query: 67  AVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQEA 126
             S A +  +++ G+       +VAGHSLGEY+AL AA A +  D +  VR RG+ M+EA
Sbjct: 68  TTSYAILTALKEYGITP----DFVAGHSLGEYSALVAAGALTFEDAVYAVRKRGEYMEEA 123

Query: 127 VPPGLGSMVAIIGLDDCVVDSICAQASRVGIC-EIANDNGGGQVVISGLQDAVKCAADTC 185
           VP G G+M AI+G D  ++  +  + +  G   +IAN N   Q+VISG +  V+ A+   
Sbjct: 124 VPGGEGAMAAILGADPHMLKQVTEEVTSEGYAVQIANMNSTKQIVISGTKQGVEIASQRA 183

Query: 186 LNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSIDEI 245
              GAKRA+ L VS PFHSSLM P ++  + +L+ +T +D  +P++ N  A  ++   +I
Sbjct: 184 KENGAKRAIPLKVSGPFHSSLMKPAAEKFQSVLNEITIRDTNIPVIANVTADVITRGADI 243

Query: 246 SRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVEDI 305
              L+EQ+   V W  ++++  N GV +  E+G GKVL GL K ID S+ A +I   E +
Sbjct: 244 QEKLIEQLYSPVLWYPSVEYMVNQGVDTFIEIGPGKVLAGLMKSIDSSVKAYAIYDEETL 303

Query: 306 DLALRSIVG 314
              + ++ G
Sbjct: 304 KDTISNLRG 312


>gi|189183500|ref|YP_001937285.1| malonyl CoA-acyl carrier protein transacylase [Orientia
           tsutsugamushi str. Ikeda]
 gi|189180271|dbj|BAG40051.1| malonyl CoA-acyl carrier protein transacylase [Orientia
           tsutsugamushi str. Ikeda]
          Length = 312

 Score =  244 bits (622), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 132/313 (42%), Positives = 188/313 (60%), Gaps = 2/313 (0%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M TV  FPGQG Q +GMG+DLYD+FP AR VF EV+  + + L+D+++NG    LT T N
Sbjct: 1   MYTVFVFPGQGVQFVGMGKDLYDNFPVARDVFHEVNDIIAEKLTDIIFNGPISTLTLTKN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDIS-YVAGHSLGEYTALCAAKAFSLSDTIRLVRAR 119
           AQ A+ AVSMA IRV+E+        I+ YVAGHSLGEY+ALCAA A SL +  ++++ R
Sbjct: 61  AQLAIMAVSMATIRVLEQQAAMKCYQIADYVAGHSLGEYSALCAAGALSLDEVTKILKVR 120

Query: 120 GKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVK 179
             +M        GSM A +G+    ++ I    S +G+CEIANDN  GQ+VISG   A+ 
Sbjct: 121 ANAMHAVASRCDGSMAACLGVTMEELNPILDYCSTIGVCEIANDNILGQIVISGHTTAIN 180

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            A +    +G K+A+ L VS PFH SLM   + + +  +D V      + I+ N+ A+ V
Sbjct: 181 LAMNMLRAQG-KKAIKLNVSGPFHCSLMAKATSIFRQAIDKVNINPTKMIIVANYSANIV 239

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
           ++  +I   L+ Q+ G+VRWRET+       V  + E+G GKVL  LAK+   +    SI
Sbjct: 240 TTPIDIKNCLIRQIEGKVRWRETLDLLQQKNVSKLIEIGPGKVLINLAKKGQYTFKCSSI 299

Query: 300 SKVEDIDLALRSI 312
           + + +ID  L +I
Sbjct: 300 NSIFEIDAFLNNI 312


>gi|218513942|ref|ZP_03510782.1| [acyl-carrier-protein] S-malonyltransferase protein [Rhizobium etli
           8C-3]
          Length = 193

 Score =  244 bits (622), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 116/193 (60%), Positives = 148/193 (76%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M+   TFPGQGSQ +GMG+DL ++F EAR VFEEVD  L + LSD+M+NG ++ LT T N
Sbjct: 1   MTIAFTFPGQGSQAVGMGKDLAENFAEARAVFEEVDEALGEKLSDVMFNGPEDTLTLTAN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
           AQPAL AVS+A +RV++  GL +K  ++YVAGHSLGEY+ALCAA  FSL+DT RL+R RG
Sbjct: 61  AQPALMAVSIAVVRVLQAKGLDLKAKVAYVAGHSLGEYSALCAAGTFSLADTARLLRIRG 120

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
            +MQ AVP G+G+M AIIGL+   V +IC +A+  G C+IANDNGGGQ+VISG + AV+ 
Sbjct: 121 NAMQAAVPVGVGAMAAIIGLEHADVVAICEEAAATGACQIANDNGGGQIVISGEKAAVEK 180

Query: 181 AADTCLNKGAKRA 193
           AA    +KGAKRA
Sbjct: 181 AAGLATDKGAKRA 193


>gi|51473903|ref|YP_067660.1| acyl-carrier-protein S-malonyltransferase [Rickettsia typhi str.
           Wilmington]
 gi|51460215|gb|AAU04178.1| [acyl-carrier protein] S-malonyltransferase [Rickettsia typhi str.
           Wilmington]
          Length = 314

 Score =  244 bits (622), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 128/313 (40%), Positives = 187/313 (59%), Gaps = 2/313 (0%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M T   FPGQGSQ+IGMG+DLYD+   A+  F+ +D  LN+ L+D+++NG   ELT T N
Sbjct: 1   MKTAFIFPGQGSQLIGMGKDLYDNLKPAKETFQIIDTVLNRKLTDIIFNGPSAELTLTTN 60

Query: 61  AQPALTAVSMAFIRVME-KNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRAR 119
           AQPAL AVSMA I +++ + G  +     Y AGHSLGEY+ALC+ ++ +L     L+  R
Sbjct: 61  AQPALMAVSMAIINIIKAETGKNLDSLCDYAAGHSLGEYSALCSTESINLETAATLLNVR 120

Query: 120 GKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVK 179
             SMQ A P G+G+M A I +    V ++     ++  C+IANDN  GQ++ISG    + 
Sbjct: 121 STSMQAACPEGVGAMAACINIPLQKVVALLEDIKKINSCQIANDNIDGQIIISGKVGDID 180

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            A     + G K A+ L VSAPFH SLM P  + M+  LD      P++PI+ N+ A   
Sbjct: 181 HAISIIKDLGYK-AIKLKVSAPFHCSLMKPAEEKMRIALDKAVINKPIIPIIQNYTAKLT 239

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
            +  EI + L+ Q+ GRVRWRET++ F    V  + E+G+G VLT + ++I+      +I
Sbjct: 240 INPLEIKQNLILQICGRVRWRETLKLFNQLHVTHIVEIGAGNVLTNMLRKINYPYKLSNI 299

Query: 300 SKVEDIDLALRSI 312
           S + ++   L +I
Sbjct: 300 SNLAELKNFLDNI 312


>gi|85708881|ref|ZP_01039947.1| acyl-carrier-protein S-malonyltransferase [Erythrobacter sp. NAP1]
 gi|85690415|gb|EAQ30418.1| acyl-carrier-protein S-malonyltransferase [Erythrobacter sp. NAP1]
          Length = 311

 Score =  244 bits (622), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 141/303 (46%), Positives = 187/303 (61%), Gaps = 2/303 (0%)

Query: 5   LTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPA 64
             FPGQGSQ +GMG +L  +   AR VFEEVD  L   LS +M +G +++LT T NAQPA
Sbjct: 4   FVFPGQGSQKVGMGTELAAASAAAREVFEEVDEALGMKLSAIMRDGPEDQLTLTENAQPA 63

Query: 65  LTAVSMAFIRVMEKN-GLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSM 123
           + A ++A +RV+E + G+ +    S VAGHSLGEY+ALCA  AF L+ T RL++ RG +M
Sbjct: 64  IMANAIATLRVLEDDFGVKLAETGSCVAGHSLGEYSALCAVGAFDLATTARLLKLRGSAM 123

Query: 124 QEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAAD 183
           Q AVP G G M A++G D     ++ A AS   +CE+ANDN   QVVISG + A+  A  
Sbjct: 124 QAAVPVGEGGMAALLGADVEKAAALAAAASEQDVCEVANDNDPTQVVISGHKSAIDRAIA 183

Query: 184 TCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSID 243
              + G KR + LPVSAPFH SLM P +  M   L      +  +P+  N  A+ VS  +
Sbjct: 184 MAKDHGIKRGIALPVSAPFHCSLMQPAADRMAEALAETLPGELALPVYANVTATKVSDPE 243

Query: 244 EISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVE 303
           E   LLVEQVTGRVRWRE+I      GV+   E+G GKVL  +  RIDK  +  S+  +E
Sbjct: 244 EERNLLVEQVTGRVRWRESIIAMRADGVERFVELG-GKVLGPMIGRIDKEAATDSLISME 302

Query: 304 DID 306
           D++
Sbjct: 303 DLE 305


>gi|218508417|ref|ZP_03506295.1| [acyl-carrier-protein] S-malonyltransferase protein [Rhizobium etli
           Brasil 5]
          Length = 210

 Score =  243 bits (621), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 118/207 (57%), Positives = 160/207 (77%)

Query: 107 FSLSDTIRLVRARGKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGG 166
           FSL+DT RL+R RG +MQ AVP G+G+M AIIGL+   V ++C + +  G C+IANDNGG
Sbjct: 3   FSLADTARLLRIRGNAMQAAVPVGVGAMAAIIGLEHADVAAVCEEVAATGACQIANDNGG 62

Query: 167 GQVVISGLQDAVKCAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDP 226
           GQ+VISG + AV+ AA    +KGAKRA+ LPVSAPFHS LM P ++ M+  L +V K DP
Sbjct: 63  GQIVISGEKAAVEKAAGLATDKGAKRAILLPVSAPFHSKLMAPAAEAMRAALATVAKSDP 122

Query: 227 VVPILPNFCASPVSSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGL 286
           VVP++ N  A+PV+  DEI+ LLVEQVTG+VRWRET++WFA +GV ++YE+GSGKVLTGL
Sbjct: 123 VVPLIANVRAAPVTDADEIATLLVEQVTGQVRWRETVEWFAGNGVTTLYELGSGKVLTGL 182

Query: 287 AKRIDKSLSAVSISKVEDIDLALRSIV 313
           A+RIDK+++ +S+    DID A+ +++
Sbjct: 183 ARRIDKTVNGISVGGPADIDAAVAALM 209


>gi|319789959|ref|YP_004151592.1| malonyl CoA-acyl carrier protein transacylase [Thermovibrio
           ammonificans HB-1]
 gi|317114461|gb|ADU96951.1| malonyl CoA-acyl carrier protein transacylase [Thermovibrio
           ammonificans HB-1]
          Length = 306

 Score =  243 bits (620), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 134/306 (43%), Positives = 180/306 (58%), Gaps = 4/306 (1%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M+    FPGQGSQ  GMG++LY++FPEAR VFEE       ++  L +   +EELT T N
Sbjct: 1   MAIAFIFPGQGSQYSGMGKELYEAFPEAREVFEEASEGAKVDIRKLCFEAPEEELTLTYN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
           AQPA+  VSMA +RV+EK G   K D+  VAGHSLGE++A  AA  FS+ +   LVR RG
Sbjct: 61  AQPAIFTVSMAVLRVLEKAGFK-KPDV--VAGHSLGEFSAAGAAGVFSVGNGALLVRKRG 117

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           + MQ AVP G+G M A+IGL    V+ I  +  + G  ++AN N   Q VISG   A++ 
Sbjct: 118 EFMQSAVPAGVGGMTAVIGLPAEAVEEIINKV-KSGFVQVANYNSPEQTVISGEIKALQE 176

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A +     GAKR V L VSAPFHS LM P ++ +K +++ +       PIL N     + 
Sbjct: 177 AEEMLKQAGAKRVVRLAVSAPFHSKLMEPAAERLKELMEELPFHKANPPILNNVDVKLIK 236

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
             +EI      QV   VRW E +   A  GV + YE+G   VL GL +RID+ L  V++ 
Sbjct: 237 EPEEIKDSFYRQVFSPVRWVEDVLKMAQMGVDTFYEIGPKNVLKGLIRRIDRKLKVVNVE 296

Query: 301 KVEDID 306
           K +DI+
Sbjct: 297 KPQDIE 302


>gi|329929600|ref|ZP_08283307.1| [acyl-carrier-protein] S-malonyltransferase [Paenibacillus sp.
           HGF5]
 gi|328936245|gb|EGG32697.1| [acyl-carrier-protein] S-malonyltransferase [Paenibacillus sp.
           HGF5]
          Length = 310

 Score =  243 bits (619), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 129/312 (41%), Positives = 183/312 (58%), Gaps = 6/312 (1%)

Query: 3   TVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQ 62
           T   FPGQG+Q +GMG+D YD+ P AR +F   D  L   LS +++NG  E+L  T N Q
Sbjct: 4   TAFIFPGQGAQSVGMGKDAYDAVPSARDLFLTADAQLGFPLSSIIFNGPDEDLKQTVNTQ 63

Query: 63  PALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKS 122
           PAL A SMA++  +   G+       YVAGHSLGEY+AL  A   S  + + +VR RG+ 
Sbjct: 64  PALLATSMAYLEAVRGKGIVP----DYVAGHSLGEYSALVCAGVLSFEEAVSIVRTRGEY 119

Query: 123 MQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVG-ICEIANDNGGGQVVISGLQDAVKCA 181
           M+ AVP G G+M A++G D   +  +C   S  G + E+AN N  GQ+VISG    V  A
Sbjct: 120 MEAAVPGGQGAMAAVLGADREALAELCKGISAEGHVVELANMNCPGQIVISGSAQGVAAA 179

Query: 182 ADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSS 241
           A+     G KRA+ L VS PFHSSLM   ++ +   L   +   P VP++ N  A PV  
Sbjct: 180 AERVKEAGGKRAIPLEVSGPFHSSLMKEAAERLAGKLAQASFNAPSVPVVANVTARPVED 239

Query: 242 IDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISK 301
              I  LLVEQV   V W ++++W    GV +  E+G G VL+GL K+IDKS+  ++++ 
Sbjct: 240 AAAIRGLLVEQVYSPVLWHDSVEWMIAQGVDTFVEIGPGSVLSGLIKKIDKSVKVMNVNS 299

Query: 302 VEDIDLALRSIV 313
           +E ++ +L ++V
Sbjct: 300 LESVN-SLETVV 310


>gi|295696061|ref|YP_003589299.1| malonyl CoA-acyl carrier protein transacylase [Bacillus tusciae DSM
           2912]
 gi|295411663|gb|ADG06155.1| malonyl CoA-acyl carrier protein transacylase [Bacillus tusciae DSM
           2912]
          Length = 314

 Score =  243 bits (619), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 134/301 (44%), Positives = 186/301 (61%), Gaps = 8/301 (2%)

Query: 7   FPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPALT 66
           FPGQG+Q +GMG+ +YD++ EA+  F+E D  L  +LSDL +NG +E+L  T   QPA+ 
Sbjct: 6   FPGQGAQKVGMGKAVYDTYEEAKKTFQEADAALGFSLSDLCFNGPEEKLRQTTYTQPAIL 65

Query: 67  AVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQEA 126
             S+A  RV+E  G  V+ D++  AGHSLGEY+AL AA A   +D +R+V  RG+ MQEA
Sbjct: 66  TASVAVWRVLEARG--VRPDVA--AGHSLGEYSALVAAGALDFADAVRVVHRRGQYMQEA 121

Query: 127 VPPGLGSMVAIIGLDDCVVDSICAQASR-VGICEIANDNGGGQVVISGLQDAVKCAADTC 185
           VP G G+M A++  D   V  +CA+ SR VG  E+AN N  GQ+VISG  +AV+ A    
Sbjct: 122 VPAGGGTMAAVLQADRDTVTEVCAEVSREVGPVELANVNCPGQLVISGRTEAVQEAGKRL 181

Query: 186 LNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSIDEI 245
           L +GAKR + L VS PFHSSLM P ++ +   L  V  +D + P++ N  A P    DEI
Sbjct: 182 LERGAKRVLPLEVSGPFHSSLMKPAAQRLAEDLARVPLRDAICPVVSNIDAKPRRKADEI 241

Query: 246 SRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVEDI 305
              L  QV G V W + ++     GV  V EVG G+V++GL +++D++   V I   ED 
Sbjct: 242 REALARQVAGPVLWEDGVRTMLAMGVTRVAEVGPGRVVSGLVRKVDRN---VEILAAEDP 298

Query: 306 D 306
           D
Sbjct: 299 D 299


>gi|157803416|ref|YP_001491965.1| hypothetical protein A1E_01175 [Rickettsia canadensis str. McKiel]
 gi|157784679|gb|ABV73180.1| hypothetical protein A1E_01175 [Rickettsia canadensis str. McKiel]
          Length = 295

 Score =  243 bits (619), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 123/288 (42%), Positives = 179/288 (62%), Gaps = 2/288 (0%)

Query: 17  MGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPALTAVSMAFIRVM 76
           MGRD Y++F  A+  F+ +D  LN+ L+D+++N + EELT T NAQPAL AVSMA I  +
Sbjct: 1   MGRDFYNNFKPAKETFQTIDEALNRKLTDIIFNSTPEELTLTTNAQPALMAVSMAIINTI 60

Query: 77  E-KNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQEAVPPGLGSMV 135
           + + G  +     Y AGHSLGEY+ALCAA++ SL DT +L+  R  SMQEA P G GSM 
Sbjct: 61  KAETGKSLDSLCDYAAGHSLGEYSALCAAESISLIDTAKLLHVRSTSMQEACPEGEGSMA 120

Query: 136 AIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAADTCLNKGAKRAVF 195
           A I +    ++ I    +++ +C+IANDN  GQ+VISG  DA+  A     + G K A+ 
Sbjct: 121 ACINIPLQKLEQILEDINKINLCQIANDNIEGQIVISGKVDAIDYAISIIKDLGYK-AIK 179

Query: 196 LPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSIDEISRLLVEQVTG 255
           L VSAPFH SLM      M+  LD      P++P++ N+ A P ++  EI + L+ Q+ G
Sbjct: 180 LKVSAPFHCSLMKLAEHKMQLALDKTVINKPIIPVIQNYTAKPTTNPLEIKQNLILQICG 239

Query: 256 RVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVE 303
           RVRWRET++ F    +  + E+G+G VLT + ++ D      +IS+++
Sbjct: 240 RVRWRETLELFNTLEITHIVEIGAGNVLTNMLRKSDYPFKLSNISELQ 287


>gi|68171236|ref|ZP_00544640.1| Malonyl CoA-acyl carrier protein transacylase [Ehrlichia
           chaffeensis str. Sapulpa]
 gi|88657851|ref|YP_507048.1| malonyl CoA-acyl carrier protein transacylase [Ehrlichia
           chaffeensis str. Arkansas]
 gi|67999356|gb|EAM86001.1| Malonyl CoA-acyl carrier protein transacylase [Ehrlichia
           chaffeensis str. Sapulpa]
 gi|88599308|gb|ABD44777.1| malonyl CoA-acyl carrier protein transacylase [Ehrlichia
           chaffeensis str. Arkansas]
          Length = 323

 Score =  243 bits (619), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 131/311 (42%), Positives = 189/311 (60%), Gaps = 4/311 (1%)

Query: 4   VLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQP 63
           +  FPGQGSQ + MG+++YD+F  AR VF EVD  LN+ LS +M+ GS E LT+T NAQ 
Sbjct: 2   IFMFPGQGSQFVSMGKNIYDNFAVARYVFHEVDDILNKKLSKIMFEGSIENLTSTDNAQL 61

Query: 64  ALTAVSMAFIRVMEK---NGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
           AL   S+A +R +E      + +  +I Y+AGHS+GE  ALCA+ A +L +  +L+  R 
Sbjct: 62  ALMVTSIATLRAIEYVLGKPVHLFNNIKYMAGHSVGECVALCASGALTLYEVTQLLLVRS 121

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           ++M +AVP G G M A+IG     V+++   A   GICEIANDN  GQVV+SG++ A++ 
Sbjct: 122 QAMYDAVPLGYGGMCALIGGSLSDVENVVKMAQEYGICEIANDNCDGQVVVSGVKAALEK 181

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQD-PVVPILPNFCASPV 239
             D   + G K+ + L VS PFHSSLM+   + ++  ++SV     P V ++ N  A   
Sbjct: 182 LPDLIKDTGIKKVIKLQVSGPFHSSLMSSACEKLQEFIESVRNMKMPSVKVVSNVSAREY 241

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
           +    I  L+ +Q+  RVRWRE+I +  + G     EVG+G  L+GL KRI   +SAVSI
Sbjct: 242 TDCFMIKNLIAKQLVSRVRWRESILYMISQGCTHFIEVGAGTTLSGLVKRISSDVSAVSI 301

Query: 300 SKVEDIDLALR 310
           +  + ID   R
Sbjct: 302 NTADCIDSITR 312


>gi|258514465|ref|YP_003190687.1| malonyl CoA-acyl carrier protein transacylase [Desulfotomaculum
           acetoxidans DSM 771]
 gi|257778170|gb|ACV62064.1| malonyl CoA-acyl carrier protein transacylase [Desulfotomaculum
           acetoxidans DSM 771]
          Length = 312

 Score =  243 bits (619), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 131/314 (41%), Positives = 194/314 (61%), Gaps = 4/314 (1%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           MS    FPGQGSQ +GM R  YD++   R +F+  D  L  ++S+L + G +E L  T N
Sbjct: 1   MSLAFVFPGQGSQYVGMCRQFYDNYQVVRDIFDLADKALAFSISELCFQGPEELLGQTEN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
            QPA+   S+A   V+ + G+  +     +AGHSLGEY+AL AA A S SD +++VR RG
Sbjct: 61  TQPAVLTASIACQAVLLEAGIAPEA----LAGHSLGEYSALVAAGALSFSDAVQIVRKRG 116

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           + MQ+AVPPG G+M AI+GLD  ++  +C  AS +G+ E+AN N  GQ+VI+G   A++ 
Sbjct: 117 QLMQQAVPPGGGAMAAILGLDAGMLQEVCKHASDLGMVEVANYNCPGQLVIAGSAAALEK 176

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A       GAKRA+ L VS PFHS+LM P ++ +   L+ ++  +P + ++ N  A  V+
Sbjct: 177 AIVLAKEAGAKRAIKLVVSGPFHSALMFPAAEKLGRELEQISIIEPKLRLVANISADYVT 236

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
           + ++I   LV QV G VRW E +Q   N G+ +  EVG GKVL+GL K+IDK ++  ++ 
Sbjct: 237 TAEQIKDCLVRQVYGPVRWIEVVQKMINDGIDTFVEVGPGKVLSGLIKKIDKRVNIYNVE 296

Query: 301 KVEDIDLALRSIVG 314
               ++ AL S+ G
Sbjct: 297 DQPSLEKALASLKG 310


>gi|322420574|ref|YP_004199797.1| malonyl CoA-acyl carrier protein transacylase [Geobacter sp. M18]
 gi|320126961|gb|ADW14521.1| malonyl CoA-acyl carrier protein transacylase [Geobacter sp. M18]
          Length = 310

 Score =  242 bits (618), Expect = 5e-62,   Method: Compositional matrix adjust.
 Identities = 127/291 (43%), Positives = 176/291 (60%), Gaps = 3/291 (1%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
           S    FPGQGSQ  GMG+DL D+F  A++ FEE D  L  +LS L + G +E+L  T N 
Sbjct: 3   SYAFIFPGQGSQHAGMGKDLADNFKAAKIAFEEADDALGFSLSRLCFEGPEEDLKLTANT 62

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPA+ A S+A +RV+ +         S++AGHSLGEY+AL A+ A   +D +R VRARG 
Sbjct: 63  QPAILAASVAALRVLREESPITP---SFLAGHSLGEYSALVASGALDFADALRTVRARGS 119

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCA 181
            MQ+AVP G+G+M AI+G +  ++  ICA+A++  +   AN N  GQ+V++G   AV  A
Sbjct: 120 YMQDAVPVGIGAMAAILGAEADLLKEICAEAAQGEVVSPANFNSPGQIVVAGHTGAVNRA 179

Query: 182 ADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSS 241
            +    KG ++A+ LPVSAPFH +LM P +  +   L+ +T      P++ N  A P S 
Sbjct: 180 IEIAKAKGLRKAMLLPVSAPFHCALMKPAADRLARTLEPLTVNPLAAPVVSNVEAKPNSD 239

Query: 242 IDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDK 292
              +  LL+EQV   V W + IQ     GV +  E+G GKVL GL KRIDK
Sbjct: 240 AARVKPLLIEQVCAPVLWEQIIQNIVAQGVTNFVEIGPGKVLAGLVKRIDK 290


>gi|297544754|ref|YP_003677056.1| malonyl CoA-acyl carrier protein transacylase [Thermoanaerobacter
           mathranii subsp. mathranii str. A3]
 gi|296842529|gb|ADH61045.1| malonyl CoA-acyl carrier protein transacylase [Thermoanaerobacter
           mathranii subsp. mathranii str. A3]
          Length = 309

 Score =  242 bits (618), Expect = 5e-62,   Method: Compositional matrix adjust.
 Identities = 128/314 (40%), Positives = 190/314 (60%), Gaps = 5/314 (1%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M     +PGQGSQ  GMG+++Y  + EAR +FE  D  L  ++S L + G +EEL  T N
Sbjct: 1   MKIAFIYPGQGSQYAGMGKEIYQRYQEAREIFERADEALGFSISKLCFEGPEEELLKTEN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
            QPA+  VS+A  +V++  G+    +    AG SLGEY++L  A+A    D +RLV+ RG
Sbjct: 61  TQPAILTVSVALTKVLQNRGI----NAEVTAGLSLGEYSSLVLAEALDFEDAVRLVKNRG 116

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           K MQ  VP G+G+M AI+GL++ VV+ IC  AS+VGI E AN N  GQ+VISG   AV+ 
Sbjct: 117 KYMQGVVPQGVGTMAAILGLENEVVEEICRIASQVGIVEPANYNCPGQLVISGEVKAVEK 176

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A +    KGAKRAV L VSAPFH S++    ++++  L  +  ++  +P++ N  A+ V+
Sbjct: 177 AVELAKEKGAKRAVVLAVSAPFHCSMLRKAGELLEKDLGKIEIRELKIPVISNVTANYVT 236

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
             +EI  LL++QV+  V W ++++     GV    E+G GK LTG  K+ID++  A +  
Sbjct: 237 R-EEIKELLIKQVSHPVLWEQSVKRMIEDGVDIFVEIGPGKTLTGFVKKIDRTKDAYNFE 295

Query: 301 KVEDIDLALRSIVG 314
             E +   L ++ G
Sbjct: 296 DEESLLKTLSALEG 309


>gi|87199448|ref|YP_496705.1| [Acyl-carrier-protein] S-malonyltransferase [Novosphingobium
           aromaticivorans DSM 12444]
 gi|87135129|gb|ABD25871.1| [Acyl-carrier-protein] S-malonyltransferase [Novosphingobium
           aromaticivorans DSM 12444]
          Length = 311

 Score =  242 bits (617), Expect = 6e-62,   Method: Compositional matrix adjust.
 Identities = 140/309 (45%), Positives = 186/309 (60%), Gaps = 2/309 (0%)

Query: 5   LTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPA 64
             FPGQGSQ +GMG +L ++   AR VFEEVD  L Q L  +M +G ++ LT T NAQPA
Sbjct: 4   FVFPGQGSQKVGMGLELAEASAAAREVFEEVDDALGQKLFQIMKDGPEDALTLTENAQPA 63

Query: 65  LTAVSMAFIRVMEKNG-LCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSM 123
           + A ++A +RV+E+ G + +     +VAGHSLGEYTALCAA AFSLSDT RL++ RG+SM
Sbjct: 64  IMANAIAVLRVLEREGGITLADKADFVAGHSLGEYTALCAAGAFSLSDTARLLKLRGQSM 123

Query: 124 QEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAAD 183
           Q AVP G G+M A++G D     ++   A+   +C +ANDN   QVV+SG + A++ A  
Sbjct: 124 QAAVPVGEGAMCALLGADIEKATALAEAAAEGEVCTVANDNDPTQVVLSGHKGAIERAVG 183

Query: 184 TCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSID 243
                G KR V LPVSAPFH  LM P +  M    +        V +  N  AS V+   
Sbjct: 184 LVKEHGIKRGVLLPVSAPFHCPLMQPAADAMAEAFEKTPPGPLRVALFANVTASIVTDPA 243

Query: 244 EISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVE 303
           E+ RLLVEQVTGRVRWRE+       GV    E+G GKVL  +  R    +S  S+  + 
Sbjct: 244 EVQRLLVEQVTGRVRWRESAIAMREAGVDQFIELG-GKVLGPMINRTVADVSITSVVGMA 302

Query: 304 DIDLALRSI 312
           DI+  L+ +
Sbjct: 303 DIEAILKEL 311


>gi|262198813|ref|YP_003270022.1| malonyl CoA-acyl carrier protein transacylase [Haliangium ochraceum
           DSM 14365]
 gi|262082160|gb|ACY18129.1| malonyl CoA-acyl carrier protein transacylase [Haliangium ochraceum
           DSM 14365]
          Length = 315

 Score =  242 bits (617), Expect = 6e-62,   Method: Compositional matrix adjust.
 Identities = 140/307 (45%), Positives = 189/307 (61%), Gaps = 3/307 (0%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M T L FPGQGSQ +GMG+ L D+FP AR VF+E D  L   +S++ + G  ++L  T  
Sbjct: 1   MGTALLFPGQGSQKVGMGKALVDAFPAARAVFDEADEALGFAISEVCFEGPADKLMLTAY 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVA--GHSLGEYTALCAAKAFSLSDTIRLVRA 118
           +QPA+   S+A +R  +  G  + +D   VA  GHSLGE+TAL AA AF+LSD +RLV  
Sbjct: 61  SQPAILTQSIAVLRAAQAEGR-IAQDGEVVAAMGHSLGEFTALVAAGAFTLSDAVRLVHL 119

Query: 119 RGKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAV 178
           RG++MQ+AVP G G M A++GLD   V ++C + +   +C  AN NG GQVVISG   A+
Sbjct: 120 RGQAMQDAVPMGEGGMAALLGLDAEAVQALCDEVAEGQVCVPANLNGAGQVVISGHAGAI 179

Query: 179 KCAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASP 238
           + A      KGAKRA+ L VSAPFHS LM P ++ +   LD +  +   VP++ N  A+P
Sbjct: 180 ERAVAAAKGKGAKRAIKLQVSAPFHSPLMQPAAERLAEALDGIAIEPLRVPVISNVEAAP 239

Query: 239 VSSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVS 298
            S    +  LLV QVTG VRW E++   A   V   +E G+GKVL GL  R  K L   S
Sbjct: 240 NSDAGRVKELLVAQVTGAVRWEESMHALAAMDVSQGFEFGAGKVLRGLFSRTVKELPVHS 299

Query: 299 ISKVEDI 305
           +S+ +DI
Sbjct: 300 LSEPDDI 306


>gi|169830825|ref|YP_001716807.1| malonyl CoA-acyl carrier protein transacylase [Candidatus
           Desulforudis audaxviator MP104C]
 gi|169637669|gb|ACA59175.1| malonyl CoA-acyl carrier protein transacylase [Candidatus
           Desulforudis audaxviator MP104C]
          Length = 313

 Score =  242 bits (617), Expect = 6e-62,   Method: Compositional matrix adjust.
 Identities = 133/304 (43%), Positives = 177/304 (58%), Gaps = 6/304 (1%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M T   FPGQGSQ +GMG +L+ S+P  R +F   D  L  +L+ L + G +EEL  T N
Sbjct: 1   MKTAFLFPGQGSQYVGMGEELHRSYPVVRRIFTRADEILGFSLTKLCFEGPREELQKTAN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
            QPA+ A S+A   V+ + G+        +AGHSLGEYTAL  A AFS  D +RLVR RG
Sbjct: 61  TQPAVFATSVACFEVLREKGILP----DVLAGHSLGEYTALVVAGAFSFEDGLRLVRRRG 116

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           + MQEAVP G G MVA++GL+   +  I  +A R G+  +AN N  GQVV++G   A++ 
Sbjct: 117 QLMQEAVPLGTGGMVAVLGLERETLKEIATEAGRAGVINLANFNCPGQVVLAGEMAALER 176

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A D     GAK+ V L VS PFHSSLM    + +   LD +  +DP  P++ N     + 
Sbjct: 177 AVDLAKQAGAKKCVPLSVSGPFHSSLMRSAGERLAQALDGIEIRDPRTPVVANVDGRFLV 236

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
           +  E+   LV Q+   VRW E IQ     GV++  EVG GKVL+GL K+I    +A  I 
Sbjct: 237 TAAEVRAALVRQIYSPVRWEEGIQTLIGAGVRTFVEVGPGKVLSGLVKKIASRDTA--IL 294

Query: 301 KVED 304
            VED
Sbjct: 295 NVED 298


>gi|289523233|ref|ZP_06440087.1| malonyl CoA-acyl carrier protein transacylase [Anaerobaculum
           hydrogeniformans ATCC BAA-1850]
 gi|289503776|gb|EFD24940.1| malonyl CoA-acyl carrier protein transacylase [Anaerobaculum
           hydrogeniformans ATCC BAA-1850]
          Length = 317

 Score =  242 bits (617), Expect = 7e-62,   Method: Compositional matrix adjust.
 Identities = 136/315 (43%), Positives = 185/315 (58%), Gaps = 3/315 (0%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M+    FPGQG Q +GMGR+ YD F  +R +F   D  L   LS +++ G +EELT T  
Sbjct: 1   MAYAFVFPGQGVQEVGMGREFYDEFTVSREMFLRADEALGFPLSRVIFEGPEEELTKTEF 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
           AQPA+  VS+A    +    +  + D S+VAGHSLGEYT+L A+ A  L D +RLV  RG
Sbjct: 61  AQPAILTVSIAAFEAL--KSMRKELDPSFVAGHSLGEYTSLVASGALKLEDGVRLVNIRG 118

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRV-GICEIANDNGGGQVVISGLQDAVK 179
           K MQ+ VP G+G+M AIIGLD   V+ IC+ AS     CE AN N   Q+V+SG  +AV 
Sbjct: 119 KLMQQVVPLGVGAMAAIIGLDKETVEEICSLASTAESFCEPANYNSPQQIVLSGHAEAVN 178

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            A +    + AKRAV L VSAPFHSSLM PV++ +     S   + P  P++ N  A P+
Sbjct: 179 RAIELAKERKAKRAVPLKVSAPFHSSLMRPVAEGLSEAFKSCEWRRPKWPVVANVNAKPL 238

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
            S++EI + L+ Q    V W +++++    G  S  EVG G VLTGL K+I K +   S+
Sbjct: 239 ESVEEIQKALLLQSYSPVLWTQSVEFMRGAGADSFLEVGPGGVLTGLIKKIAKDVKVYSL 298

Query: 300 SKVEDIDLALRSIVG 314
              E +  AL  + G
Sbjct: 299 DSPEKLKGALDFLGG 313


>gi|289578478|ref|YP_003477105.1| malonyl CoA-acyl carrier protein transacylase [Thermoanaerobacter
           italicus Ab9]
 gi|289528191|gb|ADD02543.1| malonyl CoA-acyl carrier protein transacylase [Thermoanaerobacter
           italicus Ab9]
          Length = 309

 Score =  241 bits (616), Expect = 7e-62,   Method: Compositional matrix adjust.
 Identities = 127/314 (40%), Positives = 190/314 (60%), Gaps = 5/314 (1%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M     +PGQGSQ  GMG+++Y  + EAR +FE  D  L  ++S L + G +EEL  T N
Sbjct: 1   MKIAFIYPGQGSQYAGMGKEIYQRYQEAREIFERADEALGFSISKLCFEGPEEELLKTEN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
            QPA+  VS+A  +V++  G+    +    AG SLGEY++L  A+A    D +RLV+ RG
Sbjct: 61  TQPAILTVSVALTKVLQNRGI----NAEVTAGLSLGEYSSLVLAEALDFEDAVRLVKNRG 116

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           K MQ  VP G+G+M AI+GL++ VV+ IC  AS+VGI E AN N  GQ+VISG   AV+ 
Sbjct: 117 KYMQGVVPQGVGTMAAILGLENEVVEEICRIASQVGIVEPANYNCPGQLVISGEVKAVEK 176

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A +    KGAKRAV L VSAPFH S++    ++++  L  +  ++  +P++ N  A+ V+
Sbjct: 177 AVELAKEKGAKRAVVLAVSAPFHCSMLRKAGELLEKDLGKIEIRELKIPVISNVTANYVT 236

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
             +E+  LL++QV+  V W ++++     GV    E+G GK LTG  K+ID++  A +  
Sbjct: 237 R-EEVKELLIKQVSHPVLWEQSVKRMIEDGVDIFVEIGPGKTLTGFVKKIDRTKDAYNFE 295

Query: 301 KVEDIDLALRSIVG 314
             E +   L ++ G
Sbjct: 296 DEESLLKTLSALEG 309


>gi|78222810|ref|YP_384557.1| [Acyl-carrier-protein] S-malonyltransferase [Geobacter
           metallireducens GS-15]
 gi|78194065|gb|ABB31832.1| [Acyl-carrier-protein] S-malonyltransferase [Geobacter
           metallireducens GS-15]
          Length = 308

 Score =  241 bits (616), Expect = 7e-62,   Method: Compositional matrix adjust.
 Identities = 135/301 (44%), Positives = 181/301 (60%), Gaps = 8/301 (2%)

Query: 5   LTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPA 64
             FPGQGSQ  GMG+DL D+F  AR  FEE D  L  NLS L ++G +++L  T N QP+
Sbjct: 6   FIFPGQGSQYPGMGKDLADNFALARKTFEEADDALGDNLSRLCFDGPEDQLKLTANTQPS 65

Query: 65  LTAVSMAFIRVM-EKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSM 123
           +  VS+A +RV+ E+ GL  +    Y AGHSLGEY+AL AA     +D +R VRARG  M
Sbjct: 66  ILTVSVAALRVLQEETGLSAQ----YFAGHSLGEYSALVAAGVIQFADAVRTVRARGTFM 121

Query: 124 QEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAAD 183
           QEAVP G+G+M A++ ++  V+ +ICA+A++      AN N  GQ+VI+G   AV  A +
Sbjct: 122 QEAVPVGVGAMAAMLSIEPDVLAAICAEAAQGEEVSPANFNSPGQIVIAGHTGAVNRAIE 181

Query: 184 TCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSID 243
               KG ++A+ LPVSAPFHSSLM P  + +  +L  +T      P++ N  A P     
Sbjct: 182 IAKAKGFRKAMLLPVSAPFHSSLMVPAGERLAGVLAPITVGAFSAPVVTNVEAKPNDDKA 241

Query: 244 EISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVE 303
            +  LLV QV+  V W  +++     GV    EVG GKVL+GL KRIDK    VS   VE
Sbjct: 242 RVKELLVRQVSAPVLWDASVREMVALGVTEFVEVGPGKVLSGLVKRIDKG---VSTKNVE 298

Query: 304 D 304
           D
Sbjct: 299 D 299


>gi|312111711|ref|YP_003990027.1| malonyl CoA-acyl carrier protein transacylase [Geobacillus sp.
           Y4.1MC1]
 gi|311216812|gb|ADP75416.1| malonyl CoA-acyl carrier protein transacylase [Geobacillus sp.
           Y4.1MC1]
          Length = 313

 Score =  241 bits (615), Expect = 9e-62,   Method: Compositional matrix adjust.
 Identities = 123/309 (39%), Positives = 192/309 (62%), Gaps = 5/309 (1%)

Query: 7   FPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPALT 66
           FPGQGSQ +GMG+D+  S      VF+  D  L  +LS L++ G QE LT T NAQPAL 
Sbjct: 8   FPGQGSQTVGMGKDVAQSDANIAAVFQSADERLGFSLSSLIFEGPQETLTLTYNAQPALL 67

Query: 67  AVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQEA 126
             S+A ++ +++ G+       YVAGHSLGEYTAL AA A S +D +  VR RG+ M++A
Sbjct: 68  TTSVALLQKVKEAGITA----DYVAGHSLGEYTALVAAGAISFTDAVYAVRKRGEFMEKA 123

Query: 127 VPPGLGSMVAIIGLDDCVVDSICAQASRVG-ICEIANDNGGGQVVISGLQDAVKCAADTC 185
           VP G G+M A++G+D   ++++  + S  G   ++AN N  GQ+VISG +  V+ A +  
Sbjct: 124 VPAGEGTMAAVLGMDAAALEAVTNEISEQGDPVQLANLNCPGQIVISGSKAGVEKAGNLA 183

Query: 186 LNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSIDEI 245
             +GAKR + L VS PFHS LM P +  ++ +L+++  +D  +P++ N  A PV   +EI
Sbjct: 184 KERGAKRVIPLEVSGPFHSLLMKPAASHLQEVLNTIAIRDAEIPVIANVTAQPVVKKEEI 243

Query: 246 SRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVEDI 305
            RLL+EQ+   VRW ++++     GV +  E+G GKVL+GL K+I +++   +++ +  +
Sbjct: 244 LRLLIEQLYSPVRWEQSVETMIRLGVDTFVEIGPGKVLSGLVKKISRNVRVYAVNDLASL 303

Query: 306 DLALRSIVG 314
              + ++ G
Sbjct: 304 QATVAALKG 312


>gi|296133574|ref|YP_003640821.1| malonyl CoA-acyl carrier protein transacylase [Thermincola sp. JR]
 gi|296032152|gb|ADG82920.1| malonyl CoA-acyl carrier protein transacylase [Thermincola potens
           JR]
          Length = 313

 Score =  241 bits (615), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 128/305 (41%), Positives = 176/305 (57%), Gaps = 6/305 (1%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M   + FPGQGSQ +GMG+DLYD+  EAR +FE+ D  L  +LS + ++G +EEL  T  
Sbjct: 1   MKLAVVFPGQGSQYVGMGKDLYDNSSEARALFEKADQLLGYSLSSVCFHGPEEELRKTPV 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
            QPA+   S    R   K     K  +  VAGHSLGEY+AL AA+     + ++LV  RG
Sbjct: 61  TQPAMLTTSTVLFREFSKRN---KIPVQVVAGHSLGEYSALVAAECLYFEEAVQLVEKRG 117

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           + M+EA   G G M A++GL+   V+  C +AS  G  EIAN N  GQ+VISG    ++ 
Sbjct: 118 RLMEEAASKGEGGMAAVLGLERSAVEKACREASAAGKVEIANYNCPGQIVISGTAGGLEK 177

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           AA+ C   GAKR V L VS PFHSSLM P  + +  +L       P  P + N  A  VS
Sbjct: 178 AAELCRALGAKRIVTLNVSGPFHSSLMKPAEENLAQILKETVINAPKYPFICNVTADFVS 237

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
            ++EI   L  QV+  V W + +Q    HGV +  E+G GKVLTGL ++I++    V++ 
Sbjct: 238 DVEEIREFLTRQVSHSVLWEDMVQNMIVHGVDTFVEIGPGKVLTGLIRKINRE---VTVY 294

Query: 301 KVEDI 305
            +ED+
Sbjct: 295 NIEDL 299


>gi|295706314|ref|YP_003599389.1| malonyl CoA-acyl carrier protein transacylase [Bacillus megaterium
           DSM 319]
 gi|294803973|gb|ADF41039.1| malonyl CoA-acyl carrier protein transacylase [Bacillus megaterium
           DSM 319]
          Length = 314

 Score =  241 bits (614), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 124/309 (40%), Positives = 187/309 (60%), Gaps = 5/309 (1%)

Query: 7   FPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPALT 66
           FPGQGSQ +GMG+DLYD   EA+ +    D  L  +LS++++ G QEELT T +AQPAL 
Sbjct: 8   FPGQGSQTVGMGKDLYDGTEEAKKLIHTADEALGFSLSNIIFEGPQEELTLTYHAQPALL 67

Query: 67  AVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQEA 126
           A S   +   + +G+       +VAGHSLGEY+AL AA+  S  D +  V  RG+ M EA
Sbjct: 68  ATSTMLLEAFKTSGITP----DFVAGHSLGEYSALVAAEVLSFEDAVVAVHKRGRYMDEA 123

Query: 127 VPPGLGSMVAIIGLDDCVVDSICAQASRVG-ICEIANDNGGGQVVISGLQDAVKCAADTC 185
           VP G G+M A++G+    ++++ AQ +  G   ++AN N  GQ+VISG  + V+ A    
Sbjct: 124 VPAGQGTMAAVLGMSAEDLEAVTAQITSEGDAVQLANINCPGQIVISGTVNGVEKAGALA 183

Query: 186 LNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSIDEI 245
             KGAKR + L VS PFHSSLM P ++ ++  L++V   D  VP++ N  A PV+   +I
Sbjct: 184 KEKGAKRVIPLVVSGPFHSSLMKPAAEKLRDTLETVGFSDAKVPVIANVTAKPVTDSQDI 243

Query: 246 SRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVEDI 305
              LVEQ+   VRW ET++     GV +  E+G GKVL+GL K++++  +  +++ +  +
Sbjct: 244 QNKLVEQLYSPVRWEETVETLLAEGVDTFVEIGPGKVLSGLVKKVNRRAAVYAVNDLTSL 303

Query: 306 DLALRSIVG 314
              + ++ G
Sbjct: 304 KSTIDALKG 312


>gi|323705475|ref|ZP_08117050.1| malonyl CoA-acyl carrier protein transacylase
           [Thermoanaerobacterium xylanolyticum LX-11]
 gi|323535377|gb|EGB25153.1| malonyl CoA-acyl carrier protein transacylase
           [Thermoanaerobacterium xylanolyticum LX-11]
          Length = 310

 Score =  241 bits (614), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 127/312 (40%), Positives = 190/312 (60%), Gaps = 5/312 (1%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M     +PGQG+Q  GMG+++Y+++ EAR VFEE +  L  +++ L + G  EEL  T N
Sbjct: 1   MKIAFIYPGQGAQYTGMGKEIYENYAEAREVFEEANDALRYDITRLCFEGPDEELMKTEN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
            QPA+  VS+A  +V+ K GL  K D++  AG SLGEY++L  +   S  D ++LV+ RG
Sbjct: 61  TQPAILTVSIALTKVLSKRGL--KADVT--AGLSLGEYSSLVYSGVLSFKDAVKLVKKRG 116

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           + MQ AVP G+G M AIIGLD+ VV++IC      G+ E AN N  GQ+ I+G   A++ 
Sbjct: 117 EYMQNAVPIGIGGMAAIIGLDNEVVENICYNIREFGVVEPANYNCPGQLSIAGEIKALEK 176

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A +    KGAK+AV LPVSAPFH S++      ++  L  V   D +VP++ N  A  + 
Sbjct: 177 AVELAKEKGAKKAVMLPVSAPFHCSMLKDAGIKLEEDLKQVPIFDMLVPVITNVTADYL- 235

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
            IDE+ + LV+QV+  V W ++++   +  V+   E+G GK LTG  KRIDK+  A++  
Sbjct: 236 KIDEVKKTLVKQVSSPVLWEQSVRKMIDDQVEVFIEIGPGKTLTGFMKRIDKTKKAINFE 295

Query: 301 KVEDIDLALRSI 312
            +  +D  L ++
Sbjct: 296 DMSSLDKLLSTL 307


>gi|295399777|ref|ZP_06809758.1| malonyl CoA-acyl carrier protein transacylase [Geobacillus
           thermoglucosidasius C56-YS93]
 gi|294978180|gb|EFG53777.1| malonyl CoA-acyl carrier protein transacylase [Geobacillus
           thermoglucosidasius C56-YS93]
          Length = 313

 Score =  241 bits (614), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 123/309 (39%), Positives = 192/309 (62%), Gaps = 5/309 (1%)

Query: 7   FPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPALT 66
           FPGQGSQ +GMG+D+  S      VF+  D  L  +LS L++ G QE LT T NAQPAL 
Sbjct: 8   FPGQGSQTVGMGKDVAQSDANIAAVFQSADERLGFSLSSLIFEGPQETLTLTYNAQPALL 67

Query: 67  AVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQEA 126
             S+A ++ +++ G+       YVAGHSLGEYTAL AA A S +D +  VR RG+ M++A
Sbjct: 68  TTSVALLQKVKEAGITA----DYVAGHSLGEYTALVAAGAISFTDAVYAVRKRGEFMEKA 123

Query: 127 VPPGLGSMVAIIGLDDCVVDSICAQASRVG-ICEIANDNGGGQVVISGLQDAVKCAADTC 185
           VP G G+M A++G+D   ++++  + S  G   ++AN N  GQ+VISG +  V+ A +  
Sbjct: 124 VPAGEGTMAAVLGMDAAALEAVTNEISEQGDPVQLANLNCPGQIVISGSKAGVEKAGNLA 183

Query: 186 LNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSIDEI 245
             +GAKR + L VS PFHS LM P +  ++ +L+++  +D  +P++ N  A PV   +EI
Sbjct: 184 KERGAKRVIPLEVSGPFHSLLMKPAASHLQDVLNTIAIRDAEIPVIANVTAQPVVKKEEI 243

Query: 246 SRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVEDI 305
            RLL+EQ+   VRW ++++     GV +  E+G GKVL+GL K+I +++   +++ +  +
Sbjct: 244 LRLLIEQLYSPVRWEQSVETMIRLGVDTFVEIGPGKVLSGLVKKISRNVRVYAVNDLASL 303

Query: 306 DLALRSIVG 314
              + ++ G
Sbjct: 304 QATVAALKG 312


>gi|149183213|ref|ZP_01861659.1| acyl-carrier-protein S-malonyltransferase [Bacillus sp. SG-1]
 gi|148849078|gb|EDL63282.1| acyl-carrier-protein S-malonyltransferase [Bacillus sp. SG-1]
          Length = 315

 Score =  240 bits (613), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 129/303 (42%), Positives = 187/303 (61%), Gaps = 11/303 (3%)

Query: 5   LTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPA 64
             FPGQGSQ  GMG++L + FP+    F++ D  L  +LS L++ G Q++LT T NAQPA
Sbjct: 6   FVFPGQGSQKAGMGKELSEKFPQVEEYFKKADQRLGFDLSTLIFEGPQDKLTLTENAQPA 65

Query: 65  LTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQ 124
           L   S+AF++++E  G  VK D  Y AGHSLGEY+AL AA A S  D +  VR RG+ M+
Sbjct: 66  LLTTSIAFLQMLESEG--VKPD--YTAGHSLGEYSALVAAGAISFEDGVYAVRKRGEYME 121

Query: 125 EAVPPGLGSMVAIIGLD----DCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           EAVP G G+M A++G+       + + I A+ + VG+   AN N  GQ+VISG    V+ 
Sbjct: 122 EAVPAGEGTMAAVLGMGRDQLSEITERISAEGNHVGL---ANLNCPGQIVISGSFRGVEL 178

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A+D    +GAKR + L VS PFHSS+M P ++    +LD +  +D  VP++ N  A P+ 
Sbjct: 179 ASDLAKEEGAKRVLPLQVSGPFHSSMMKPAAENFSGVLDEIAIRDAEVPVIANVNAEPMI 238

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
           S  EI   L++Q+   V W +T+    + GV +  E+G GKVL+GL K++++ ++  SIS
Sbjct: 239 SASEIKERLIQQLYSPVLWEDTVVKLLDAGVDTFIEIGPGKVLSGLIKKVNRRVNTFSIS 298

Query: 301 KVE 303
             E
Sbjct: 299 DEE 301


>gi|73667394|ref|YP_303410.1| malonyl CoA-acyl carrier protein transacylase [Ehrlichia canis str.
           Jake]
 gi|72394535|gb|AAZ68812.1| Malonyl CoA-acyl carrier protein transacylase [Ehrlichia canis str.
           Jake]
          Length = 326

 Score =  239 bits (611), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 129/309 (41%), Positives = 189/309 (61%), Gaps = 8/309 (2%)

Query: 4   VLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQP 63
           +L FPGQGSQ + MG+D+YD+F  AR VF EVD  LN+ LS +M+ GS E LT+T NAQ 
Sbjct: 5   ILMFPGQGSQFVSMGKDIYDNFAVARYVFHEVDDILNKKLSKIMFEGSIENLTSTDNAQL 64

Query: 64  ALTAVSMAFIRVMEK---NGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
           AL   S+A +R +E      + +   + Y+AGHS+GE  ALCA+ A +L +  +L+  R 
Sbjct: 65  ALMVTSIATLRAIEYVLGKPIHLFNKVKYMAGHSVGECVALCASGALTLYEVTQLLLIRS 124

Query: 121 KSMQEAVPPGLGSMVAIIG--LDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAV 178
           ++M +AVP G G M A+IG  L+D  V+++   A   G+CEIANDN  GQVV+SG++ A+
Sbjct: 125 QAMYDAVPLGYGGMCALIGGSLED--VENVVKMAQEYGVCEIANDNCDGQVVVSGVKAAL 182

Query: 179 KCAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQD-PVVPILPNFCAS 237
           +   D   + G K+ + L VS PFHSSLM      ++  ++ +     P+V ++ N  A+
Sbjct: 183 EQLPDLIKDTGIKKVIKLQVSGPFHSSLMNSACDKLQQFIERIEDMKMPLVKVISNVSAT 242

Query: 238 PVSSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAV 297
             +    I  L+ +Q+  RVRWRE+I +    G     EVG+G  L+GL KRI  ++SAV
Sbjct: 243 EYTDCLMIKDLIAKQLISRVRWRESILYMIKQGCTCFIEVGAGTTLSGLVKRISPNVSAV 302

Query: 298 SISKVEDID 306
           S++    ID
Sbjct: 303 SVNTASCID 311


>gi|326203622|ref|ZP_08193486.1| malonyl CoA-acyl carrier protein transacylase [Clostridium
           papyrosolvens DSM 2782]
 gi|325986442|gb|EGD47274.1| malonyl CoA-acyl carrier protein transacylase [Clostridium
           papyrosolvens DSM 2782]
          Length = 310

 Score =  239 bits (611), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 124/304 (40%), Positives = 187/304 (61%), Gaps = 4/304 (1%)

Query: 7   FPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPALT 66
           FPGQG+Q +GMG+++ D +  A  +F+E    L  ++ ++++N   E L  T N QP + 
Sbjct: 8   FPGQGAQYVGMGKEIADEYKSAGKIFDEATEALGFDVREMIFNSDDETLKITENTQPTIV 67

Query: 67  AVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQEA 126
             S+A ++ + + G  +K D  +VAG SLGEY A  AA   S  D + LV+ RGK MQEA
Sbjct: 68  TTSIACMQPLLEKG--IKPD--FVAGLSLGEYAAHVAAGTVSFKDAVSLVKKRGKYMQEA 123

Query: 127 VPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAADTCL 186
           VP G+G+M AIIGL++  V   C +AS +GI E AN N  GQ+V++G   AV+ AA+ C 
Sbjct: 124 VPLGVGAMAAIIGLENDDVIECCKEASEIGIVEPANFNCPGQIVVAGETAAVEKAAELCK 183

Query: 187 NKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSIDEIS 246
            KGAKRA+ LPVSAPFH SL+ P  + +   L+ V+ +D  +P++ N     V+    + 
Sbjct: 184 TKGAKRAMLLPVSAPFHCSLLKPAGEKLAAELEKVSFKDMKIPVVSNVTGDAVTDKSMVK 243

Query: 247 RLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVEDID 306
            LL+ QV+  V W + I    + GV +  E+G GKVL+G  K+IDK+++ ++I  +E ++
Sbjct: 244 ELLIRQVSTSVLWEKCISTMLDKGVNTFVEIGPGKVLSGFVKKIDKNVTVINIENLETLN 303

Query: 307 LALR 310
            AL 
Sbjct: 304 KALE 307


>gi|30263855|ref|NP_846232.1| acyl-carrier-protein S-malonyltransferase [Bacillus anthracis str.
           Ames]
 gi|47529281|ref|YP_020630.1| acyl-carrier-protein S-malonyltransferase [Bacillus anthracis str.
           'Ames Ancestor']
 gi|49186702|ref|YP_029954.1| acyl-carrier-protein S-malonyltransferase [Bacillus anthracis str.
           Sterne]
 gi|65321180|ref|ZP_00394139.1| COG0331: (acyl-carrier-protein) S-malonyltransferase [Bacillus
           anthracis str. A2012]
 gi|165873289|ref|ZP_02217897.1| malonyl CoA-acyl carrier protein transacylase [Bacillus anthracis
           str. A0488]
 gi|167642022|ref|ZP_02400253.1| malonyl CoA-acyl carrier protein transacylase [Bacillus anthracis
           str. A0193]
 gi|170709346|ref|ZP_02899761.1| malonyl CoA-acyl carrier protein transacylase [Bacillus anthracis
           str. A0389]
 gi|177655961|ref|ZP_02937113.1| malonyl CoA-acyl carrier protein transacylase [Bacillus anthracis
           str. A0174]
 gi|190566053|ref|ZP_03018972.1| malonyl CoA-acyl carrier protein transacylase [Bacillus anthracis
           Tsiankovskii-I]
 gi|227813240|ref|YP_002813249.1| malonyl CoA-acyl carrier protein transacylase [Bacillus anthracis
           str. CDC 684]
 gi|229601809|ref|YP_002868089.1| malonyl CoA-acyl carrier protein transacylase [Bacillus anthracis
           str. A0248]
 gi|254735890|ref|ZP_05193596.1| malonyl CoA-acyl carrier protein transacylase [Bacillus anthracis
           str. Western North America USA6153]
 gi|254751169|ref|ZP_05203208.1| malonyl CoA-acyl carrier protein transacylase [Bacillus anthracis
           str. Vollum]
 gi|254756717|ref|ZP_05208746.1| malonyl CoA-acyl carrier protein transacylase [Bacillus anthracis
           str. Australia 94]
 gi|30258499|gb|AAP27718.1| malonyl CoA-acyl carrier protein transacylase [Bacillus anthracis
           str. Ames]
 gi|47504429|gb|AAT33105.1| malonyl CoA-acyl carrier protein transacylase [Bacillus anthracis
           str. 'Ames Ancestor']
 gi|49180629|gb|AAT56005.1| malonyl CoA-acyl carrier protein transacylase [Bacillus anthracis
           str. Sterne]
 gi|164710974|gb|EDR16543.1| malonyl CoA-acyl carrier protein transacylase [Bacillus anthracis
           str. A0488]
 gi|167510021|gb|EDR85436.1| malonyl CoA-acyl carrier protein transacylase [Bacillus anthracis
           str. A0193]
 gi|170125741|gb|EDS94653.1| malonyl CoA-acyl carrier protein transacylase [Bacillus anthracis
           str. A0389]
 gi|172079905|gb|EDT65012.1| malonyl CoA-acyl carrier protein transacylase [Bacillus anthracis
           str. A0174]
 gi|190562972|gb|EDV16938.1| malonyl CoA-acyl carrier protein transacylase [Bacillus anthracis
           Tsiankovskii-I]
 gi|227007316|gb|ACP17059.1| malonyl CoA-acyl carrier protein transacylase [Bacillus anthracis
           str. CDC 684]
 gi|229266217|gb|ACQ47854.1| malonyl CoA-acyl carrier protein transacylase [Bacillus anthracis
           str. A0248]
          Length = 314

 Score =  239 bits (611), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 127/311 (40%), Positives = 187/311 (60%), Gaps = 9/311 (2%)

Query: 7   FPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPALT 66
           FPGQGSQ +GMG+ L ++  E   VF + D  L  +LS++++ GSQE+LT T NAQPAL 
Sbjct: 8   FPGQGSQAVGMGKQLAENNKEVANVFAKADEVLQDSLSEVIFEGSQEKLTLTTNAQPALL 67

Query: 67  AVSMAFIRVMEKNGLCVKRDIS--YVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQ 124
             S A +  +++       DI+  +VAGHSLGEY+AL AA A +  D +  VR RG+ M+
Sbjct: 68  TTSFAILTALKE------YDITPDFVAGHSLGEYSALVAAGALTFEDAVYAVRKRGEYME 121

Query: 125 EAVPPGLGSMVAIIGLDDCVVDSICAQASRVGIC-EIANDNGGGQVVISGLQDAVKCAAD 183
           EAVP G G+M AI+G D  ++  +  + +  G   +IAN N   Q+VISG +  V+ A+ 
Sbjct: 122 EAVPGGEGAMAAILGADPHMLKRVTEEVTGEGYAVQIANMNSTKQIVISGTKQGVEIASQ 181

Query: 184 TCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSID 243
                GAKRA+ L VS PFHS+LM P ++  + +L+ +T QD  +P++ N  A  ++S  
Sbjct: 182 RAKENGAKRAIPLKVSGPFHSALMKPAAEKFQSVLNEITIQDTNIPVIANVTADVITSGA 241

Query: 244 EISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVE 303
            I   L+EQ+   V W  +I++  N GV +  E+G GKVL GL K ID S+ A +I   E
Sbjct: 242 HIQEKLIEQLYSPVLWYPSIEYMVNQGVDTFIEIGPGKVLAGLMKSIDSSVKAYAIYDEE 301

Query: 304 DIDLALRSIVG 314
            +   + ++ G
Sbjct: 302 TLKDTISNLRG 312


>gi|332799143|ref|YP_004460642.1| malonyl CoA-acyl carrier protein transacylase [Tepidanaerobacter
           sp. Re1]
 gi|332696878|gb|AEE91335.1| malonyl CoA-acyl carrier protein transacylase [Tepidanaerobacter
           sp. Re1]
          Length = 311

 Score =  239 bits (610), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 128/301 (42%), Positives = 188/301 (62%), Gaps = 4/301 (1%)

Query: 5   LTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPA 64
             FPGQG+Q +GMG+DLYD+FP AR +F+E D +L + +S++ +NG  E+L  T N QPA
Sbjct: 6   FIFPGQGAQNVGMGKDLYDNFPTARRIFDEADKSLKEKISEICFNGPDEKLQETINTQPA 65

Query: 65  LTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQ 124
           +   S+A   ++   G  +  DI  VAG S+GEY+AL AA++   +  + LV+ RGK MQ
Sbjct: 66  ILTHSIACFSILRDKG--IMPDI--VAGLSIGEYSALVAAESIEFNQAVPLVQKRGKYMQ 121

Query: 125 EAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAADT 184
           EAVP G G+M AI+GL+   V  IC  AS  GI + AN N  GQ+V++G   AVK A + 
Sbjct: 122 EAVPLGEGTMAAILGLEREEVLQICDTASEEGIVQAANFNCPGQIVLAGEVKAVKKAIEL 181

Query: 185 CLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSIDE 244
              +GAK+AV L VSAPFH SL+ P +  +   L+ V   D  +P++ N  A  V +  E
Sbjct: 182 AKARGAKKAVILAVSAPFHCSLLKPAADKLANELEKVEIMDSKIPVVSNVNAEIVRNNCE 241

Query: 245 ISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVED 304
           I +LL++QV   V W + I+   ++G +   EVG G+VL+G  K+I+KSL+ +++   E 
Sbjct: 242 IKQLLIKQVFSPVFWEDCIRCMIDYGAEIFIEVGPGRVLSGFMKKINKSLTVLNVEDAES 301

Query: 305 I 305
           +
Sbjct: 302 L 302


>gi|294500968|ref|YP_003564668.1| malonyl CoA-acyl carrier protein transacylase [Bacillus megaterium
           QM B1551]
 gi|294350905|gb|ADE71234.1| malonyl CoA-acyl carrier protein transacylase [Bacillus megaterium
           QM B1551]
          Length = 314

 Score =  239 bits (610), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 123/309 (39%), Positives = 186/309 (60%), Gaps = 5/309 (1%)

Query: 7   FPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPALT 66
           FPGQGSQ +GMG+DLYD   EA+ +    D  L  +LS++++ G QEELT T +AQPAL 
Sbjct: 8   FPGQGSQTVGMGKDLYDGTEEAKKLIHTADEALGFSLSNIIFEGPQEELTLTYHAQPALL 67

Query: 67  AVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQEA 126
             S   +   + +G+       +VAGHSLGEY+AL AA+  S  D +  V  RG+ M EA
Sbjct: 68  TTSTMLLEAFKTSGITP----DFVAGHSLGEYSALVAAEVLSFKDAVVAVHKRGRYMDEA 123

Query: 127 VPPGLGSMVAIIGLDDCVVDSICAQASRVG-ICEIANDNGGGQVVISGLQDAVKCAADTC 185
           VP G G+M A++G+    ++++ AQ +  G   ++AN N  GQ+VISG  + V+ A    
Sbjct: 124 VPAGQGTMAAVLGMSAEDLEAVTAQITSEGDAVQLANINCPGQIVISGTVNGVEKAGALA 183

Query: 186 LNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSIDEI 245
             KGAKR + L VS PFHSSLM P ++ ++  L++V   D  VP++ N  A PV+   +I
Sbjct: 184 KEKGAKRVIPLVVSGPFHSSLMKPAAEKLRDTLETVGFSDAKVPVIANVTAKPVTDSQDI 243

Query: 246 SRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVEDI 305
              LVEQ+   VRW ET++     GV +  E+G GKVL+GL K++++  +  +++ +  +
Sbjct: 244 QNKLVEQLYSPVRWEETVETLLAEGVDTFVEIGPGKVLSGLVKKVNRRATVYAVNDLTSL 303

Query: 306 DLALRSIVG 314
              + ++ G
Sbjct: 304 KSTIDALKG 312


>gi|116621716|ref|YP_823872.1| [Acyl-carrier-protein] S-malonyltransferase [Candidatus Solibacter
           usitatus Ellin6076]
 gi|116224878|gb|ABJ83587.1| [Acyl-carrier-protein] S-malonyltransferase [Candidatus Solibacter
           usitatus Ellin6076]
          Length = 310

 Score =  239 bits (610), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 135/304 (44%), Positives = 179/304 (58%), Gaps = 4/304 (1%)

Query: 3   TVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQ 62
           T   FPGQGSQ  GMG+ L D+   AR VFEE D  L   LS L + G +++L  T N Q
Sbjct: 5   TAFLFPGQGSQAPGMGKALADTHAAARRVFEEADDALGFPLSRLCFEGPEDQLKLTENTQ 64

Query: 63  PALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKS 122
           PAL  VS+A   V+ + G    R   YVAGHSLGEY+AL AA +   +D +RLVR RG+ 
Sbjct: 65  PALLTVSIAAFEVLRETG----RVPDYVAGHSLGEYSALVAAGSLRFADAVRLVRKRGQY 120

Query: 123 MQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAA 182
           MQEAVP G+G+M AI+ L +  +DSI A+A++  +   AN N   QVVI+G   AV  A 
Sbjct: 121 MQEAVPQGIGAMAAILKLPEGKLDSIIAEAAQGEVLSAANLNSPDQVVIAGHTGAVNRAC 180

Query: 183 DTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSI 242
           +     GAKRA+ LPVSAPFH +LM P  + ++  LD+    D   P++ N+ A  + + 
Sbjct: 181 ELAKAAGAKRAILLPVSAPFHCALMRPAQERLRADLDAAEFHDLTCPLVNNWQAREIRAA 240

Query: 243 DEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKV 302
            E    L +QV   VRW ETI++ A  G     EVG+G VLTGL + ID  L  V   + 
Sbjct: 241 AEAREGLYQQVPNPVRWVETIRYLAGQGTAGFVEVGAGSVLTGLLRAIDPKLQGVKFGEP 300

Query: 303 EDID 306
            D++
Sbjct: 301 ADLE 304


>gi|220928134|ref|YP_002505043.1| malonyl CoA-acyl carrier protein transacylase [Clostridium
           cellulolyticum H10]
 gi|219998462|gb|ACL75063.1| malonyl CoA-acyl carrier protein transacylase [Clostridium
           cellulolyticum H10]
          Length = 310

 Score =  239 bits (609), Expect = 5e-61,   Method: Compositional matrix adjust.
 Identities = 126/307 (41%), Positives = 191/307 (62%), Gaps = 4/307 (1%)

Query: 7   FPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPALT 66
           FPGQG+Q +GMG+++ D +  A  VF+E    L  ++ ++++NG  E L  T N QP + 
Sbjct: 8   FPGQGAQYVGMGKEIADEYKSASKVFDEATEALGFDVREMIFNGDDETLKITENTQPTIV 67

Query: 67  AVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQEA 126
             S+A ++ + + G  ++ D  +VAG SLGEY A   A   S  D + LV+ RGK MQEA
Sbjct: 68  TTSIACMQPLLEKG--IRPD--FVAGLSLGEYAAHVTAGTISFKDAVALVKKRGKYMQEA 123

Query: 127 VPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAADTCL 186
           VP G+G+M AIIGL++  V   C +AS+VGI E AN N  GQ+V++G + AV+ AA+ C 
Sbjct: 124 VPIGVGAMAAIIGLENNDVIECCKEASQVGIVEPANFNCPGQIVVAGEKAAVEKAAELCK 183

Query: 187 NKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSIDEIS 246
            KGAKRA+ LPVSAPFH SL+ P  + +   LD V+  D  +P++ N     V++ D + 
Sbjct: 184 AKGAKRAMLLPVSAPFHCSLLKPAGEKLAVELDMVSLNDIKIPVVTNVTGETVTNKDFVK 243

Query: 247 RLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVEDID 306
            LLV+QV+  V   ++I+   + GV +  E+G GKVL+G  K+ID+    +++  +E ++
Sbjct: 244 DLLVKQVSTSVLLEKSIRTMLDAGVDTFVEIGPGKVLSGFVKKIDRDAKVLNVENLETLN 303

Query: 307 LALRSIV 313
            AL  +V
Sbjct: 304 KALEVLV 310


>gi|332981626|ref|YP_004463067.1| (Acyl-carrier-protein) S-malonyltransferase [Mahella australiensis
           50-1 BON]
 gi|332699304|gb|AEE96245.1| (Acyl-carrier-protein) S-malonyltransferase [Mahella australiensis
           50-1 BON]
          Length = 311

 Score =  239 bits (609), Expect = 6e-61,   Method: Compositional matrix adjust.
 Identities = 127/310 (40%), Positives = 187/310 (60%), Gaps = 4/310 (1%)

Query: 5   LTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPA 64
             FPGQG+Q  GMG+ L   + E   +F+    TL  +++ L + G  E L  T   QP+
Sbjct: 6   FIFPGQGAQYAGMGQQLALRYAEVSEIFKAASETLGYDMAKLCFEGPDEVLKQTEITQPS 65

Query: 65  LTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQ 124
           +  VSMA  + +E NG  V  D++  AG SLGEY AL  A A   +D ++L+R RG+ MQ
Sbjct: 66  IFTVSMACAKALEING--VVPDMA--AGLSLGEYGALTVANAIDFADAVKLLRQRGRFMQ 121

Query: 125 EAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAADT 184
           EAVP G G+M AIIGLD   V+ +C +AS+ G+ E AN N  GQ+VISG   AV+ A++ 
Sbjct: 122 EAVPIGQGAMAAIIGLDKETVEQVCKEASKYGVVEPANYNCPGQIVISGQTVAVQKASEM 181

Query: 185 CLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSIDE 244
              KGAKRA+ L VSAPFH SL+      +  +L+SV+   P +P++ N  A  VSS ++
Sbjct: 182 AKEKGAKRAIMLEVSAPFHCSLLKSAGDRLAEVLESVSINKPAIPVIANVTAEEVSSPED 241

Query: 245 ISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVED 304
           I +LL+EQV+  VRW E+++     G  +  EVG GK L+G  K+I K +  +++  ++ 
Sbjct: 242 IRQLLIEQVSSPVRWEESVRRMMAMGADTFIEVGPGKALSGFVKKISKDVKVMNVEDIQS 301

Query: 305 IDLALRSIVG 314
           ++ A+  + G
Sbjct: 302 LESAISQLEG 311


>gi|323526871|ref|YP_004229024.1| malonyl CoA-acyl carrier protein transacylase [Burkholderia sp.
           CCGE1001]
 gi|323383873|gb|ADX55964.1| malonyl CoA-acyl carrier protein transacylase [Burkholderia sp.
           CCGE1001]
          Length = 311

 Score =  238 bits (608), Expect = 7e-61,   Method: Compositional matrix adjust.
 Identities = 135/299 (45%), Positives = 172/299 (57%), Gaps = 4/299 (1%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M     FPGQGSQ +GM     D  P  R   +E    LNQ+L  L+  G  E+L  T N
Sbjct: 1   MKFAFVFPGQGSQSVGMLNAFADQ-PIVRETVQEASDALNQDLGKLIAEGPAEDLNLTTN 59

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
            QP +   + A  R  ++ G       + VAGHSLGEYTAL AA A +  D + LVR R 
Sbjct: 60  TQPVMLTAAYAIYRAWQQAGGPAP---ALVAGHSLGEYTALVAAGAIAFRDAVPLVRFRA 116

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           ++MQ AVP G G M AI+GLDD  V ++CA+AS  G+ E  N N   QVVI+G + AV+ 
Sbjct: 117 QAMQTAVPVGEGGMAAILGLDDDTVRAVCAEASAAGVVEAVNFNAPSQVVIAGHKAAVEK 176

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A +    KGAKRA+ LPVSAPFHSSL+ P S  ++  L SV  Q P +P++ N   + V+
Sbjct: 177 ACEVAKAKGAKRALPLPVSAPFHSSLLKPASDQLREYLASVHVQVPSIPVINNVDVAIVN 236

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
              +I   LV Q  G VRW E++Q  A  GV  V E G GKVL GL KRID +L   S+
Sbjct: 237 EPAQIKDALVRQAAGAVRWVESVQAMAAQGVTHVVECGPGKVLAGLTKRIDGNLIGASV 295


>gi|167586619|ref|ZP_02379007.1| malonyl CoA-acyl carrier protein transacylase [Burkholderia
           ubonensis Bu]
          Length = 310

 Score =  238 bits (608), Expect = 7e-61,   Method: Compositional matrix adjust.
 Identities = 136/310 (43%), Positives = 177/310 (57%), Gaps = 4/310 (1%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M     FPGQGSQ +GM  + +      R   +E    LNQ+L  L+  G  EEL  T N
Sbjct: 1   MKFAFVFPGQGSQSVGM-LNAFADLAVVRETLQEASDALNQDLGKLIAEGPAEELNLTTN 59

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
            QP +   + A  R  ++ G       S VAGHSLGEYTAL AA A +  D + LVR R 
Sbjct: 60  TQPVMLTAAYACYRAWQEAGGPAP---SIVAGHSLGEYTALVAAGAIAFKDAVPLVRFRA 116

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           ++MQ AVP G G M AI+GLDD  V ++CA+A+  G+ E  N N   QVVI+G + AV+ 
Sbjct: 117 QAMQTAVPVGQGGMAAILGLDDDTVRAVCAEAAEAGVVEAVNFNAPAQVVIAGNKAAVEK 176

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A +    KGAKRA+ LPVSAPFHSSL+TP S  ++  L +V  + P +P++ N   + VS
Sbjct: 177 ACEIAKAKGAKRALPLPVSAPFHSSLLTPASDQLRDYLATVDVKAPQIPVVNNIDVAVVS 236

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
               I   LV Q  G VRW E ++  A  GV  V E G GKVL GL KRID +L+  S+ 
Sbjct: 237 DPAAIKDALVRQAAGPVRWVECVRHIAGTGVTHVIECGPGKVLAGLTKRIDANLTGASVF 296

Query: 301 KVEDIDLALR 310
               +D AL+
Sbjct: 297 DPASLDEALK 306


>gi|229157428|ref|ZP_04285506.1| Malonyl CoA-acyl carrier protein transacylase [Bacillus cereus ATCC
           4342]
 gi|228626155|gb|EEK82904.1| Malonyl CoA-acyl carrier protein transacylase [Bacillus cereus ATCC
           4342]
          Length = 314

 Score =  238 bits (608), Expect = 7e-61,   Method: Compositional matrix adjust.
 Identities = 126/311 (40%), Positives = 186/311 (59%), Gaps = 9/311 (2%)

Query: 7   FPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPALT 66
           FPGQGSQ +GMG+ L ++  E   VF + D  L  +LS++++ G QE+LT T NAQPAL 
Sbjct: 8   FPGQGSQAVGMGKQLAENNKEVANVFAKADEVLQDSLSEVIFEGPQEKLTLTTNAQPALL 67

Query: 67  AVSMAFIRVMEKNGLCVKRDIS--YVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQ 124
             S A +  +++       DI+  +VAGHSLGEY+AL AA A +  D +  VR RG+ M+
Sbjct: 68  TTSFAILTALKE------YDITPDFVAGHSLGEYSALVAAGALTFEDAVYAVRKRGEYME 121

Query: 125 EAVPPGLGSMVAIIGLDDCVVDSICAQASRVGIC-EIANDNGGGQVVISGLQDAVKCAAD 183
           EAVP G G+M AI+G D  ++  +  + +  G   +IAN N   Q+VISG +  V+ A+ 
Sbjct: 122 EAVPGGEGAMAAILGADPHMLKQVTEEVTSEGYAVQIANMNSTKQIVISGTKQGVEIASQ 181

Query: 184 TCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSID 243
                GAKRA+ L VS PFHS+LM P ++  + +L+ +T QD  +P++ N  A  ++S  
Sbjct: 182 RAKENGAKRAIPLKVSGPFHSALMKPAAEKFQSVLNEITIQDTNIPVIANVTADVITSGA 241

Query: 244 EISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVE 303
            I   L+EQ+   V W  +I++  N GV +  E+G GKVL GL K ID S+ A +I   E
Sbjct: 242 HIQEKLIEQLYSPVLWYPSIEYMVNQGVDTFIEIGPGKVLAGLMKSIDSSVKAYAIYDEE 301

Query: 304 DIDLALRSIVG 314
            +   + ++ G
Sbjct: 302 TLKDTISNLRG 312


>gi|229019048|ref|ZP_04175888.1| Malonyl CoA-acyl carrier protein transacylase [Bacillus cereus
           AH1273]
 gi|229025294|ref|ZP_04181713.1| Malonyl CoA-acyl carrier protein transacylase [Bacillus cereus
           AH1272]
 gi|228735985|gb|EEL86561.1| Malonyl CoA-acyl carrier protein transacylase [Bacillus cereus
           AH1272]
 gi|228742250|gb|EEL92410.1| Malonyl CoA-acyl carrier protein transacylase [Bacillus cereus
           AH1273]
          Length = 314

 Score =  238 bits (608), Expect = 7e-61,   Method: Compositional matrix adjust.
 Identities = 127/309 (41%), Positives = 183/309 (59%), Gaps = 5/309 (1%)

Query: 7   FPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPALT 66
           FPGQGSQ +GMGR L ++  E   VF + D  L  +LS++++ G QE+LT T NAQPAL 
Sbjct: 8   FPGQGSQAVGMGRQLAENNNEVAKVFAKADEVLQDSLSEVIFEGPQEKLTLTTNAQPALL 67

Query: 67  AVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQEA 126
             S A +  +  N   +  D  +VAGHSLGEY+AL AA A +  D +  VR RG+ M+EA
Sbjct: 68  TTSFAILTAL--NEYDITPD--FVAGHSLGEYSALVAAGALTFEDAVYAVRKRGEYMEEA 123

Query: 127 VPPGLGSMVAIIGLDDCVVDSICAQASRVGIC-EIANDNGGGQVVISGLQDAVKCAADTC 185
           VP G G+M AI+G D  ++  +  + +  G   +IAN N   Q+VISG    V+ A+   
Sbjct: 124 VPGGEGAMAAILGADPEMLKQVTEEVTSEGYAVQIANMNSTKQIVISGTNQGVELASQRA 183

Query: 186 LNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSIDEI 245
              GAKRA+ L VS PFHSSLM P ++  + +L+ +T QD  +P++ N  A  ++   +I
Sbjct: 184 KENGAKRAIPLKVSGPFHSSLMKPAAERFQSVLNEITIQDTNIPVIANVTADVITRGTDI 243

Query: 246 SRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVEDI 305
              L+EQ+   V W  +I++  N GV +  E+G GKVL GL K ID S+ A +I   E +
Sbjct: 244 KEKLIEQLYSPVLWYPSIEYMVNQGVDTFIEIGPGKVLAGLMKSIDSSVKAYAIYDEETL 303

Query: 306 DLALRSIVG 314
              + ++ G
Sbjct: 304 KDTISNLRG 312


>gi|221214101|ref|ZP_03587074.1| malonyl CoA-acyl carrier protein transacylase [Burkholderia
           multivorans CGD1]
 gi|221166278|gb|EED98751.1| malonyl CoA-acyl carrier protein transacylase [Burkholderia
           multivorans CGD1]
          Length = 332

 Score =  238 bits (607), Expect = 8e-61,   Method: Compositional matrix adjust.
 Identities = 137/310 (44%), Positives = 176/310 (56%), Gaps = 4/310 (1%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M     FPGQGSQ +GM  + +      R   +E    LNQ+L  L+  G  EEL  T N
Sbjct: 23  MKFAFVFPGQGSQSVGM-LNAFADLAVVRETLQEASDALNQDLGKLIAEGPAEELNLTTN 81

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
            QP +   + A  R  ++ G       S VAGHSLGEYTAL AA A +  D + LVR R 
Sbjct: 82  TQPVMLTAAYACYRAWQQAGGPAP---SIVAGHSLGEYTALVAAGAIAFKDAVPLVRFRA 138

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           ++MQ AVP G G M AI+GLDD  V ++CA+AS  G+ E  N N   QVVI+G + AV+ 
Sbjct: 139 QAMQTAVPVGQGGMAAILGLDDDTVRAVCAEASSEGVVEAVNFNAPAQVVIAGAKAAVEK 198

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A +    KGAKRA+ LPVSAPFHSSL+ P S  ++  L +V  + P +P++ N   + VS
Sbjct: 199 ACEVAKAKGAKRALPLPVSAPFHSSLLKPASDQLRDYLANVEVKAPQIPVVNNIDVAVVS 258

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
               I   LV Q  G VRW E +Q  A  GV  V E G GKVL GL KRID +L+  S+ 
Sbjct: 259 DPAAIKDALVRQAAGPVRWVECVQHIAGTGVTHVIECGPGKVLAGLTKRIDGNLTGASVF 318

Query: 301 KVEDIDLALR 310
               +D AL+
Sbjct: 319 DPASLDEALK 328


>gi|324327749|gb|ADY23009.1| malonyl CoA-acyl carrier protein transacylase [Bacillus
           thuringiensis serovar finitimus YBT-020]
          Length = 314

 Score =  238 bits (607), Expect = 8e-61,   Method: Compositional matrix adjust.
 Identities = 125/311 (40%), Positives = 186/311 (59%), Gaps = 9/311 (2%)

Query: 7   FPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPALT 66
           FPGQGSQ +GMG+ L ++  E   VF + D  L  +LS++++ G QE+LT T NAQPAL 
Sbjct: 8   FPGQGSQAVGMGKQLAENNKEVANVFAKADEVLQDSLSEVIFEGPQEKLTLTTNAQPALL 67

Query: 67  AVSMAFIRVMEKNGLCVKRDIS--YVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQ 124
             S A +  +++       DI+  +VAGHSLGEY+AL AA A +  D +  VR RG+ M+
Sbjct: 68  TTSFAILTALKE------YDITPDFVAGHSLGEYSALVAAGALTFEDAVYAVRKRGEYME 121

Query: 125 EAVPPGLGSMVAIIGLDDCVVDSICAQASRVGIC-EIANDNGGGQVVISGLQDAVKCAAD 183
           EAVP G G+M AI+G D  ++  +  + +  G   +IAN N   Q+VISG +  V+ A+ 
Sbjct: 122 EAVPGGEGAMAAILGADPHMLKQVTEEVTSEGYAVQIANMNSTKQIVISGTKQGVEIASQ 181

Query: 184 TCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSID 243
                GAKRA+ L VS PFHS+LM P ++  + +L+ +T QD  +P++ N  A  ++S  
Sbjct: 182 RAKENGAKRAILLKVSGPFHSALMKPAAEKFQSVLNEITIQDTNIPVIANVTADVITSGA 241

Query: 244 EISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVE 303
            I   L+EQ+   V W  +I++  + GV +  E+G GKVL GL K ID S+ A +I   E
Sbjct: 242 HIQEKLIEQLYSPVLWYPSIEYMVSQGVDTFIEIGPGKVLAGLMKSIDSSVKAYAIYDEE 301

Query: 304 DIDLALRSIVG 314
            +   + ++ G
Sbjct: 302 TLQDTISNLRG 312


>gi|218904982|ref|YP_002452816.1| malonyl CoA-acyl carrier protein transacylase [Bacillus cereus
           AH820]
 gi|218538226|gb|ACK90624.1| malonyl CoA-acyl carrier protein transacylase [Bacillus cereus
           AH820]
          Length = 314

 Score =  238 bits (607), Expect = 8e-61,   Method: Compositional matrix adjust.
 Identities = 126/311 (40%), Positives = 187/311 (60%), Gaps = 9/311 (2%)

Query: 7   FPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPALT 66
           FPGQGSQ +GMG+ L ++  E   VF + D  L  +LS++++ G QE+LT T NAQPAL 
Sbjct: 8   FPGQGSQAVGMGKQLAENNKEVANVFAKADEVLQDSLSEVIFEGPQEKLTLTTNAQPALL 67

Query: 67  AVSMAFIRVMEKNGLCVKRDIS--YVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQ 124
             S A +  +++       DI+  +VAGHSLGEY+AL AA A + +D +  VR RG+ M+
Sbjct: 68  TTSFAILTALKE------YDITPDFVAGHSLGEYSALVAAGALTFADAVYAVRKRGEYME 121

Query: 125 EAVPPGLGSMVAIIGLDDCVVDSICAQASRVGIC-EIANDNGGGQVVISGLQDAVKCAAD 183
           EAVP G G+M AI+G D  ++  +  + +  G   +IAN N   Q+VISG +  V+ A+ 
Sbjct: 122 EAVPGGEGAMAAILGADPHMLKQVTEEVTGEGYAVQIANMNSTKQIVISGTKQGVEIASQ 181

Query: 184 TCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSID 243
                GAKRA+ L VS PFHS+LM P ++  + +L+ +T QD  +P++ N  A  ++S  
Sbjct: 182 RAKENGAKRAIPLKVSGPFHSALMKPAAEKFQSVLNEITIQDTNIPVIANVTADVITSGA 241

Query: 244 EISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVE 303
            I   L+EQ+   V W  +I++  N GV +  E+G GKVL GL K ID S+ A +I   E
Sbjct: 242 HIQEKLIEQLYSPVLWYPSIEYMVNQGVDTFIEIGPGKVLAGLMKSIDSSVKAYAIYDEE 301

Query: 304 DIDLALRSIVG 314
            +   + ++ G
Sbjct: 302 TLKDTISNLRG 312


>gi|254245923|ref|ZP_04939244.1| Malonyl CoA-acyl carrier protein transacylase [Burkholderia
           cenocepacia PC184]
 gi|124870699|gb|EAY62415.1| Malonyl CoA-acyl carrier protein transacylase [Burkholderia
           cenocepacia PC184]
          Length = 322

 Score =  238 bits (607), Expect = 8e-61,   Method: Compositional matrix adjust.
 Identities = 137/310 (44%), Positives = 175/310 (56%), Gaps = 4/310 (1%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M     FPGQGSQ IGM  D +      R   +E    LNQ+L  L+  G  EEL  T N
Sbjct: 13  MKFAFVFPGQGSQAIGM-LDAFADLAVVRETLQEASDALNQDLGKLIAEGPAEELNLTTN 71

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
            QP +   + A  R  ++ G       S VAGHSLGEYTAL AA A +  D + LVR R 
Sbjct: 72  TQPVMLTAAYACYRAWQQAGGPAP---SIVAGHSLGEYTALVAAGALAFKDAVPLVRFRA 128

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           ++MQ AVP G G M AI+GLDD  V ++CA+A+  G+ E  N N   QVVI+G + AV+ 
Sbjct: 129 QAMQTAVPVGQGGMAAILGLDDDTVRAVCAEAAEAGVVEAVNFNAPAQVVIAGSKAAVEK 188

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A +    KGAKRA+ LPVSAPFHSSL+ P S  ++  L +V  + P +P++ N   + VS
Sbjct: 189 ACEIAKAKGAKRALPLPVSAPFHSSLLKPASDQLRDYLANVDVKAPQIPVVNNIDVAVVS 248

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
               I   LV Q  G VRW E ++  A  GV  V E G GKVL GL KRID +L   S+ 
Sbjct: 249 DPAAIKDALVRQAAGPVRWVECVRHIAGTGVTHVVECGPGKVLAGLTKRIDGNLVGASVF 308

Query: 301 KVEDIDLALR 310
               +D AL+
Sbjct: 309 DPASLDEALK 318


>gi|325523016|gb|EGD01436.1| malonyl CoA-acyl carrier protein transacylase [Burkholderia sp.
           TJI49]
          Length = 310

 Score =  238 bits (607), Expect = 8e-61,   Method: Compositional matrix adjust.
 Identities = 137/310 (44%), Positives = 176/310 (56%), Gaps = 4/310 (1%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M     FPGQGSQ +GM  + +      R   +E    LNQ+L  L+  G  EEL  T N
Sbjct: 1   MKFAFVFPGQGSQSVGM-LNAFADLAVVRETLQEASDALNQDLGKLIAEGPAEELNLTTN 59

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
            QP +   + A  R  ++ G       S VAGHSLGEYTAL AA A +  D + LVR R 
Sbjct: 60  TQPVMLTAAYACYRAWQQAGGPAP---SIVAGHSLGEYTALVAAGAIAFRDAVPLVRFRA 116

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           ++MQ AVP G G M AI+GLDD  V ++CA+AS  G+ E  N N   QVVI+G + AV+ 
Sbjct: 117 QAMQTAVPVGQGGMAAILGLDDDTVRAVCAEASSEGVVEAVNFNAPAQVVIAGAKAAVEK 176

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A +    KGAKRA+ LPVSAPFHSSL+ P S  ++  L SV  + P +P++ N   + V+
Sbjct: 177 ACEVAKAKGAKRALPLPVSAPFHSSLLKPASDQLRDYLASVDVKAPQIPVVNNIDVAVVA 236

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
               I   LV Q  G VRW E +Q  A  GV  V E G GKVL GL KRID +L+  S+ 
Sbjct: 237 DPAAIKDALVRQAAGPVRWVECVQHIAGTGVTHVIECGPGKVLAGLTKRIDGNLTGASVF 296

Query: 301 KVEDIDLALR 310
               +D AL+
Sbjct: 297 DPASLDEALK 306


>gi|107022198|ref|YP_620525.1| malonyl CoA-acyl carrier protein transacylase [Burkholderia
           cenocepacia AU 1054]
 gi|105892387|gb|ABF75552.1| [Acyl-carrier-protein] S-malonyltransferase [Burkholderia
           cenocepacia AU 1054]
          Length = 310

 Score =  238 bits (607), Expect = 9e-61,   Method: Compositional matrix adjust.
 Identities = 137/310 (44%), Positives = 175/310 (56%), Gaps = 4/310 (1%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M     FPGQGSQ IGM  D +      R   +E    LNQ+L  L+  G  EEL  T N
Sbjct: 1   MKFAFVFPGQGSQAIGM-LDAFADLAVVRETLQEASDALNQDLGKLIAEGPAEELNLTTN 59

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
            QP +   + A  R  ++ G       S VAGHSLGEYTAL AA A +  D + LVR R 
Sbjct: 60  TQPVMLTAAYACYRAWQQAGGPAP---SIVAGHSLGEYTALVAAGALAFKDAVPLVRFRA 116

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           ++MQ AVP G G M AI+GLDD  V ++CA+A+  G+ E  N N   QVVI+G + AV+ 
Sbjct: 117 QAMQTAVPVGQGGMAAILGLDDDAVRAVCAEAAEAGVVEAVNFNAPAQVVIAGSKAAVEK 176

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A +    KGAKRA+ LPVSAPFHSSL+ P S  ++  L +V  + P +P++ N   + VS
Sbjct: 177 ACEIAKAKGAKRALPLPVSAPFHSSLLKPASDQLRDYLANVDVKAPQIPVVNNIDVAVVS 236

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
               I   LV Q  G VRW E ++  A  GV  V E G GKVL GL KRID +L   S+ 
Sbjct: 237 DPAAIKDALVRQAAGPVRWVECVRHIAGTGVTHVIECGPGKVLAGLTKRIDGNLVGASVF 296

Query: 301 KVEDIDLALR 310
               +D AL+
Sbjct: 297 DPASLDEALK 306


>gi|295677188|ref|YP_003605712.1| malonyl CoA-acyl carrier protein transacylase [Burkholderia sp.
           CCGE1002]
 gi|295437031|gb|ADG16201.1| malonyl CoA-acyl carrier protein transacylase [Burkholderia sp.
           CCGE1002]
          Length = 311

 Score =  238 bits (607), Expect = 9e-61,   Method: Compositional matrix adjust.
 Identities = 134/299 (44%), Positives = 172/299 (57%), Gaps = 4/299 (1%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M     FPGQGSQ +GM  + +      R   +E    LNQ+L  L+  G  E+L  T N
Sbjct: 1   MKFAFVFPGQGSQAVGM-LNAFADHAVVRETVQEASDALNQDLGKLIAEGPAEDLNLTTN 59

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
            QP +   + A  R  ++ G    R  + VAGHSLGEYTAL AA A +  D + LVR R 
Sbjct: 60  TQPVMLTAAYAVYRAWQQAG---GRTPAIVAGHSLGEYTALVAAGALAFRDAVPLVRFRA 116

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           ++MQ AVP G G M AI+GLDD  V ++CA+AS  G+ E  N N   QVVI+G + AV+ 
Sbjct: 117 QAMQTAVPVGEGGMAAILGLDDDTVRAVCAEASVAGVVEAVNFNAPAQVVIAGHKAAVEK 176

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A +    KGAKRA+ LPVSAPFHSSL+ P S  ++  L S+  Q P +P++ N   + V+
Sbjct: 177 ACEVAKAKGAKRALSLPVSAPFHSSLLKPASDQLREYLASIDVQVPSIPVINNVDVAVVN 236

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
              +I   LV Q  G VRW E +Q  A  GV  V E G GKVL GL KRID SL   S+
Sbjct: 237 EPAKIKDALVRQAAGPVRWVECVQAMAAQGVTHVIECGPGKVLAGLTKRIDGSLVGTSV 295


>gi|116689144|ref|YP_834767.1| malonyl CoA-acyl carrier protein transacylase [Burkholderia
           cenocepacia HI2424]
 gi|116647233|gb|ABK07874.1| [Acyl-carrier-protein] S-malonyltransferase [Burkholderia
           cenocepacia HI2424]
          Length = 310

 Score =  238 bits (607), Expect = 9e-61,   Method: Compositional matrix adjust.
 Identities = 137/310 (44%), Positives = 175/310 (56%), Gaps = 4/310 (1%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M     FPGQGSQ IGM  D +      R   +E    LNQ+L  L+  G  EEL  T N
Sbjct: 1   MKFAFVFPGQGSQAIGM-LDAFADLAVVRETLQEASDALNQDLGKLIAEGPAEELNLTTN 59

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
            QP +   + A  R  ++ G       S VAGHSLGEYTAL AA A +  D + LVR R 
Sbjct: 60  TQPVMLTAAYACYRAWQQAGGPAP---SIVAGHSLGEYTALVAAGALAFKDAVPLVRFRA 116

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           ++MQ AVP G G M AI+GLDD  V ++CA+A+  G+ E  N N   QVVI+G + AV+ 
Sbjct: 117 QAMQTAVPVGQGGMAAILGLDDDTVRAVCAEAAEAGVVEAVNFNAPAQVVIAGSKAAVEK 176

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A +    KGAKRA+ LPVSAPFHSSL+ P S  ++  L +V  + P +P++ N   + VS
Sbjct: 177 ACEIAKAKGAKRALPLPVSAPFHSSLLKPASDQLRDYLANVDVKAPQIPVVNNIDVAVVS 236

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
               I   LV Q  G VRW E ++  A  GV  V E G GKVL GL KRID +L   S+ 
Sbjct: 237 DPAAIKDALVRQAAGPVRWVECVRHIAGTGVTHVIECGPGKVLAGLTKRIDGNLVGASVF 296

Query: 301 KVEDIDLALR 310
               +D AL+
Sbjct: 297 DPASLDEALK 306


>gi|319649607|ref|ZP_08003763.1| acyl-carrier-protein S-malonyltransferase [Bacillus sp. 2_A_57_CT2]
 gi|317398769|gb|EFV79451.1| acyl-carrier-protein S-malonyltransferase [Bacillus sp. 2_A_57_CT2]
          Length = 315

 Score =  238 bits (607), Expect = 9e-61,   Method: Compositional matrix adjust.
 Identities = 126/298 (42%), Positives = 185/298 (62%), Gaps = 5/298 (1%)

Query: 7   FPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPALT 66
           FPGQGSQ  GMG+ L +   + +  FE  D  L  +LS L++ G QE+LT T NAQPAL 
Sbjct: 8   FPGQGSQAAGMGKALAEQDEKVKSFFESADQKLGFSLSQLIFEGPQEKLTLTTNAQPALL 67

Query: 67  AVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQEA 126
             S+A +   +++G+       +VAGHSLGEYTAL AA+A S  D +  VR RG+ M+EA
Sbjct: 68  TTSIAILDYFKRSGVAP----DFVAGHSLGEYTALVAAEALSFEDGVYAVRKRGEFMEEA 123

Query: 127 VPPGLGSMVAIIGLDDCVVDSICAQASRVG-ICEIANDNGGGQVVISGLQDAVKCAADTC 185
           VP G G+M A++GLD   + ++  + +  G   ++AN N  GQ+VISG +  V+ A+   
Sbjct: 124 VPNGEGTMAAVLGLDRDKLTAVTEEVTAGGNPVQLANLNCPGQIVISGSRAGVEQASAKA 183

Query: 186 LNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSIDEI 245
             +GAKR + L VS PFHS LM P ++  + +LD +  +D VVP++ N  AS ++S  EI
Sbjct: 184 KEEGAKRVLPLEVSGPFHSELMKPAAEKFRQVLDDIEIKDAVVPVIANVTASEMTSAAEI 243

Query: 246 SRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVE 303
           +  L+EQ+   V W ++I+     GV +  E+G GKVL+GL K++D+SL   ++S  E
Sbjct: 244 NSRLIEQLYSPVLWEDSIRRMIELGVDTFIEIGPGKVLSGLVKKVDRSLKTYAVSDAE 301


>gi|226313213|ref|YP_002773107.1| malonyl CoA-acyl carrier protein transacylase [Brevibacillus brevis
           NBRC 100599]
 gi|226096161|dbj|BAH44603.1| malonyl CoA-acyl carrier protein transacylase [Brevibacillus brevis
           NBRC 100599]
          Length = 316

 Score =  238 bits (607), Expect = 9e-61,   Method: Compositional matrix adjust.
 Identities = 128/303 (42%), Positives = 183/303 (60%), Gaps = 5/303 (1%)

Query: 5   LTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPA 64
             FPGQGSQ +GMG+ L +    AR +FE+ D  L  +LS L + G +EEL  T N QPA
Sbjct: 6   FVFPGQGSQFVGMGQALSEQSEAARHIFEQADEALGFSLSGLCFAGPEEELKLTANTQPA 65

Query: 65  LTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQ 124
           +   S+A +  +  N        ++VAGHSLGEY+AL AA A S +D ++ VRARG+ M+
Sbjct: 66  ILTASIAVMAAL--NEKLPDYKPAFVAGHSLGEYSALVAAGALSFADAVKTVRARGQFME 123

Query: 125 EAVPPGLGSMVAIIGLDDCVVDSICAQASRVG-ICEIANDNGGGQVVISGLQDAVKCAAD 183
           EAVP G G+M A++ +D   + ++C + +  G   ++AN N  GQ+VISG  + VK A +
Sbjct: 124 EAVPAGQGAMAAVLNMDRAALHAVCEEVTASGHPVQLANMNCPGQIVISGSAEGVKLAGE 183

Query: 184 TCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSID 243
                GAKR + L VS PFHSSLM P +  ++ +L  VT Q+  VP++ N  A PVS   
Sbjct: 184 KAKEAGAKRVLPLNVSGPFHSSLMQPAADKLQAVLAGVTVQEAAVPVVANVTARPVSEAT 243

Query: 244 EISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVE 303
            I   LV+QV+  V W +++QW    GV +  E+G GKVL GL K+I  + +  +I  V+
Sbjct: 244 IIVDQLVQQVSAPVLWEDSVQWMVEAGVTTFVEIGPGKVLAGLIKKIAPADT--TIISVQ 301

Query: 304 DID 306
           D+D
Sbjct: 302 DMD 304


>gi|212639599|ref|YP_002316119.1| (acyl-carrier-protein) S-malonyltransferase [Anoxybacillus
           flavithermus WK1]
 gi|212561079|gb|ACJ34134.1| (acyl-carrier-protein) S-malonyltransferase [Anoxybacillus
           flavithermus WK1]
          Length = 314

 Score =  238 bits (607), Expect = 9e-61,   Method: Compositional matrix adjust.
 Identities = 122/294 (41%), Positives = 188/294 (63%), Gaps = 5/294 (1%)

Query: 7   FPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPALT 66
           FPGQGSQ +GMG++  +   +   VF + D  L  +LS L++ G Q+ LT T NAQPAL 
Sbjct: 9   FPGQGSQTVGMGKEWAEKDEKVAAVFRQADERLQVSLSQLIFEGPQDVLTKTENAQPALL 68

Query: 67  AVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQEA 126
             S+AF++ +++  +       YVAGHSLGEY+AL AA   S SD +  VR RG+ M++A
Sbjct: 69  TTSIAFLQKVKEAHIAPH----YVAGHSLGEYSALVAASVLSFSDAVYAVRKRGELMEKA 124

Query: 127 VPPGLGSMVAIIGLDDCVVDSICAQAS-RVGICEIANDNGGGQVVISGLQDAVKCAADTC 185
           VP G G+M A++G+D+ ++  +  +AS      ++AN N  GQ+VISG ++AV+ A+   
Sbjct: 125 VPSGQGTMAAVLGMDEALLQQVVDEASTESSPVQLANLNCPGQIVISGAKEAVERASQLA 184

Query: 186 LNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSIDEI 245
             KGAKR + L VS PFHS LM P ++    +L++++ Q+  VP++ N  A P+++  EI
Sbjct: 185 KEKGAKRVIPLEVSGPFHSILMKPAAEQFLSVLNTLSFQESTVPVISNVTAEPMTNPTEI 244

Query: 246 SRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
            + LVEQ+   VRW +++Q   + GV +  E+G GKVL+GL K+I++ ++  SI
Sbjct: 245 KQRLVEQLYSPVRWEQSVQTMIDLGVDTFIEIGPGKVLSGLVKKINRHVNVYSI 298


>gi|49478416|ref|YP_037913.1| acyl-carrier-protein S-malonyltransferase [Bacillus thuringiensis
           serovar konkukian str. 97-27]
 gi|52141637|ref|YP_085193.1| acyl-carrier-protein S-malonyltransferase [Bacillus cereus E33L]
 gi|167636664|ref|ZP_02394954.1| malonyl CoA-acyl carrier protein transacylase [Bacillus anthracis
           str. A0442]
 gi|170689650|ref|ZP_02880831.1| malonyl CoA-acyl carrier protein transacylase [Bacillus anthracis
           str. A0465]
 gi|196035786|ref|ZP_03103188.1| malonyl CoA-acyl carrier protein transacylase [Bacillus cereus W]
 gi|196042320|ref|ZP_03109596.1| [acyl-carrier-protein] S-malonyltransferase [Bacillus cereus
           NVH0597-99]
 gi|228916489|ref|ZP_04080055.1| Malonyl CoA-acyl carrier protein transacylase [Bacillus
           thuringiensis serovar pulsiensis BGSC 4CC1]
 gi|228928900|ref|ZP_04091932.1| Malonyl CoA-acyl carrier protein transacylase [Bacillus
           thuringiensis serovar pondicheriensis BGSC 4BA1]
 gi|228935166|ref|ZP_04097993.1| Malonyl CoA-acyl carrier protein transacylase [Bacillus
           thuringiensis serovar andalousiensis BGSC 4AW1]
 gi|229123366|ref|ZP_04252570.1| Malonyl CoA-acyl carrier protein transacylase [Bacillus cereus
           95/8201]
 gi|254683440|ref|ZP_05147300.1| acyl-carrier-protein S-malonyltransferase [Bacillus anthracis str.
           CNEVA-9066]
 gi|254721383|ref|ZP_05183172.1| acyl-carrier-protein S-malonyltransferase [Bacillus anthracis str.
           A1055]
 gi|254739523|ref|ZP_05197220.1| acyl-carrier-protein S-malonyltransferase [Bacillus anthracis str.
           Kruger B]
 gi|301055343|ref|YP_003793554.1| acyl-carrier-protein S-malonyltransferase [Bacillus anthracis CI]
 gi|49329972|gb|AAT60618.1| malonyl CoA-acyl carrier protein transacylase [Bacillus
           thuringiensis serovar konkukian str. 97-27]
 gi|51975106|gb|AAU16656.1| malonyl CoA-acyl carrier protein transacylase [Bacillus cereus
           E33L]
 gi|167527915|gb|EDR90731.1| malonyl CoA-acyl carrier protein transacylase [Bacillus anthracis
           str. A0442]
 gi|170666395|gb|EDT17177.1| malonyl CoA-acyl carrier protein transacylase [Bacillus anthracis
           str. A0465]
 gi|195991435|gb|EDX55401.1| malonyl CoA-acyl carrier protein transacylase [Bacillus cereus W]
 gi|196026842|gb|EDX65473.1| [acyl-carrier-protein] S-malonyltransferase [Bacillus cereus
           NVH0597-99]
 gi|228660142|gb|EEL15778.1| Malonyl CoA-acyl carrier protein transacylase [Bacillus cereus
           95/8201]
 gi|228824531|gb|EEM70336.1| Malonyl CoA-acyl carrier protein transacylase [Bacillus
           thuringiensis serovar andalousiensis BGSC 4AW1]
 gi|228830707|gb|EEM76312.1| Malonyl CoA-acyl carrier protein transacylase [Bacillus
           thuringiensis serovar pondicheriensis BGSC 4BA1]
 gi|228843068|gb|EEM88150.1| Malonyl CoA-acyl carrier protein transacylase [Bacillus
           thuringiensis serovar pulsiensis BGSC 4CC1]
 gi|300377512|gb|ADK06416.1| acyl-carrier-protein S-malonyltransferase [Bacillus cereus biovar
           anthracis str. CI]
          Length = 314

 Score =  238 bits (607), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 126/311 (40%), Positives = 186/311 (59%), Gaps = 9/311 (2%)

Query: 7   FPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPALT 66
           FPGQGSQ +GMG+ L ++  E   VF + D  L  +LS++++ G QE+LT T NAQPAL 
Sbjct: 8   FPGQGSQAVGMGKQLAENNKEVANVFAKADEVLQDSLSEVIFEGPQEKLTLTTNAQPALL 67

Query: 67  AVSMAFIRVMEKNGLCVKRDIS--YVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQ 124
             S A +  +++       DI+  +VAGHSLGEY+AL AA A +  D +  VR RG+ M+
Sbjct: 68  TTSFAILTALKE------YDITPDFVAGHSLGEYSALVAAGALTFEDAVYAVRKRGEYME 121

Query: 125 EAVPPGLGSMVAIIGLDDCVVDSICAQASRVGIC-EIANDNGGGQVVISGLQDAVKCAAD 183
           EAVP G G+M AI+G D  ++  +  + +  G   +IAN N   Q+VISG +  V+ A+ 
Sbjct: 122 EAVPGGEGAMAAILGADPHMLKQVTEEVTGEGYAVQIANMNSTKQIVISGTKQGVEIASQ 181

Query: 184 TCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSID 243
                GAKRA+ L VS PFHS+LM P ++  + +L+ +T QD  +P++ N  A  ++S  
Sbjct: 182 RAKENGAKRAIPLKVSGPFHSALMKPAAEKFQSVLNEITIQDTNIPVIANVTADVITSGA 241

Query: 244 EISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVE 303
            I   L+EQ+   V W  +I++  N GV +  E+G GKVL GL K ID S+ A +I   E
Sbjct: 242 HIQEKLIEQLYSPVLWYPSIEYMVNQGVDTFIEIGPGKVLAGLMKSIDSSVKAYAIYDEE 301

Query: 304 DIDLALRSIVG 314
            +   + ++ G
Sbjct: 302 TLKDTISNLRG 312


>gi|170732432|ref|YP_001764379.1| malonyl CoA-acyl carrier protein transacylase [Burkholderia
           cenocepacia MC0-3]
 gi|169815674|gb|ACA90257.1| malonyl CoA-acyl carrier protein transacylase [Burkholderia
           cenocepacia MC0-3]
          Length = 310

 Score =  238 bits (607), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 137/310 (44%), Positives = 175/310 (56%), Gaps = 4/310 (1%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M     FPGQGSQ IGM  D +      R   +E    LNQ+L  L+  G  EEL  T N
Sbjct: 1   MKFAFVFPGQGSQAIGM-LDAFADLAVVRETLQEASDALNQDLGKLIAEGPAEELNLTTN 59

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
            QP +   + A  R  ++ G       S VAGHSLGEYTAL AA A +  D + LVR R 
Sbjct: 60  TQPVMLTAAYACYRAWQQAGGPAP---SIVAGHSLGEYTALVAAGALAFKDAVPLVRFRA 116

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           ++MQ AVP G G M AI+GLDD  V ++CA+A+  G+ E  N N   QVVI+G + AV+ 
Sbjct: 117 QAMQTAVPVGQGGMAAILGLDDDTVRAVCAEAAEAGVVEAVNFNAPAQVVIAGSKAAVEK 176

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A +    KGAKRA+ LPVSAPFHSSL+ P S  ++  L +V  + P +P++ N   + VS
Sbjct: 177 ACEIAKAKGAKRALPLPVSAPFHSSLLKPASDQLRDYLANVDVKAPQIPVVNNIDVAVVS 236

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
               I   LV Q  G VRW E ++  A  GV  V E G GKVL GL KRID +L   S+ 
Sbjct: 237 DPAAIKDALVRQAAGPVRWVECVRHIAGTGVTHVVECGPGKVLAGLTKRIDGNLVGASVF 296

Query: 301 KVEDIDLALR 310
               +D AL+
Sbjct: 297 DPASLDEALK 306


>gi|163941590|ref|YP_001646474.1| malonyl CoA-acyl carrier protein transacylase [Bacillus
           weihenstephanensis KBAB4]
 gi|229013035|ref|ZP_04170200.1| Malonyl CoA-acyl carrier protein transacylase [Bacillus mycoides
           DSM 2048]
 gi|163863787|gb|ABY44846.1| malonyl CoA-acyl carrier protein transacylase [Bacillus
           weihenstephanensis KBAB4]
 gi|228748289|gb|EEL98149.1| Malonyl CoA-acyl carrier protein transacylase [Bacillus mycoides
           DSM 2048]
          Length = 314

 Score =  238 bits (606), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 126/311 (40%), Positives = 187/311 (60%), Gaps = 9/311 (2%)

Query: 7   FPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPALT 66
           FPGQGSQ +GMGR L ++  E   VF + D  L+ +LS++++ G QE+LT T NAQPAL 
Sbjct: 8   FPGQGSQAVGMGRQLAENNKEVAKVFAKADEVLHDSLSEVIFEGPQEKLTLTTNAQPALL 67

Query: 67  AVSMAFIRVMEKNGLCVKRDIS--YVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQ 124
             S A +  +++       DI+  +VAGHSLGEY+AL AA A +  D +  VR RG+ M+
Sbjct: 68  TTSFAILTALKE------YDITPDFVAGHSLGEYSALVAAGALTFEDAVYAVRKRGEYME 121

Query: 125 EAVPPGLGSMVAIIGLDDCVVDSICAQASRVGIC-EIANDNGGGQVVISGLQDAVKCAAD 183
           EAVP G G+M AI+G D  ++  +  + +  G   +IAN N   Q+VISG +  V+ A+ 
Sbjct: 122 EAVPGGEGAMAAILGADPDMLKRVTEEVTSEGYAVQIANMNSTKQIVISGTKQGVELASQ 181

Query: 184 TCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSID 243
                GAKRA+ L VS PFHSSLM P ++  + +L+ +T QD  +P++ N  A  ++   
Sbjct: 182 RAKENGAKRAIPLKVSGPFHSSLMKPAAEKFQSVLNEITIQDTNIPVIANVTADVITRGT 241

Query: 244 EISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVE 303
           +I   L+EQ+   V W  +I++  N GV +  E+G GKVL GL K ID S+ A ++   E
Sbjct: 242 DIQAKLIEQLYSPVLWYPSIEYMVNQGVDTFIEIGPGKVLAGLMKSIDSSVKAYAVYDEE 301

Query: 304 DIDLALRSIVG 314
            +   + ++ G
Sbjct: 302 TLKDTISNLRG 312


>gi|222097297|ref|YP_002531354.1| malonyl CoA-acyl carrier protein transacylase [Bacillus cereus Q1]
 gi|221241355|gb|ACM14065.1| malonyl CoA-acyl carrier protein transacylase [Bacillus cereus Q1]
          Length = 314

 Score =  238 bits (606), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 126/311 (40%), Positives = 187/311 (60%), Gaps = 9/311 (2%)

Query: 7   FPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPALT 66
           FPGQGSQ +GMG+ L ++  E   VF + D  L  +LS++++ G QE+LT T NAQPAL 
Sbjct: 8   FPGQGSQAVGMGKQLAENNKEVANVFAKADEVLQDSLSEVIFEGPQEKLTLTTNAQPALL 67

Query: 67  AVSMAFIRVMEKNGLCVKRDIS--YVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQ 124
             S A +  +++       DI+  +VAGHSLGEY+AL AA A +  D +  VR RG+ M+
Sbjct: 68  TTSFAILTALKE------YDITPDFVAGHSLGEYSALVAAGALTFEDAVYAVRKRGEYME 121

Query: 125 EAVPPGLGSMVAIIGLDDCVVDSICAQASRVGIC-EIANDNGGGQVVISGLQDAVKCAAD 183
           EAVP G G+MVAI+G D  ++  +  + +  G   +IAN N   Q+VISG +  V+ A+ 
Sbjct: 122 EAVPGGEGAMVAILGADPHMLKQVTEEVTSEGYAVQIANMNSTKQIVISGTKQGVEIASQ 181

Query: 184 TCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSID 243
                GAKRA+ L VS PFHS+LM P ++  + +L+ +T QD  +P++ N  A  ++S  
Sbjct: 182 RAKENGAKRAIPLKVSGPFHSALMKPAAEKFQSVLNEITIQDTNIPVIANVTADVITSGA 241

Query: 244 EISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVE 303
            I   L+EQ+   V W  +I++  + GV +  E+G GKVL GL K ID S+ A +I   E
Sbjct: 242 HIQEKLIEQLYSPVLWYPSIEYMVSQGVDTFIEIGPGKVLVGLMKSIDSSVKAYAIYDEE 301

Query: 304 DIDLALRSIVG 314
            +   + ++ G
Sbjct: 302 TLQDTISNLRG 312


>gi|118479074|ref|YP_896225.1| [Acyl-carrier-protein] S-malonyltransferase [Bacillus thuringiensis
           str. Al Hakam]
 gi|196047423|ref|ZP_03114635.1| malonyl CoA-acyl carrier protein transacylase [Bacillus cereus
           03BB108]
 gi|225865833|ref|YP_002751211.1| malonyl CoA-acyl carrier protein transacylase [Bacillus cereus
           03BB102]
 gi|229186092|ref|ZP_04313261.1| Malonyl CoA-acyl carrier protein transacylase [Bacillus cereus BGSC
           6E1]
 gi|118418299|gb|ABK86718.1| [Acyl-carrier-protein] S-malonyltransferase [Bacillus thuringiensis
           str. Al Hakam]
 gi|196021731|gb|EDX60426.1| malonyl CoA-acyl carrier protein transacylase [Bacillus cereus
           03BB108]
 gi|225789525|gb|ACO29742.1| malonyl CoA-acyl carrier protein transacylase [Bacillus cereus
           03BB102]
 gi|228597268|gb|EEK54919.1| Malonyl CoA-acyl carrier protein transacylase [Bacillus cereus BGSC
           6E1]
          Length = 314

 Score =  238 bits (606), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 126/311 (40%), Positives = 186/311 (59%), Gaps = 9/311 (2%)

Query: 7   FPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPALT 66
           FPGQGSQ +GMG+ L ++  E   VF + D  L  +LS++++ G QE+LT T NAQPAL 
Sbjct: 8   FPGQGSQAVGMGKQLAENNKEVANVFAKADEVLQDSLSEVIFEGPQEKLTLTTNAQPALL 67

Query: 67  AVSMAFIRVMEKNGLCVKRDIS--YVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQ 124
             S A +  +++       DI+  +VAGHSLGEY+AL AA A +  D +  VR RG+ M+
Sbjct: 68  TTSFAILTALKE------YDITPDFVAGHSLGEYSALVAAGALTFEDAVYAVRKRGEYME 121

Query: 125 EAVPPGLGSMVAIIGLDDCVVDSICAQASRVGIC-EIANDNGGGQVVISGLQDAVKCAAD 183
           EAVP G G+M AI+G D  ++  +  + +  G   +IAN N   Q+VISG +  V+ A+ 
Sbjct: 122 EAVPGGEGAMAAILGADPHMLKQVTEEVTGEGYAVQIANMNSTKQIVISGTKQGVEIASQ 181

Query: 184 TCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSID 243
                GAKRA+ L VS PFHS+LM P ++  + +L+ +T QD  +P++ N  A  ++S  
Sbjct: 182 RSKENGAKRAIPLKVSGPFHSALMKPAAEKFQSVLNEITIQDTNIPVIANVTADVITSGA 241

Query: 244 EISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVE 303
            I   L+EQ+   V W  +I++  N GV +  E+G GKVL GL K ID S+ A +I   E
Sbjct: 242 HIQEKLIEQLYSPVLWYPSIEYMVNQGVDTFIEIGPGKVLAGLMKSIDSSVKAYAIYDEE 301

Query: 304 DIDLALRSIVG 314
            +   + ++ G
Sbjct: 302 TLKDTISNLRG 312


>gi|307730539|ref|YP_003907763.1| malonyl CoA-acyl carrier protein transacylase [Burkholderia sp.
           CCGE1003]
 gi|307585074|gb|ADN58472.1| malonyl CoA-acyl carrier protein transacylase [Burkholderia sp.
           CCGE1003]
          Length = 311

 Score =  238 bits (606), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 136/313 (43%), Positives = 180/313 (57%), Gaps = 10/313 (3%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFE---EVDHTLNQNLSDLMWNGSQEELTA 57
           M     FPGQGSQ +GM     ++F +  +V E   E    LNQ+L  L+  G  E+L  
Sbjct: 1   MKFAFVFPGQGSQSVGM----LNAFADQAIVRETVQEASDALNQDLGKLIAEGPAEDLNL 56

Query: 58  TCNAQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVR 117
           T N QP +   + A  R  ++ G       + VAGHSLGEYTAL AA A +  D + LVR
Sbjct: 57  TTNTQPVMLTAAYAIYRAWQQAGGPTP---AIVAGHSLGEYTALVAAGAIAFRDAVPLVR 113

Query: 118 ARGKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDA 177
            R ++MQ AVP G G M AI+GLDD  V ++CA+AS  G+ E  N N   QVVI+G + A
Sbjct: 114 FRAQAMQTAVPVGEGGMAAILGLDDDTVRAVCAEASAAGVVEAVNFNAPAQVVIAGHKAA 173

Query: 178 VKCAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCAS 237
           V+ A +    KGAKRA+ LPVSAPFHSSL+ P S  ++  L SV  Q P +P++ N   +
Sbjct: 174 VEKACEVAKAKGAKRALPLPVSAPFHSSLLKPASDQLREYLASVNVQVPSIPVINNVDVA 233

Query: 238 PVSSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAV 297
            V+   +I   LV Q  G VRW E++Q  A  GV  V E G GKVL GL KRID +L+  
Sbjct: 234 IVNEPAQIKDALVRQAAGAVRWVESVQAMAAQGVTHVVECGPGKVLAGLTKRIDGNLTGA 293

Query: 298 SISKVEDIDLALR 310
           S+     ++  L+
Sbjct: 294 SVFDPASLEETLK 306


>gi|206559386|ref|YP_002230147.1| malonyl CoA-acyl carrier protein transacylase 2 [Burkholderia
           cenocepacia J2315]
 gi|206561212|ref|YP_002231977.1| malonyl CoA-acyl carrier protein transacylase 1 [Burkholderia
           cenocepacia J2315]
 gi|198035424|emb|CAR51300.1| malonyl CoA-acyl carrier protein transacylase 2 [Burkholderia
           cenocepacia J2315]
 gi|198037254|emb|CAR53176.1| malonyl CoA-acyl carrier protein transacylase 1 [Burkholderia
           cenocepacia J2315]
          Length = 310

 Score =  238 bits (606), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 136/310 (43%), Positives = 176/310 (56%), Gaps = 4/310 (1%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M     FPGQGSQ IGM  + +      R   +E    LNQ+L  L+  G  EEL  T N
Sbjct: 1   MKFAFVFPGQGSQAIGM-LNAFADLAVVRETLQEASDALNQDLGKLIAEGPAEELNLTTN 59

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
            QP +   + A  R  ++ G       S VAGHSLGEYTAL AA A +  D + LVR R 
Sbjct: 60  TQPVMLTAAYACYRAWQQAGGPAP---SIVAGHSLGEYTALVAAGALAFKDAVPLVRFRA 116

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           ++MQ AVP G G M AI+GLDD  V ++CA+A+  G+ E  N N   QVVI+G + AV+ 
Sbjct: 117 QAMQTAVPVGQGGMAAILGLDDDTVRAVCAEAAEAGVVEAVNFNAPAQVVIAGSKAAVEK 176

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A +    KGAKRA+ LPVSAPFHSSL+ P S  ++  L +V  + P +P++ N   + VS
Sbjct: 177 ACEIAKAKGAKRALPLPVSAPFHSSLLKPASDQLRDYLANVDVKAPQIPVVNNIDVAVVS 236

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
               I   LV Q  G VRW E ++  A  GV  V E G GKVL GL KRID +L+  S+ 
Sbjct: 237 DPAAIKDALVRQAAGPVRWVECVRHIAGTGVTHVIECGPGKVLAGLTKRIDGNLTGASVF 296

Query: 301 KVEDIDLALR 310
               +D AL+
Sbjct: 297 DPASLDEALK 306


>gi|317129242|ref|YP_004095524.1| malonyl CoA-acyl carrier protein transacylase [Bacillus
           cellulosilyticus DSM 2522]
 gi|315474190|gb|ADU30793.1| malonyl CoA-acyl carrier protein transacylase [Bacillus
           cellulosilyticus DSM 2522]
          Length = 315

 Score =  238 bits (606), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 125/311 (40%), Positives = 187/311 (60%), Gaps = 5/311 (1%)

Query: 5   LTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPA 64
           L FPGQGSQ +GMG++L+D + + + ++ E D  L ++LS L+++G +EEL  T N QPA
Sbjct: 6   LLFPGQGSQQVGMGKELFDLYEQTKNIYNEADDVLGESLSSLIFSGDEEELKKTENTQPA 65

Query: 65  LTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQ 124
           L   S++   V++  G+    +  Y AGHSLGEY+AL AA A S  D    VR RG+ M+
Sbjct: 66  LLTTSISIWEVLKSKGV----NPDYAAGHSLGEYSALVAAGAMSFQDACVAVRKRGQWME 121

Query: 125 EAVPPGLGSMVAIIGLDDCVVDSICAQASRV-GICEIANDNGGGQVVISGLQDAVKCAAD 183
           +AVP G G+M A++G+    +  +  +A++   I E AN N  GQ+VISG  + V+ A +
Sbjct: 122 QAVPKGKGTMAAVLGMKRDELTELTIEATKASNIVEPANFNCPGQIVISGTVEGVQAATE 181

Query: 184 TCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSID 243
               KGAKR + L VS PFHSSLM P ++ MK  LDS+    P + ++ N  A  V   +
Sbjct: 182 LAKEKGAKRVIPLSVSGPFHSSLMKPAAEKMKEHLDSIQIHAPQIQVVANVTADVVKDSE 241

Query: 244 EISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVE 303
            I +LL EQ+   V W +T+    N GV +  EVG GKVL+GL K++ +  + + +   E
Sbjct: 242 MIRQLLFEQIYSPVLWEDTLHRLVNDGVDTFIEVGPGKVLSGLVKKVSRRATVLPVFDQE 301

Query: 304 DIDLALRSIVG 314
            ++ AL ++ G
Sbjct: 302 TLEKALTTLGG 312


>gi|161525352|ref|YP_001580364.1| malonyl CoA-acyl carrier protein transacylase [Burkholderia
           multivorans ATCC 17616]
 gi|189349911|ref|YP_001945539.1| [acyl-carrier-protein] S-malonyltransferase [Burkholderia
           multivorans ATCC 17616]
 gi|160342781|gb|ABX15867.1| malonyl CoA-acyl carrier protein transacylase [Burkholderia
           multivorans ATCC 17616]
 gi|189333933|dbj|BAG43003.1| [acyl-carrier-protein] S-malonyltransferase [Burkholderia
           multivorans ATCC 17616]
          Length = 310

 Score =  237 bits (605), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 136/310 (43%), Positives = 176/310 (56%), Gaps = 4/310 (1%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M     FPGQGSQ +GM  + +      R   +E    LNQ+L  L+  G  EEL  T N
Sbjct: 1   MKFAFVFPGQGSQAVGM-LNAFADLAVVRETLQEASDALNQDLGKLIAEGPAEELNLTTN 59

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
            QP +   + A  R  ++ G       S VAGHSLGEYTAL AA A +  D + LVR R 
Sbjct: 60  TQPVMLTAAYACYRAWQQAGGPAP---SIVAGHSLGEYTALVAAGAIAFKDAVPLVRFRA 116

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           ++MQ AVP G G M AI+GLDD  V ++CA+AS  G+ E  N N   QVVI+G + AV+ 
Sbjct: 117 QAMQTAVPVGQGGMAAILGLDDDTVRAVCAEASSEGVVEAVNFNAPAQVVIAGAKAAVEK 176

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A +    KGAKRA+ LPVSAPFHSSL+ P S  ++  L +V  + P +P++ N   + VS
Sbjct: 177 ACEVAKAKGAKRALPLPVSAPFHSSLLKPASDQLRDYLANVEVKAPQIPVVNNIDVAVVS 236

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
               I   LV Q  G VRW E ++  A  GV  V E G GKVL GL KRID +L+  S+ 
Sbjct: 237 DPAAIKDALVRQAAGPVRWVECVKHIAGTGVTHVIECGPGKVLAGLTKRIDGNLTGASVF 296

Query: 301 KVEDIDLALR 310
               +D AL+
Sbjct: 297 DPASLDEALK 306


>gi|85374295|ref|YP_458357.1| malonyl CoA-acyl carrier protein transacylase [Erythrobacter
           litoralis HTCC2594]
 gi|84787378|gb|ABC63560.1| malonyl CoA-acyl carrier protein transacylase [Erythrobacter
           litoralis HTCC2594]
          Length = 312

 Score =  237 bits (605), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 146/307 (47%), Positives = 191/307 (62%), Gaps = 2/307 (0%)

Query: 7   FPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPALT 66
           FPGQGSQ +GMG DL D+   AR VFEEVD  L+Q LSD+M +G + +LT T NAQPA+ 
Sbjct: 6   FPGQGSQKVGMGADLADASAAARAVFEEVDDALSQTLSDIMRDGPEADLTLTENAQPAIM 65

Query: 67  AVSMAFIRVMEKN-GLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQE 125
           A ++A +RV+E++ G+ +      VAGHSLGEYTALCA  AFSL+DT RL++ RG++MQ 
Sbjct: 66  ANAIATLRVLEQDLGVSLVETGDCVAGHSLGEYTALCAVGAFSLADTARLLKLRGQAMQA 125

Query: 126 AVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAADTC 185
           AVP G G+M A++G D     ++   A++  +CEIANDN   QVVISG   A++ A    
Sbjct: 126 AVPVGEGAMAALLGADIEKATALAEAAAQGEVCEIANDNDPTQVVISGHTGAIERAVALV 185

Query: 186 LNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSIDEI 245
              G KR V LPVSAPFH SLM P +  M   L         +P+  N  A+ VS   E 
Sbjct: 186 KEHGIKRGVPLPVSAPFHCSLMQPAADAMAEALAETPPSSFSLPVYANVTAAKVSDPAEE 245

Query: 246 SRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVEDI 305
             LLV+QVTGRVRWRE++    + GV    E+G GKVL  +  RIDK     S   +ED+
Sbjct: 246 RDLLVQQVTGRVRWRESVLAMRDSGVAHFIELG-GKVLGPMVGRIDKEAQITSAITMEDL 304

Query: 306 DLALRSI 312
           +   + I
Sbjct: 305 EALAKEI 311


>gi|152976218|ref|YP_001375735.1| acyl-carrier-protein S-malonyltransferase [Bacillus cereus subsp.
           cytotoxis NVH 391-98]
 gi|152024970|gb|ABS22740.1| malonyl CoA-acyl carrier protein transacylase [Bacillus cytotoxicus
           NVH 391-98]
          Length = 316

 Score =  237 bits (605), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 125/309 (40%), Positives = 185/309 (59%), Gaps = 5/309 (1%)

Query: 7   FPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPALT 66
           FPGQGSQ +GMG+ L ++  +   VF++ D  LN+ LS +++ G QE+LT T NAQPAL 
Sbjct: 8   FPGQGSQAVGMGKQLAENNKKVAEVFQKADQVLNEPLSQVIFEGPQEKLTLTTNAQPALL 67

Query: 67  AVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQEA 126
             S A +  +  N   +  D  YVAGHSLGEY+AL A +A +  D +  VR RG+ M+EA
Sbjct: 68  TTSFAILTAL--NEYDITPD--YVAGHSLGEYSALVAVEALTFEDAVYAVRKRGEYMEEA 123

Query: 127 VPPGLGSMVAIIGLDDCVVDSICAQASRVG-ICEIANDNGGGQVVISGLQDAVKCAADTC 185
           VP G G+M AI+G D  ++  +  + +  G   +IAN N   Q+VISG +  V+ A+   
Sbjct: 124 VPGGEGAMAAILGADPNMLKQVTEEVTNEGHAVQIANMNSVKQIVISGTKQGVELASQKA 183

Query: 186 LNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSIDEI 245
             KGAKRA+ L VS PFHSSLM P ++  K +L+ +  QD  +P++ N  A  +++ +EI
Sbjct: 184 KEKGAKRAIPLRVSGPFHSSLMKPAAEKFKSVLNEIAIQDAKIPVIANVTADCMTNREEI 243

Query: 246 SRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVEDI 305
              L+EQ+   V W  ++++    GV +  E+G GKVL GL K ID S+   ++   E +
Sbjct: 244 QEKLIEQLYSPVLWYPSMEYMIEQGVDTFIEIGPGKVLAGLMKAIDSSVKVYTVYDEETL 303

Query: 306 DLALRSIVG 314
              + S+ G
Sbjct: 304 KDTISSLRG 312


>gi|229092894|ref|ZP_04224028.1| Malonyl CoA-acyl carrier protein transacylase [Bacillus cereus
           Rock3-42]
 gi|228690516|gb|EEL44299.1| Malonyl CoA-acyl carrier protein transacylase [Bacillus cereus
           Rock3-42]
          Length = 314

 Score =  237 bits (604), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 125/311 (40%), Positives = 186/311 (59%), Gaps = 9/311 (2%)

Query: 7   FPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPALT 66
           FPGQGSQ +GMG+ L ++  E   VF + D  L  +LS++++ G QE+LT T NAQPAL 
Sbjct: 8   FPGQGSQAVGMGKQLAENNKEVANVFAKADEVLQDSLSEVIFEGPQEKLTLTTNAQPALL 67

Query: 67  AVSMAFIRVMEKNGLCVKRDIS--YVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQ 124
             S A +  +++       D++  +VAGHSLGEY+AL AA A +  D +  VR RG+ M+
Sbjct: 68  TTSFAILTALKE------YDVTPDFVAGHSLGEYSALVAAGALTFEDAVYAVRKRGEYME 121

Query: 125 EAVPPGLGSMVAIIGLDDCVVDSICAQASRVGIC-EIANDNGGGQVVISGLQDAVKCAAD 183
           EAVP G G+M AI+G D  ++  +  + +  G   +IAN N   Q+VISG +  V+ A+ 
Sbjct: 122 EAVPGGEGAMAAILGADPHMLKQVTEEVTGEGYAVQIANMNSTKQIVISGTKQGVEIASQ 181

Query: 184 TCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSID 243
                GAKRA+ L VS PFHS+LM P ++  + +L+ +T QD  +P++ N  A  ++S  
Sbjct: 182 RAKENGAKRAIPLKVSGPFHSALMKPAAEKFQSVLNEITIQDTNIPVIANVTADVITSGA 241

Query: 244 EISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVE 303
            I   L+EQ+   V W  +I++  N GV +  E+G GKVL GL K ID S+ A +I   E
Sbjct: 242 HIQEKLIEQLYSPVLWYPSIEYMVNQGVDTFIEIGPGKVLAGLMKSIDSSVKAYAIYDEE 301

Query: 304 DIDLALRSIVG 314
            +   + ++ G
Sbjct: 302 TLKDTISNLRG 312


>gi|171319463|ref|ZP_02908567.1| malonyl CoA-acyl carrier protein transacylase [Burkholderia
           ambifaria MEX-5]
 gi|171095314|gb|EDT40297.1| malonyl CoA-acyl carrier protein transacylase [Burkholderia
           ambifaria MEX-5]
          Length = 310

 Score =  237 bits (604), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 136/310 (43%), Positives = 175/310 (56%), Gaps = 4/310 (1%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M     FPGQGSQ +GM  + +      R   +E    LNQ+L  L+  G  EEL  T N
Sbjct: 1   MKFAFVFPGQGSQSVGM-LNAFADLAVVRETLQEASDALNQDLGKLIAEGPAEELNLTTN 59

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
            QP +   + A  R  ++ G       S VAGHSLGEYTAL AA A +  D + LVR R 
Sbjct: 60  TQPVMLTAAYACYRAWQQAGGPAP---SIVAGHSLGEYTALVAAGAIAFKDAVPLVRFRA 116

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           ++MQ AVP G G M AI+GLDD  V ++CA+A+  G+ E  N N   QVVI+G + AV+ 
Sbjct: 117 QAMQTAVPVGQGGMAAILGLDDDTVRAVCAEAAEAGVVEAVNFNAPAQVVIAGAKAAVEK 176

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A +    KGAKRA+ LPVSAPFHSSL+ P S  ++  L +V  + P +P++ N   + V 
Sbjct: 177 ACEIAKAKGAKRALPLPVSAPFHSSLLKPASDQLRDYLANVDVKAPQIPVVNNIDVAVVG 236

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
               I   LV Q  G VRW E +Q  A  GV  V E G GKVL GL KRID +L  VS+ 
Sbjct: 237 DPAAIKDALVRQAAGPVRWVECVQHIAGTGVTHVIECGPGKVLAGLTKRIDGNLVGVSVF 296

Query: 301 KVEDIDLALR 310
               +D AL+
Sbjct: 297 DPASLDEALK 306


>gi|229197963|ref|ZP_04324677.1| Malonyl CoA-acyl carrier protein transacylase [Bacillus cereus
           m1293]
 gi|228585442|gb|EEK43546.1| Malonyl CoA-acyl carrier protein transacylase [Bacillus cereus
           m1293]
          Length = 314

 Score =  237 bits (604), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 125/311 (40%), Positives = 187/311 (60%), Gaps = 9/311 (2%)

Query: 7   FPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPALT 66
           FPGQGSQ +GMG+ L ++  E   VF + D  L  +LS++++ G QE+LT T NAQPAL 
Sbjct: 8   FPGQGSQAVGMGKQLAENNKEVANVFAKADEVLQDSLSEVIFEGPQEKLTLTTNAQPALL 67

Query: 67  AVSMAFIRVMEKNGLCVKRDIS--YVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQ 124
             S+A +  +++       DI+  +VAGHSLGEY+AL AA A +  D +  VR RG+ M+
Sbjct: 68  TTSLAILTALKE------YDITPDFVAGHSLGEYSALVAAGALTFEDAVYAVRKRGEYME 121

Query: 125 EAVPPGLGSMVAIIGLDDCVVDSICAQASRVGIC-EIANDNGGGQVVISGLQDAVKCAAD 183
           EAVP G G+M AI+G D  ++  +  + +  G   +IAN N   Q+VISG +  V+ A+ 
Sbjct: 122 EAVPGGEGAMAAILGADPHMLKQVTEEVTSEGYAVQIANMNSTKQIVISGTKQGVEIASQ 181

Query: 184 TCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSID 243
                GAKRA+ L VS PFHS+LM P ++  + +L+ +T QD  +P++ N  A  ++S  
Sbjct: 182 RAKEHGAKRAIPLKVSGPFHSALMKPAAEKFQSVLNEITIQDTNIPVIANVTADVITSGA 241

Query: 244 EISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVE 303
            I   L+EQ+   V W  +I++  + GV +  E+G GKVL GL K ID S+ A +I   E
Sbjct: 242 HIQEKLIEQLYSPVLWYPSIEYMVSQGVDTFIEIGPGKVLAGLMKSIDSSVKAYAIYDEE 301

Query: 304 DIDLALRSIVG 314
            +   + ++ G
Sbjct: 302 TLQDTISNLRG 312


>gi|221201339|ref|ZP_03574378.1| malonyl CoA-acyl carrier protein transacylase [Burkholderia
           multivorans CGD2M]
 gi|221208819|ref|ZP_03581817.1| malonyl CoA-acyl carrier protein transacylase [Burkholderia
           multivorans CGD2]
 gi|221171275|gb|EEE03724.1| malonyl CoA-acyl carrier protein transacylase [Burkholderia
           multivorans CGD2]
 gi|221178607|gb|EEE11015.1| malonyl CoA-acyl carrier protein transacylase [Burkholderia
           multivorans CGD2M]
          Length = 332

 Score =  236 bits (603), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 136/310 (43%), Positives = 176/310 (56%), Gaps = 4/310 (1%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M     FPGQGSQ +GM  + +      R   +E    LNQ+L  L+  G  EEL  T N
Sbjct: 23  MKFAFVFPGQGSQSVGM-LNAFADLAVVRETLQEASDALNQDLGKLIAEGPAEELNLTTN 81

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
            QP +   + A  R  ++ G       S VAGHSLGEYTAL AA A +  D + LVR R 
Sbjct: 82  TQPVMLTAAYACYRAWQQAGGPAP---SIVAGHSLGEYTALVAAGAIAFKDAVPLVRFRA 138

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           ++MQ AVP G G M AI+GLDD  V ++CA+AS  G+ E  N N   QVVI+G + AV+ 
Sbjct: 139 QAMQTAVPVGQGGMAAILGLDDDTVRAVCAEASSEGVVEAVNFNAPAQVVIAGAKAAVEK 198

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A +    KGAKRA+ LPVSAPFHSSL+ P S  ++  L +V  + P +P++ N   + VS
Sbjct: 199 ACEVAKAKGAKRALPLPVSAPFHSSLLKPASDQLRDYLANVEVKAPQIPVVNNIDVAVVS 258

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
               I   LV Q  G VRW E ++  A  GV  V E G GKVL GL KRID +L+  S+ 
Sbjct: 259 DPAAIKDALVRQAAGPVRWVECVKHIAGTGVTHVIECGPGKVLAGLTKRIDGNLTGASVF 318

Query: 301 KVEDIDLALR 310
               +D AL+
Sbjct: 319 DPASLDEALK 328


>gi|228947571|ref|ZP_04109861.1| Malonyl CoA-acyl carrier protein transacylase [Bacillus
           thuringiensis serovar monterrey BGSC 4AJ1]
 gi|228812091|gb|EEM58422.1| Malonyl CoA-acyl carrier protein transacylase [Bacillus
           thuringiensis serovar monterrey BGSC 4AJ1]
          Length = 314

 Score =  236 bits (603), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 125/311 (40%), Positives = 185/311 (59%), Gaps = 9/311 (2%)

Query: 7   FPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPALT 66
           FPGQGSQ +GMG+ L ++  E   VF + D  L  +LS++++ G QE+LT T NAQPAL 
Sbjct: 8   FPGQGSQAVGMGKQLAENNKEVANVFAKADEVLQDSLSEVIFEGPQEKLTLTTNAQPALL 67

Query: 67  AVSMAFIRVMEKNGLCVKRDIS--YVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQ 124
             S A +  +++       DI+  +VAGHSLGEY+AL AA A +  D +  VR RG+ M+
Sbjct: 68  TTSFAILTALKE------YDITPDFVAGHSLGEYSALVAAGALTFEDAVYAVRKRGEYME 121

Query: 125 EAVPPGLGSMVAIIGLDDCVVDSICAQASRVGIC-EIANDNGGGQVVISGLQDAVKCAAD 183
           EAVP G G+M AI+G D  ++  +  + +  G   +IAN N   Q+VISG +  V+ A+ 
Sbjct: 122 EAVPGGEGAMAAILGADPHMLKQVTEEVTGEGYAVQIANMNSTKQIVISGTKQGVEIASQ 181

Query: 184 TCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSID 243
                GAKRA+ L VS PFHS+ M P ++  + +L+ +T QD  +P++ N  A  ++S  
Sbjct: 182 RAKENGAKRAIPLKVSGPFHSAFMKPAAEKFQSVLNEITIQDTNIPVIANVTADVITSGA 241

Query: 244 EISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVE 303
            I   L+EQ+   V W  +I++  N GV +  E+G GKVL GL K ID S+ A +I   E
Sbjct: 242 HIQEKLIEQLYSPVLWYPSIEYMVNQGVDTFIEIGPGKVLAGLMKSIDSSVKAYAIYDEE 301

Query: 304 DIDLALRSIVG 314
            +   + ++ G
Sbjct: 302 TLKDTISNLRG 312


>gi|30021940|ref|NP_833571.1| acyl-carrier-protein S-malonyltransferase [Bacillus cereus ATCC
           14579]
 gi|229047539|ref|ZP_04193129.1| Malonyl CoA-acyl carrier protein transacylase [Bacillus cereus
           AH676]
 gi|229111323|ref|ZP_04240876.1| Malonyl CoA-acyl carrier protein transacylase [Bacillus cereus
           Rock1-15]
 gi|229129128|ref|ZP_04258101.1| Malonyl CoA-acyl carrier protein transacylase [Bacillus cereus
           BDRD-Cer4]
 gi|229146423|ref|ZP_04274794.1| Malonyl CoA-acyl carrier protein transacylase [Bacillus cereus
           BDRD-ST24]
 gi|229152051|ref|ZP_04280246.1| Malonyl CoA-acyl carrier protein transacylase [Bacillus cereus
           m1550]
 gi|296504347|ref|YP_003666047.1| acyl-carrier-protein S-malonyltransferase [Bacillus thuringiensis
           BMB171]
 gi|29897496|gb|AAP10772.1| Malonyl-CoA-[acyl-carrier-protein] transacylase [Bacillus cereus
           ATCC 14579]
 gi|228631400|gb|EEK88034.1| Malonyl CoA-acyl carrier protein transacylase [Bacillus cereus
           m1550]
 gi|228637056|gb|EEK93515.1| Malonyl CoA-acyl carrier protein transacylase [Bacillus cereus
           BDRD-ST24]
 gi|228654365|gb|EEL10230.1| Malonyl CoA-acyl carrier protein transacylase [Bacillus cereus
           BDRD-Cer4]
 gi|228672099|gb|EEL27390.1| Malonyl CoA-acyl carrier protein transacylase [Bacillus cereus
           Rock1-15]
 gi|228723786|gb|EEL75141.1| Malonyl CoA-acyl carrier protein transacylase [Bacillus cereus
           AH676]
 gi|296325399|gb|ADH08327.1| acyl-carrier-protein S-malonyltransferase [Bacillus thuringiensis
           BMB171]
          Length = 314

 Score =  236 bits (603), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 125/311 (40%), Positives = 185/311 (59%), Gaps = 9/311 (2%)

Query: 7   FPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPALT 66
           FPGQGSQ +GMG+ L ++  E   VF + D  L  +LS++++ G QE+LT T NAQPAL 
Sbjct: 8   FPGQGSQAVGMGKQLAENNKEVAKVFAKADEVLEDSLSEVIFEGPQEKLTLTTNAQPALL 67

Query: 67  AVSMAFIRVMEKNGLCVKRDIS--YVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQ 124
             S A +  +++       DI+  +VAGHSLGEY+AL AA A +  D +  VR RG+ M+
Sbjct: 68  TTSFAILTALKE------YDITPDFVAGHSLGEYSALVAAGALTFEDAVYAVRKRGEYME 121

Query: 125 EAVPPGLGSMVAIIGLDDCVVDSICAQASRVGIC-EIANDNGGGQVVISGLQDAVKCAAD 183
           EAVP G G+M AI+G D  ++  +  + +  G   +IAN N   Q+VISG +  V+ A+ 
Sbjct: 122 EAVPGGEGAMAAILGADPHMLKQVTEEVTSEGYAVQIANMNSTKQIVISGTKQGVEVASQ 181

Query: 184 TCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSID 243
                GAKRA+ L VS PFHSSLM P ++  + +L+ +T  D  +P++ N  A  ++   
Sbjct: 182 RAKENGAKRAIPLKVSGPFHSSLMKPAAEKFQSVLNEITIHDTNIPVIANVTAEVITRGA 241

Query: 244 EISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVE 303
           +I   L+EQ+   V W  +I++  N GV +  E+G GKVL GL K ID S+ A +I   E
Sbjct: 242 DIQEKLIEQLYSPVLWYPSIEYMVNQGVDTFIEIGPGKVLAGLMKSIDSSVKAYAIYDEE 301

Query: 304 DIDLALRSIVG 314
            +   + ++ G
Sbjct: 302 TLKDTISNLRG 312


>gi|229061455|ref|ZP_04198800.1| Malonyl CoA-acyl carrier protein transacylase [Bacillus cereus
           AH603]
 gi|228717878|gb|EEL69526.1| Malonyl CoA-acyl carrier protein transacylase [Bacillus cereus
           AH603]
          Length = 314

 Score =  236 bits (603), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 126/311 (40%), Positives = 186/311 (59%), Gaps = 9/311 (2%)

Query: 7   FPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPALT 66
           FPGQGSQ +GMGR L  +  E   VF + D  L+ +LS++++ G QE+LT T NAQPAL 
Sbjct: 8   FPGQGSQAVGMGRQLAGNNKEVAKVFAKADEVLHDSLSEVIFEGPQEKLTLTTNAQPALL 67

Query: 67  AVSMAFIRVMEKNGLCVKRDIS--YVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQ 124
             S A +  +++       DI+  +VAGHSLGEY+AL AA A +  D +  VR RG+ M+
Sbjct: 68  TTSFAILTALKE------YDITPDFVAGHSLGEYSALVAAGALTFEDAVYAVRKRGEYME 121

Query: 125 EAVPPGLGSMVAIIGLDDCVVDSICAQASRVGIC-EIANDNGGGQVVISGLQDAVKCAAD 183
           EAVP G G+M AI+G D  ++  +  + +  G   +IAN N   Q+VISG +  V+ A+ 
Sbjct: 122 EAVPGGEGAMAAILGADPDMLKRVTEEVTSEGYAVQIANMNSTKQIVISGTKQGVELASQ 181

Query: 184 TCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSID 243
                GAKRA+ L VS PFHSSLM P ++  + +L+ +T QD  +P++ N  A  ++   
Sbjct: 182 RAKENGAKRAIPLKVSGPFHSSLMKPAAEKFQSVLNEITIQDTNIPVIANVTADVITRGT 241

Query: 244 EISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVE 303
           +I   L+EQ+   V W  +I++  N GV +  E+G GKVL GL K ID S+ A ++   E
Sbjct: 242 DIQAKLIEQLYSPVLWYPSIEYMVNQGVDTFIEIGPGKVLAGLMKSIDSSVKAYAVYDEE 301

Query: 304 DIDLALRSIVG 314
            +   + ++ G
Sbjct: 302 TLKDTISNLRG 312


>gi|229134660|ref|ZP_04263469.1| Malonyl CoA-acyl carrier protein transacylase [Bacillus cereus
           BDRD-ST196]
 gi|228648706|gb|EEL04732.1| Malonyl CoA-acyl carrier protein transacylase [Bacillus cereus
           BDRD-ST196]
          Length = 314

 Score =  236 bits (603), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 126/311 (40%), Positives = 186/311 (59%), Gaps = 9/311 (2%)

Query: 7   FPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPALT 66
           FPGQGSQ +GMGR L ++  E   VF + D  L+ +LS +++ G QE+LT T NAQPAL 
Sbjct: 8   FPGQGSQAVGMGRQLAENNKEVAKVFAKADEVLHDSLSAVIFEGPQEKLTLTTNAQPALL 67

Query: 67  AVSMAFIRVMEKNGLCVKRDIS--YVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQ 124
             S A +  +++       DI+  +VAGHSLGEY+AL AA A +  D +  VR RG+ M+
Sbjct: 68  TTSFAILTALKE------YDITPDFVAGHSLGEYSALVAAGALTFEDAVYAVRKRGEYME 121

Query: 125 EAVPPGLGSMVAIIGLDDCVVDSICAQASRVGIC-EIANDNGGGQVVISGLQDAVKCAAD 183
           EAVP G G+M AI+G D  ++  +  + +  G   +IAN N   Q+VISG +  V+ A+ 
Sbjct: 122 EAVPGGEGAMAAILGADPDMLKRVTEEVTSEGYAVQIANMNSTKQIVISGTKQGVELASQ 181

Query: 184 TCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSID 243
                GAKRA+ L VS PFHSSLM P ++  + +L+ +T QD  +P++ N  A  ++   
Sbjct: 182 RAKENGAKRAIPLKVSGPFHSSLMKPAAEKFQSVLNEITIQDTNIPVIANVTADVITRGT 241

Query: 244 EISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVE 303
           +I   L+EQ+   V W  +I++  N GV +  E+G GKVL GL K ID S+ A ++   E
Sbjct: 242 DIQAKLIEQLYSPVLWYPSIEYMVNQGVDTFIEIGPGKVLAGLMKSIDSSVKAYAVYDEE 301

Query: 304 DIDLALRSIVG 314
            +   + ++ G
Sbjct: 302 TLKDTISNLRG 312


>gi|229031482|ref|ZP_04187482.1| Malonyl CoA-acyl carrier protein transacylase [Bacillus cereus
           AH1271]
 gi|228729771|gb|EEL80751.1| Malonyl CoA-acyl carrier protein transacylase [Bacillus cereus
           AH1271]
          Length = 314

 Score =  236 bits (603), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 127/311 (40%), Positives = 185/311 (59%), Gaps = 9/311 (2%)

Query: 7   FPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPALT 66
           FPGQGSQ +GMG+ L ++  E   VF + D  L  +LS++++ G QE+LT T NAQPAL 
Sbjct: 8   FPGQGSQAVGMGKQLAENNKEVANVFAKADEVLQDSLSEVIFEGPQEKLTLTTNAQPALL 67

Query: 67  AVSMAFIRVMEKNGLCVKRDIS--YVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQ 124
             S A +  +++       DI+  +VAGHSLGEY+AL AA A +  D +  VR RG+ M+
Sbjct: 68  TTSFAILTALKE------YDITPDFVAGHSLGEYSALVAAGAITFEDAVYAVRKRGEYME 121

Query: 125 EAVPPGLGSMVAIIGLDDCVVDSICAQASRVGIC-EIANDNGGGQVVISGLQDAVKCAAD 183
           EAVP G G+M AI+G D  ++  +  + +  G   +IAN N   Q+VISG +  V+ A+ 
Sbjct: 122 EAVPGGEGAMAAILGADPHMLKQVTEEVTSEGYAVQIANMNSTKQIVISGTKQGVEIASQ 181

Query: 184 TCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSID 243
                GAKRA+ L VS PFHSSLM P ++  + +L+ +T QD  +P++ N  A  ++S  
Sbjct: 182 RAKENGAKRAIPLKVSGPFHSSLMKPAAEKFQSVLNEITIQDTNIPVIANVTADVITSGA 241

Query: 244 EISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVE 303
            I   L+EQ+   V W  +I+   N GV +  E+G GKVL GL K ID S+ A +I   E
Sbjct: 242 HIQEKLIEQLYSPVLWYPSIENMVNQGVDTFIEIGPGKVLAGLMKSIDSSVKAYAIYDEE 301

Query: 304 DIDLALRSIVG 314
            +   + ++ G
Sbjct: 302 TLKDTISNLRG 312


>gi|238026605|ref|YP_002910836.1| Malonyl CoA-acyl carrier protein transacylase [Burkholderia glumae
           BGR1]
 gi|237875799|gb|ACR28132.1| Malonyl CoA-acyl carrier protein transacylase [Burkholderia glumae
           BGR1]
          Length = 310

 Score =  236 bits (603), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 137/310 (44%), Positives = 175/310 (56%), Gaps = 4/310 (1%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M     FPGQGSQ +GM  + +      R   +E    LNQ+L  L+  G  EEL  T N
Sbjct: 1   MKFAFVFPGQGSQSVGM-LNAFADLAVVRETVQEASDALNQDLGKLIAEGPAEELNLTAN 59

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
            QP +   + A  R  +  G       S VAGHSLGEYTAL AA A +  D + LVR R 
Sbjct: 60  TQPVMLTAAYACYRAWQAAGGPAP---SIVAGHSLGEYTALVAAGAIAFRDAVPLVRFRA 116

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           ++MQ AVP G G M AI+GLDD  V ++CA+AS  G+ E  N N   QVVI+G + AV+ 
Sbjct: 117 QAMQNAVPVGQGGMAAILGLDDDTVRAVCAEASAEGVVEAVNFNAPAQVVIAGAKAAVEK 176

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A +    KGAKRA+ LPVSAPFHSSL+ P S  ++  L SVT   P +P++ N   + VS
Sbjct: 177 ACELAKAKGAKRALPLPVSAPFHSSLLKPASDQLRDYLASVTVNAPAIPLVNNIDVAVVS 236

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
               I   LV Q  G VRW E ++  A  GV  + E G GKVL GL KRID +L+ VS+ 
Sbjct: 237 DPAAIKDALVRQAAGPVRWVECVRHIAGTGVTQLVECGPGKVLAGLTKRIDGTLTGVSVF 296

Query: 301 KVEDIDLALR 310
               +D  L+
Sbjct: 297 DPATLDDVLK 306


>gi|95929575|ref|ZP_01312317.1| malonyl CoA-acyl carrier protein transacylase [Desulfuromonas
           acetoxidans DSM 684]
 gi|95134272|gb|EAT15929.1| malonyl CoA-acyl carrier protein transacylase [Desulfuromonas
           acetoxidans DSM 684]
          Length = 305

 Score =  236 bits (603), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 122/305 (40%), Positives = 186/305 (60%), Gaps = 3/305 (0%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M     FPGQG+Q  GMG++L ++F  AR VFEE +  L  +L+ + + G +E+L  T N
Sbjct: 1   MMLAFIFPGQGAQHAGMGKELSENFSVAREVFEEANDALGFDLAKMCYEGPEEDLKLTAN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
            QPA+  +S+A +RV+++          +VAGHSLGEY+AL A+   + +D +  VR RG
Sbjct: 61  TQPAILTMSVAALRVLQQES---DLQADFVAGHSLGEYSALVASGGMTFADAVCTVRQRG 117

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
             MQ+AVP G G+M A++G+D   ++ ICA+A+   I   AN N  GQ+VI+G   AV+ 
Sbjct: 118 TFMQQAVPVGEGAMAAVLGVDGETLEKICAEAAGDQIVSPANFNSPGQIVIAGHTAAVER 177

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A +     GAK+A+ LPVSAPFH +LM P  + +  +LD+VT     +P++ N  AS  S
Sbjct: 178 AIELAKENGAKKAMPLPVSAPFHCALMKPAGEQLAGVLDAVTLSALAIPVVTNVEASANS 237

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
            +  +  LLV QV+  VRW E++++    GV+   E+G GKVL GL KRI++ +   ++ 
Sbjct: 238 DMARVKSLLVSQVSAPVRWDESVRYMVEQGVERFIEIGPGKVLCGLIKRIERRMPVANVE 297

Query: 301 KVEDI 305
            +  +
Sbjct: 298 NLASL 302


>gi|228960068|ref|ZP_04121732.1| Malonyl CoA-acyl carrier protein transacylase [Bacillus
           thuringiensis serovar pakistani str. T13001]
 gi|228799584|gb|EEM46537.1| Malonyl CoA-acyl carrier protein transacylase [Bacillus
           thuringiensis serovar pakistani str. T13001]
          Length = 314

 Score =  236 bits (603), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 125/311 (40%), Positives = 185/311 (59%), Gaps = 9/311 (2%)

Query: 7   FPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPALT 66
           FPGQGSQ +GMG+ L ++  E   VF + D  L  +LS++++ G QE+LT T NAQPAL 
Sbjct: 8   FPGQGSQAVGMGKQLAENNKEVAKVFAKADEVLKDSLSEVIFEGPQEKLTLTTNAQPALL 67

Query: 67  AVSMAFIRVMEKNGLCVKRDIS--YVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQ 124
             S A +  +++       DI+  +VAGHSLGEY+AL AA A +  D +  VR RG+ M+
Sbjct: 68  TTSFAILTALKE------YDITPDFVAGHSLGEYSALVAAGALTFEDAVYAVRKRGEYME 121

Query: 125 EAVPPGLGSMVAIIGLDDCVVDSICAQASRVGIC-EIANDNGGGQVVISGLQDAVKCAAD 183
           EAVP G G+M AI+G D  ++  +  + +  G   +IAN N   Q+VISG +  V+ A+ 
Sbjct: 122 EAVPGGEGAMAAILGADPHMLKQVTEEVTSEGYAVQIANMNSTKQIVISGTKQGVEVASQ 181

Query: 184 TCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSID 243
                GAKRA+ L VS PFHSSLM P ++  + +L+ +T  D  +P++ N  A  ++   
Sbjct: 182 RAKENGAKRAIPLKVSGPFHSSLMKPAAEKFQSVLNEITIHDTNIPVIANVTAEVITRGA 241

Query: 244 EISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVE 303
           +I   L+EQ+   V W  +I++  N GV +  E+G GKVL GL K ID S+ A +I   E
Sbjct: 242 DIQENLIEQLYSPVLWYPSIEYMVNQGVDTFIEIGPGKVLAGLMKSIDSSVKAYAIYDEE 301

Query: 304 DIDLALRSIVG 314
            +   + ++ G
Sbjct: 302 TLKDTISNLRG 312


>gi|237756332|ref|ZP_04584883.1| malonyl CoA-acyl carrier protein transacylase [Sulfurihydrogenibium
           yellowstonense SS-5]
 gi|237691502|gb|EEP60559.1| malonyl CoA-acyl carrier protein transacylase [Sulfurihydrogenibium
           yellowstonense SS-5]
          Length = 300

 Score =  236 bits (602), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 124/304 (40%), Positives = 179/304 (58%), Gaps = 7/304 (2%)

Query: 5   LTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPA 64
             FPGQGSQ +GMG+D+YDSF E R +  +V+  L  NL+++++N  +E+L  T   QPA
Sbjct: 4   FVFPGQGSQYVGMGKDIYDSFEEVREIHNKVNEKLGFNLTEIIFN-DEEKLNLTQYTQPA 62

Query: 65  LTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQ 124
           +   S    ++  K      R  S++AGHSLGE+TAL  A + S+ D + L   RG  MQ
Sbjct: 63  ILLTSYLIYKIFNKKN----RTPSFLAGHSLGEFTALTVAGSLSVEDAVYLTYIRGSLMQ 118

Query: 125 EAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAADT 184
            AVP G G M AIIGLD   ++ +       G+ EIAN N   Q VISG  +AVK A + 
Sbjct: 119 SAVPEGKGLMAAIIGLDANKIEEVLKTID--GVVEIANYNSYEQTVISGETEAVKKAMEV 176

Query: 185 CLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSIDE 244
             ++GAK+ V L VS P HSSL+   +K     ++     D  +P++ N  A+P++ + E
Sbjct: 177 LKSQGAKKVVPLAVSVPAHSSLLKEKAKEFAKYIEDTPFNDAKIPVISNITATPITKVQE 236

Query: 245 ISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVED 304
           I   L       VRW +T+++ AN+ VK+VYE+G  KVLTGL KRI+ +L   +I  ++D
Sbjct: 237 IKEELKAHFYSPVRWVQTVEFLANNDVKTVYEIGPKKVLTGLIKRINSNLELKNIETLQD 296

Query: 305 IDLA 308
           I+ A
Sbjct: 297 IENA 300


>gi|172060057|ref|YP_001807709.1| malonyl CoA-acyl carrier protein transacylase [Burkholderia
           ambifaria MC40-6]
 gi|171992574|gb|ACB63493.1| malonyl CoA-acyl carrier protein transacylase [Burkholderia
           ambifaria MC40-6]
          Length = 310

 Score =  236 bits (602), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 136/310 (43%), Positives = 174/310 (56%), Gaps = 4/310 (1%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M     FPGQGSQ +GM  + +      R   +E    LNQ+L  L+  G  EEL  T N
Sbjct: 1   MKFAFVFPGQGSQSVGM-LNAFADLAVVRETLQEASDALNQDLGKLIAEGPAEELNLTTN 59

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
            QP +   + A  R  ++ G       S VAGHSLGEYTAL AA A +  D + LVR R 
Sbjct: 60  TQPVMLTAAYACYRAWQQAGGPAP---SIVAGHSLGEYTALVAAGAIAFKDAVPLVRFRA 116

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           ++MQ AVP G G M AI+GLDD  V ++CA+A+  G+ E  N N   QVVI+G + AV+ 
Sbjct: 117 QAMQTAVPVGQGGMAAILGLDDDTVRAVCAEAAEAGVVEAVNFNAPAQVVIAGAKAAVEK 176

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A +    KGAKRA+ LPVSAPFHSSL+ P S  ++  L  V  + P +P++ N   + VS
Sbjct: 177 ACEIAKAKGAKRALPLPVSAPFHSSLLKPASDQLRDYLADVDVKAPQIPVVNNIDVAVVS 236

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
               I   LV Q  G VRW E +Q  A  GV  V E G GKVL GL KRID +L   S+ 
Sbjct: 237 DPAAIKDALVRQAAGPVRWVECMQHIAGTGVTHVIECGPGKVLAGLTKRIDGNLVGASVF 296

Query: 301 KVEDIDLALR 310
               +D AL+
Sbjct: 297 DPASLDEALK 306


>gi|217961272|ref|YP_002339840.1| malonyl CoA-acyl carrier protein transacylase [Bacillus cereus
           AH187]
 gi|228986995|ref|ZP_04147121.1| Malonyl CoA-acyl carrier protein transacylase [Bacillus
           thuringiensis serovar tochigiensis BGSC 4Y1]
 gi|229140497|ref|ZP_04269052.1| Malonyl CoA-acyl carrier protein transacylase [Bacillus cereus
           BDRD-ST26]
 gi|217063459|gb|ACJ77709.1| malonyl CoA-acyl carrier protein transacylase [Bacillus cereus
           AH187]
 gi|228643058|gb|EEK99334.1| Malonyl CoA-acyl carrier protein transacylase [Bacillus cereus
           BDRD-ST26]
 gi|228772773|gb|EEM21213.1| Malonyl CoA-acyl carrier protein transacylase [Bacillus
           thuringiensis serovar tochigiensis BGSC 4Y1]
          Length = 314

 Score =  236 bits (602), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 125/311 (40%), Positives = 186/311 (59%), Gaps = 9/311 (2%)

Query: 7   FPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPALT 66
           FPGQGSQ +GMG+ L ++  E   VF + D  L  +LS++++ G QE+LT T NAQPAL 
Sbjct: 8   FPGQGSQAVGMGKQLAENNKEVANVFAKADEVLQDSLSEVIFEGPQEKLTLTTNAQPALL 67

Query: 67  AVSMAFIRVMEKNGLCVKRDIS--YVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQ 124
             S A +  +++       DI+  +VAGHSLGEY+AL AA A +  D +  VR RG+ M+
Sbjct: 68  TTSFAILTALKE------YDITPDFVAGHSLGEYSALVAAGALTFEDAVYAVRKRGEYME 121

Query: 125 EAVPPGLGSMVAIIGLDDCVVDSICAQASRVGIC-EIANDNGGGQVVISGLQDAVKCAAD 183
           EAVP G G+M AI+G D  ++  +  + +  G   +IAN N   Q+VISG +  V+ A+ 
Sbjct: 122 EAVPGGEGAMAAILGADPHMLKQVTEEVTSEGYAVQIANMNSTKQIVISGTKQGVEIASQ 181

Query: 184 TCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSID 243
                GAKRA+ L VS PFHS+LM P ++  + +L+ +T QD  +P++ N  A  ++S  
Sbjct: 182 RAKEHGAKRAIPLKVSGPFHSALMKPAAEKFQSVLNEITIQDTNIPVIANVTADVITSGA 241

Query: 244 EISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVE 303
            I   L+EQ+   V W  +I++  + GV +  E+G GKVL GL K ID S+ A +I   E
Sbjct: 242 HIQEKLIEQLYSPVLWYPSIEYMVSQGVDTFIEIGPGKVLAGLMKSIDSSVKAYAIYDEE 301

Query: 304 DIDLALRSIVG 314
            +   + ++ G
Sbjct: 302 TLQDTISNLRG 312


>gi|188997073|ref|YP_001931324.1| malonyl CoA-acyl carrier protein transacylase [Sulfurihydrogenibium
           sp. YO3AOP1]
 gi|188932140|gb|ACD66770.1| malonyl CoA-acyl carrier protein transacylase [Sulfurihydrogenibium
           sp. YO3AOP1]
          Length = 301

 Score =  236 bits (602), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 125/306 (40%), Positives = 182/306 (59%), Gaps = 10/306 (3%)

Query: 5   LTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPA 64
             FPGQGSQ +GMG+D+YDSF E R +  +V+  L  NL+++++N  +E+L  T   QPA
Sbjct: 4   FVFPGQGSQYVGMGKDIYDSFEEVREIHNKVNEKLGFNLTEIIFN-DEEKLNLTQYTQPA 62

Query: 65  LTAVSMAFIRVMEKNGLCVKRDI--SYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKS 122
           +   S    ++        K++I  S++AGHSLGE+TAL  A + S+ D + L   RG  
Sbjct: 63  ILLTSYLIYKIFND-----KKNITPSFLAGHSLGEFTALTVAGSLSIEDAVYLTYIRGSL 117

Query: 123 MQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAA 182
           MQ AVP G G M AIIGLD   ++ +       G+ EIAN N   Q VISG  +AVK A 
Sbjct: 118 MQSAVPEGKGLMAAIIGLDANKIEEVLKTID--GVVEIANYNSYEQTVISGETEAVKKAM 175

Query: 183 DTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSI 242
           +   ++GAK+ V L VS P HSSL+   +K     ++     D  +P++ N  A+P++ +
Sbjct: 176 EVLKSQGAKKVVPLAVSVPAHSSLLKEKAKEFAKYIEDTPFNDAKIPVISNITATPITKV 235

Query: 243 DEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKV 302
            EI   L       VRW +T+++ AN+GVK+VYE+G  KVLTGL KRI+ +L   +I  +
Sbjct: 236 QEIKEELKAHFYSPVRWVQTVEFLANNGVKTVYEIGPKKVLTGLMKRINGNLELKNIETL 295

Query: 303 EDIDLA 308
           +DI+ A
Sbjct: 296 QDIENA 301


>gi|47570286|ref|ZP_00240935.1| malonyl CoA-acyl carrier protein transacylase [Bacillus cereus
           G9241]
 gi|47553050|gb|EAL11452.1| malonyl CoA-acyl carrier protein transacylase [Bacillus cereus
           G9241]
          Length = 314

 Score =  236 bits (602), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 125/311 (40%), Positives = 185/311 (59%), Gaps = 9/311 (2%)

Query: 7   FPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPALT 66
           FPGQGSQ +GMG+ L ++  E   VF + D  L  +LS++++ G QE+LT T NAQPAL 
Sbjct: 8   FPGQGSQAVGMGKQLAENNKEVANVFAKADEVLQDSLSEVIFEGPQEKLTLTTNAQPALL 67

Query: 67  AVSMAFIRVMEKNGLCVKRDIS--YVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQ 124
             S A +  +++       DI+  +VAGHSLGEY+AL AA A +  D +  VR RG+ M+
Sbjct: 68  TTSFAILTALKE------YDITPDFVAGHSLGEYSALVAAGALTFEDAVYAVRKRGEYME 121

Query: 125 EAVPPGLGSMVAIIGLDDCVVDSICAQASRVGIC-EIANDNGGGQVVISGLQDAVKCAAD 183
            AVP G G+M AI+G D  ++  +  + +  G   +IAN N   Q+VISG +  V+ A+ 
Sbjct: 122 AAVPGGEGAMAAILGADPHMLKQVTEEVTSEGYAVQIANMNSTKQIVISGTKQGVEIASQ 181

Query: 184 TCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSID 243
                GAKRA+ L VS PFHS+LM P ++  + +L+ +T QD  +P++ N  A  ++S  
Sbjct: 182 RAKENGAKRAIPLKVSGPFHSALMKPAAEKFQSVLNEITIQDTNIPVIANVTADVITSGA 241

Query: 244 EISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVE 303
            I + L+EQ+   V W  +I++  N GV +  E+G GKVL GL K ID S+ A +I   E
Sbjct: 242 HIQKKLIEQLYSPVLWYPSIEYMVNQGVDTFIEIGPGKVLAGLMKSIDSSVKAYAIYDEE 301

Query: 304 DIDLALRSIVG 314
            +   +  + G
Sbjct: 302 TLKDTISDLRG 312


>gi|42782944|ref|NP_980191.1| acyl-carrier-protein S-malonyltransferase [Bacillus cereus ATCC
           10987]
 gi|42738871|gb|AAS42799.1| malonyl CoA-acyl carrier protein transacylase [Bacillus cereus ATCC
           10987]
          Length = 314

 Score =  236 bits (601), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 125/311 (40%), Positives = 186/311 (59%), Gaps = 9/311 (2%)

Query: 7   FPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPALT 66
           FPGQGSQ +GMG+ L ++  E   VF + D  L  +LS++++ G QE+LT T NAQPAL 
Sbjct: 8   FPGQGSQAVGMGKQLAENNKEVANVFAKADEVLQDSLSEVIFEGPQEKLTLTTNAQPALL 67

Query: 67  AVSMAFIRVMEKNGLCVKRDIS--YVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQ 124
             S A +  +++       DI+  +VAGHSLGEY+AL AA A +  D +  VR RG+ M+
Sbjct: 68  TTSFAILTALKE------YDITPDFVAGHSLGEYSALVAAGALTFEDAVYAVRKRGEYME 121

Query: 125 EAVPPGLGSMVAIIGLDDCVVDSICAQASRVG-ICEIANDNGGGQVVISGLQDAVKCAAD 183
           EAVP G G+M AI+G D  ++  +  + +  G   +IAN N   Q+VISG +  V+ A+ 
Sbjct: 122 EAVPGGEGAMAAILGADPHMLKQVTEEVTSEGHAVQIANMNSTKQIVISGTKQGVEIASQ 181

Query: 184 TCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSID 243
                GAKRA+ L VS PFHS+LM P ++  + +L+ +T QD  +P++ N  A  ++S  
Sbjct: 182 RAKENGAKRAIPLKVSGPFHSALMKPAAEKFQSVLNEITIQDTNIPVIANVTADVITSGA 241

Query: 244 EISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVE 303
            I   L+EQ+   V W  +I++  + GV +  E+G GKVL GL K ID S+ A +I   E
Sbjct: 242 HIQEKLIEQLYSPVLWYPSIEYMVSQGVDTFIEIGPGKVLAGLMKSIDSSVKAYAIYDEE 301

Query: 304 DIDLALRSIVG 314
            +   + ++ G
Sbjct: 302 TLQDTISNLRG 312


>gi|229168591|ref|ZP_04296314.1| Malonyl CoA-acyl carrier protein transacylase [Bacillus cereus
           AH621]
 gi|228614997|gb|EEK72099.1| Malonyl CoA-acyl carrier protein transacylase [Bacillus cereus
           AH621]
          Length = 314

 Score =  236 bits (601), Expect = 5e-60,   Method: Compositional matrix adjust.
 Identities = 125/311 (40%), Positives = 186/311 (59%), Gaps = 9/311 (2%)

Query: 7   FPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPALT 66
           FPGQGSQ +GMGR L ++  E   VF + D  L+ +LS++++ G QE+LT T NAQPAL 
Sbjct: 8   FPGQGSQAVGMGRQLAENNKEVAKVFAKADEVLHDSLSEVIFEGPQEKLTLTTNAQPALL 67

Query: 67  AVSMAFIRVMEKNGLCVKRDIS--YVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQ 124
             S A +  +++       DI+  +VAGHSLGEY+AL AA A +  D +  VR RG+ M+
Sbjct: 68  TTSFAILTALKE------YDITPDFVAGHSLGEYSALVAAGALTFEDAVYAVRKRGEYME 121

Query: 125 EAVPPGLGSMVAIIGLDDCVVDSICAQASRVGIC-EIANDNGGGQVVISGLQDAVKCAAD 183
           EAVP G G+M AI+G D  ++  +  + +  G   +IAN N   Q+VISG +  V+ A+ 
Sbjct: 122 EAVPGGEGAMAAILGADPDMLKRVTEEVTSEGYAVQIANMNSTKQIVISGTKQGVELASQ 181

Query: 184 TCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSID 243
                GAKRA+ L VS PFHSSLM P ++  + +L+ +T QD  +P++ N  A  ++   
Sbjct: 182 RAKENGAKRAIPLKVSGPFHSSLMKPAAEKFQSVLNEITIQDTNIPVIANVTADVITRGT 241

Query: 244 EISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVE 303
           +I   L+EQ+   V W  +I++  N GV +  E+G GKVL GL K ID S+   ++   E
Sbjct: 242 DIQAKLIEQLYSPVLWYPSIEYMVNQGVDTFIEIGPGKVLAGLMKSIDSSVKVYAVYDEE 301

Query: 304 DIDLALRSIVG 314
            +   + ++ G
Sbjct: 302 TLRDTISNLRG 312


>gi|325294490|ref|YP_004281004.1| malonyl CoA-acyl carrier protein transacylase [Desulfurobacterium
           thermolithotrophum DSM 11699]
 gi|325064938|gb|ADY72945.1| malonyl CoA-acyl carrier protein transacylase [Desulfurobacterium
           thermolithotrophum DSM 11699]
          Length = 307

 Score =  236 bits (601), Expect = 5e-60,   Method: Compositional matrix adjust.
 Identities = 126/306 (41%), Positives = 183/306 (59%), Gaps = 3/306 (0%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M+    FPGQGSQ  GMG++L+D+FPEAR VFEE       +++ L +   +E+LT T N
Sbjct: 1   MAVAFIFPGQGSQYSGMGKELFDAFPEAREVFEEASEGAKVDIAKLCFEAPEEKLTLTYN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
           AQPA+  +SMA ++V+EK G     +   VAGHSLGE++A  AAK  S+ D   LVR RG
Sbjct: 61  AQPAIFTLSMAILKVLEKAGF--NEEPVLVAGHSLGEFSAAGAAKVISIHDGALLVRKRG 118

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           + MQEAVP G+G M A+IGL    ++ +     + G  ++AN N   Q VISG   A++ 
Sbjct: 119 EFMQEAVPAGVGGMTAVIGLTSKKIEEVLKNV-KSGFIQVANYNSPEQTVISGEIKALEE 177

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A +     GAK+ V L VSAPFHS LM P ++ +K +++ +  ++  VPIL N     + 
Sbjct: 178 AEEKLKEAGAKKVVRLAVSAPFHSELMKPAAEKLKELMEEIEFKEAEVPILNNADVRIIK 237

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
           + +EI      Q+   VRW E +      GV + YE+G   VL GL +RID+SL  +++ 
Sbjct: 238 TPEEIRDSFYRQMFSPVRWVEDVLKMKEMGVDTFYEIGPKNVLKGLIRRIDRSLKVINVE 297

Query: 301 KVEDID 306
           K +D++
Sbjct: 298 KPKDLE 303


>gi|228940940|ref|ZP_04103499.1| Malonyl CoA-acyl carrier protein transacylase [Bacillus
           thuringiensis serovar berliner ATCC 10792]
 gi|228973869|ref|ZP_04134445.1| Malonyl CoA-acyl carrier protein transacylase [Bacillus
           thuringiensis serovar thuringiensis str. T01001]
 gi|228980459|ref|ZP_04140769.1| Malonyl CoA-acyl carrier protein transacylase [Bacillus
           thuringiensis Bt407]
 gi|228779279|gb|EEM27536.1| Malonyl CoA-acyl carrier protein transacylase [Bacillus
           thuringiensis Bt407]
 gi|228785894|gb|EEM33897.1| Malonyl CoA-acyl carrier protein transacylase [Bacillus
           thuringiensis serovar thuringiensis str. T01001]
 gi|228818776|gb|EEM64842.1| Malonyl CoA-acyl carrier protein transacylase [Bacillus
           thuringiensis serovar berliner ATCC 10792]
 gi|326941621|gb|AEA17517.1| acyl-carrier-protein S-malonyltransferase [Bacillus thuringiensis
           serovar chinensis CT-43]
          Length = 314

 Score =  236 bits (601), Expect = 5e-60,   Method: Compositional matrix adjust.
 Identities = 125/311 (40%), Positives = 185/311 (59%), Gaps = 9/311 (2%)

Query: 7   FPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPALT 66
           FPGQGSQ +GMG+ L ++  E   VF + D  L  +LS++++ G QE+LT T NAQPAL 
Sbjct: 8   FPGQGSQAVGMGKQLAENNKEVAKVFAKADEVLEDSLSEVIFEGPQEKLTLTTNAQPALL 67

Query: 67  AVSMAFIRVMEKNGLCVKRDIS--YVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQ 124
             S A +  +++       DI+  +VAGHSLGEY+AL AA A +  D +  VR RG+ M+
Sbjct: 68  TTSFAILTALKE------YDITPDFVAGHSLGEYSALVAAGALTFEDAVYAVRKRGEYME 121

Query: 125 EAVPPGLGSMVAIIGLDDCVVDSICAQASRVGIC-EIANDNGGGQVVISGLQDAVKCAAD 183
           EAVP G G+M AI+G D  ++  +  + +  G   +IAN N   Q+VISG +  V+ A+ 
Sbjct: 122 EAVPGGEGAMAAILGADPHMLKQVTEEVTSEGYAVQIANMNSTKQIVISGTKQGVEDASQ 181

Query: 184 TCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSID 243
                GAKRA+ L VS PFHSSLM P ++  + +L+ +T  D  +P++ N  A  ++   
Sbjct: 182 RAKENGAKRAIPLKVSGPFHSSLMKPAAEKFQSVLNEITIHDTNIPVIANVTAEVITRGA 241

Query: 244 EISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVE 303
           +I   L+EQ+   V W  +I++  N GV +  E+G GKVL GL K ID S+ A +I   E
Sbjct: 242 DIQEKLIEQLYSPVLWYPSIEYMVNQGVDTFIEIGPGKVLAGLMKSIDSSVKAYAIYDEE 301

Query: 304 DIDLALRSIVG 314
            +   + ++ G
Sbjct: 302 TLKDTISNLRG 312


>gi|94971599|ref|YP_593647.1| [Acyl-carrier-protein] S-malonyltransferase [Candidatus Koribacter
           versatilis Ellin345]
 gi|94553649|gb|ABF43573.1| [Acyl-carrier-protein] S-malonyltransferase [Candidatus Koribacter
           versatilis Ellin345]
          Length = 321

 Score =  235 bits (600), Expect = 5e-60,   Method: Compositional matrix adjust.
 Identities = 125/307 (40%), Positives = 183/307 (59%), Gaps = 4/307 (1%)

Query: 7   FPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPALT 66
           FPGQGSQ +GMG++L   +P A+  F+E D  L   LS L W G +++L  T   QPA+ 
Sbjct: 12  FPGQGSQSVGMGKELAALYPVAQETFDEADAALGYRLSQLCWEGPEDQLKMTEITQPAIL 71

Query: 67  AVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQEA 126
             S+A  RV++  G+    +  YVAGHSLGEY+A  AA      D +R VR RGK MQEA
Sbjct: 72  TASVAVWRVLQSKGI----NPQYVAGHSLGEYSAHVAAGTLDFKDAVRTVRNRGKYMQEA 127

Query: 127 VPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAADTCL 186
           VP G+G+M A++ L    V  +C +A++  +C+ AN N   Q VISG + AV+ AA+   
Sbjct: 128 VPVGVGAMAAVLMLPADEVKKVCEEAAQGEVCQAANLNSPNQTVISGSKAAVERAAELAK 187

Query: 187 NKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSIDEIS 246
            +GAKRAV LPVSAPFH +LM P    +   L ++   +P VP+L N   + +++ D   
Sbjct: 188 KRGAKRAVMLPVSAPFHCALMQPAQDRLATDLATLAFHNPEVPVLCNVDVALITTADAAR 247

Query: 247 RLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVEDID 306
             L  QVTG V+W  +++     GVK+  EVG G VL+GL K+I+K+ +  ++   + + 
Sbjct: 248 DTLTRQVTGAVQWDASMRKLIELGVKTFVEVGPGTVLSGLMKQIEKTQTCFNVENEDSLQ 307

Query: 307 LALRSIV 313
            A+  ++
Sbjct: 308 KAMNGLL 314


>gi|138894710|ref|YP_001125163.1| malonyl CoA-acyl carrier protein transacylase (FabD) [Geobacillus
           thermodenitrificans NG80-2]
 gi|196247671|ref|ZP_03146373.1| malonyl CoA-acyl carrier protein transacylase [Geobacillus sp.
           G11MC16]
 gi|134266223|gb|ABO66418.1| Malonyl CoA-acyl carrier protein transacylase (FabD) [Geobacillus
           thermodenitrificans NG80-2]
 gi|196212455|gb|EDY07212.1| malonyl CoA-acyl carrier protein transacylase [Geobacillus sp.
           G11MC16]
          Length = 314

 Score =  235 bits (600), Expect = 5e-60,   Method: Compositional matrix adjust.
 Identities = 134/312 (42%), Positives = 193/312 (61%), Gaps = 11/312 (3%)

Query: 7   FPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPALT 66
           FPGQGSQ +GM +D  D    AR V E  D  L   LS LM+NG QEELT T NAQPAL 
Sbjct: 8   FPGQGSQTVGMAKDAADHDARARAVIEAADERLGFPLSALMFNGPQEELTLTYNAQPALL 67

Query: 67  AVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQEA 126
             S+A + +++  GL  K D  YVAGHSLGEYTAL AA A S +D +  VR RG+ M EA
Sbjct: 68  TASIALLELVKAAGL--KAD--YVAGHSLGEYTALVAAGAMSFADAVYAVRRRGELMDEA 123

Query: 127 VPPGLGSMVAIIGLD----DCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAA 182
           VP G G+M A++G++    + V + I AQ   V   E AN N  GQ+VISG +  V+ A 
Sbjct: 124 VPAGEGTMAAVLGMEGEVLEAVTNEITAQGDPV---EPANFNCPGQIVISGSKAGVEKAG 180

Query: 183 DTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSI 242
                +GAKR + L VS PFHS+LM P ++ ++ +L  +  +D  +P++ N  A PV + 
Sbjct: 181 QLAKERGAKRVIPLEVSGPFHSALMKPAAEQLQEVLSGLVIRDADIPVIANVTAEPVMNK 240

Query: 243 DEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKV 302
           ++I+RLL+EQ+   VRW ++++     GV +  E+G GKVL+GL K+ID++    +++ +
Sbjct: 241 EDIARLLIEQLYSPVRWEQSVRTLLALGVDTFLEIGPGKVLSGLVKKIDRNARIYAVNDL 300

Query: 303 EDIDLALRSIVG 314
             ++  + ++ G
Sbjct: 301 ASLEATVAALKG 312


>gi|225849323|ref|YP_002729487.1| malonyl CoA-acyl carrier protein transacylase [Sulfurihydrogenibium
           azorense Az-Fu1]
 gi|225643469|gb|ACN98519.1| malonyl CoA-acyl carrier protein transacylase [Sulfurihydrogenibium
           azorense Az-Fu1]
          Length = 301

 Score =  235 bits (600), Expect = 5e-60,   Method: Compositional matrix adjust.
 Identities = 125/305 (40%), Positives = 186/305 (60%), Gaps = 8/305 (2%)

Query: 5   LTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPA 64
             FPGQGSQ +GMG+D Y++F E R + E+V+  L  NL+D+++N ++E+L  T   QPA
Sbjct: 4   FVFPGQGSQYVGMGKDFYENFEEVRQLHEKVNERLGFNLTDIIFN-NEEKLNLTEYTQPA 62

Query: 65  LTAVSMAFIRVM-EKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSM 123
           L   S    ++  EK G+    +  +VAGHSLGE+TAL  A + SL D + +   RGK M
Sbjct: 63  LVLTSYITYKIFKEKKGI----EPDFVAGHSLGEFTALAVAGSLSLEDAVYITHIRGKLM 118

Query: 124 QEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAAD 183
           Q AVP G+G M AIIGL+   ++ I  Q    GI EIAN N   Q VISG + AV+ A +
Sbjct: 119 QSAVPEGVGLMAAIIGLEASKIEEILKQID--GIVEIANYNSYEQTVISGEKVAVEKAME 176

Query: 184 TCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSID 243
              ++GAK+ V L VS P HSS++   ++     L+ +  +D  +P++ N  A P++   
Sbjct: 177 ILKSQGAKKVVPLVVSVPAHSSMLKEKAQEFGEYLEKIEIKDASIPVISNVSAKPITKAQ 236

Query: 244 EISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVE 303
           +I + L       VRW +TI++ ++ GVK +YE+G  KVLTGL KRI+K L+  ++  ++
Sbjct: 237 DIKQELKVHFYSPVRWVQTIEYLSSMGVKDIYEIGPKKVLTGLIKRINKDLNLKNVETLQ 296

Query: 304 DIDLA 308
           DI+ A
Sbjct: 297 DIENA 301


>gi|312897524|ref|ZP_07756944.1| malonyl CoA-acyl carrier protein transacylase [Megasphaera
           micronuciformis F0359]
 gi|310621376|gb|EFQ04916.1| malonyl CoA-acyl carrier protein transacylase [Megasphaera
           micronuciformis F0359]
          Length = 313

 Score =  235 bits (600), Expect = 6e-60,   Method: Compositional matrix adjust.
 Identities = 132/306 (43%), Positives = 181/306 (59%), Gaps = 8/306 (2%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M     FPGQG+Q +GM +DLYDS+   R +FEE D  L  +L+ L + G  EEL  T N
Sbjct: 1   MKKAFVFPGQGAQKVGMVKDLYDSYASVRQLFEESDDALGFSLTKLCFEGPDEELMLTYN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
            QPA+   S A   V+++ G   + DI  VAGHSLGEY+AL AA +   +D +R VR RG
Sbjct: 61  TQPAILTASTACNLVLKEEGF--QPDI--VAGHSLGEYSALVAAGSLDFTDAVRTVRLRG 116

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVG-ICEIANDNGGGQVVISGLQDAVK 179
           + MQEAVP G G+M AI+GLD+  + SIC Q S  G   E  N N  GQ+VI+G   AV+
Sbjct: 117 QFMQEAVPLGEGAMAAILGLDEEKIKSICTQISTQGSTVEAVNFNCPGQIVIAGATKAVE 176

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            A ++    GAKRAV L VSAPFHS+LM P ++ +  +LD++T +D V+P++ N      
Sbjct: 177 QAVESMKEAGAKRAVMLNVSAPFHSTLMQPAAERLAEVLDTITIRDAVIPVVANVNGEIE 236

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
            +  +I   LV+Q    V W + +Q     G  +  EVG GK L G  ++IDK++ +   
Sbjct: 237 RTAADIKASLVKQAASPVLWVKCVQTMQTFGADTFVEVGPGKTLCGFNRKIDKTIHS--- 293

Query: 300 SKVEDI 305
              EDI
Sbjct: 294 ENTEDI 299


>gi|308068617|ref|YP_003870222.1| Malonyl CoA-acyl carrier protein transacylase (MCT) [Paenibacillus
           polymyxa E681]
 gi|305857896|gb|ADM69684.1| Malonyl CoA-acyl carrier protein transacylase (MCT) [Paenibacillus
           polymyxa E681]
          Length = 314

 Score =  235 bits (599), Expect = 7e-60,   Method: Compositional matrix adjust.
 Identities = 123/304 (40%), Positives = 173/304 (56%), Gaps = 4/304 (1%)

Query: 3   TVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQ 62
           T   FPGQGSQV+GM +D Y++ P A  VF + D  L   LS L++ G    L  T N Q
Sbjct: 4   TAFIFPGQGSQVVGMAKDAYEAVPAATEVFRQADERLGFALSTLIFEGPDTALKQTSNTQ 63

Query: 63  PALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKS 122
           PAL   S+A      K  + +  D  YVAGHSLGEY+AL A+   +  D + +VR RG+ 
Sbjct: 64  PALLTASIALYEAF-KEKMGIHPD--YVAGHSLGEYSALVASGVLAFEDAVEIVRTRGEF 120

Query: 123 MQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVG-ICEIANDNGGGQVVISGLQDAVKCA 181
           M++A+P G G M A++G D   + ++C   +  G + E+AN N  GQ+V+SG ++ V   
Sbjct: 121 MEQAIPDGQGGMAAVLGADREALAALCRDITESGQLVELANINCPGQIVVSGTKEGVAAV 180

Query: 182 ADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSS 241
           A+     G KRA+ L VS PFHSSLM   +  +   L +VT     +P++ N  A PV  
Sbjct: 181 AERVKEAGGKRAITLEVSGPFHSSLMKEAATKLSSKLGAVTFSTAQIPVVANVTAKPVRE 240

Query: 242 IDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISK 301
             EI +LLV+QV   V W +++ W    GV +  E G G VLTGL K+IDK++   +IS 
Sbjct: 241 GSEIRQLLVDQVYSPVLWEDSVAWLLEQGVDTFVEFGPGSVLTGLVKKIDKTVKLYNISS 300

Query: 302 VEDI 305
           +E  
Sbjct: 301 LESF 304


>gi|228922606|ref|ZP_04085906.1| Malonyl CoA-acyl carrier protein transacylase [Bacillus
           thuringiensis serovar huazhongensis BGSC 4BD1]
 gi|228837035|gb|EEM82376.1| Malonyl CoA-acyl carrier protein transacylase [Bacillus
           thuringiensis serovar huazhongensis BGSC 4BD1]
          Length = 314

 Score =  235 bits (599), Expect = 7e-60,   Method: Compositional matrix adjust.
 Identities = 125/311 (40%), Positives = 184/311 (59%), Gaps = 9/311 (2%)

Query: 7   FPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPALT 66
           FPGQGSQ +GMG+ L ++  E   VF + D  L  +LS++++ G QE+LT T NAQPAL 
Sbjct: 8   FPGQGSQAVGMGKQLAENNKEVAKVFAKADEVLQDSLSEVIFEGPQEKLTLTTNAQPALL 67

Query: 67  AVSMAFIRVMEKNGLCVKRDIS--YVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQ 124
             S A +  +++       DI+  +VAGHSLGEY+AL AA A +  D +  VR RG+ M+
Sbjct: 68  TTSFAILTALKE------YDITPDFVAGHSLGEYSALVAAGALTFEDAVYAVRKRGEYME 121

Query: 125 EAVPPGLGSMVAIIGLDDCVVDSICAQASRVGIC-EIANDNGGGQVVISGLQDAVKCAAD 183
           EAVP G G+M AI+G D  ++  +  + +  G   +IAN N   Q+VISG +  V+ A+ 
Sbjct: 122 EAVPGGEGAMAAILGADPHMLKQVTEEVTSEGYAVQIANMNSTKQIVISGTKQGVEVASQ 181

Query: 184 TCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSID 243
                GAKRA+ L VS PFHSSLM P ++  + +L+ +T  D  +P++ N  A  ++   
Sbjct: 182 RAKENGAKRAIPLKVSGPFHSSLMKPAAEKFQSVLNEITIHDTNIPVIANVTAEVITRGA 241

Query: 244 EISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVE 303
           +I   L+EQ+   V W  +I++  N GV    E+G GKVL GL K ID S+ A +I   E
Sbjct: 242 DIQEKLIEQLYSPVLWYPSIEYMVNQGVDIFIEIGPGKVLAGLMKSIDSSVKAYAIYDEE 301

Query: 304 DIDLALRSIVG 314
            +   + ++ G
Sbjct: 302 TLKDTISNLRG 312


>gi|310641505|ref|YP_003946263.1| malonyl CoA-acyl carrier protein transacylase (fabd) [Paenibacillus
           polymyxa SC2]
 gi|309246455|gb|ADO56022.1| Malonyl CoA-acyl carrier protein transacylase (FabD) [Paenibacillus
           polymyxa SC2]
          Length = 313

 Score =  235 bits (599), Expect = 8e-60,   Method: Compositional matrix adjust.
 Identities = 122/304 (40%), Positives = 174/304 (57%), Gaps = 5/304 (1%)

Query: 3   TVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQ 62
           T   FPGQGSQ +GM +D Y++ P A  VF + D  L   LS L++ G    L  T N Q
Sbjct: 4   TAFIFPGQGSQAVGMAKDAYEAVPAATEVFRKADERLGFALSTLIFEGPDTALKQTSNTQ 63

Query: 63  PALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKS 122
           PAL   S+A     ++ G  ++ D  YVAGHSLGEY+AL A+   +  D +  VRARG+ 
Sbjct: 64  PALLTASIALYEAFKEKG--IRPD--YVAGHSLGEYSALVASGVLTFEDAVETVRARGQF 119

Query: 123 MQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVG-ICEIANDNGGGQVVISGLQDAVKCA 181
           M++A+P G G M A++G D   + ++C   +  G + E+AN N  GQ+V+SG +  V   
Sbjct: 120 MEQAIPDGQGGMAAVLGADREALAALCRDITESGQLVELANINCPGQIVVSGTKAGVAAV 179

Query: 182 ADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSS 241
           A+     G KRA+ L VS PFHSSLM   +  +   L++V   +  +P++ N  A PV  
Sbjct: 180 AERVKEAGGKRAITLEVSGPFHSSLMKEAADKLSGKLETVKFAEAQIPVVTNVTAKPVRE 239

Query: 242 IDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISK 301
             EI +LLVEQV   V W +++ W    GV +  E G G VLTGL K+IDK++   ++S 
Sbjct: 240 GSEIRQLLVEQVYSPVLWEDSVAWLLEQGVDTFVEFGPGSVLTGLVKKIDKTVKLYNMSS 299

Query: 302 VEDI 305
           +E  
Sbjct: 300 LESF 303


>gi|121533807|ref|ZP_01665634.1| malonyl CoA-acyl carrier protein transacylase [Thermosinus
           carboxydivorans Nor1]
 gi|121307798|gb|EAX48713.1| malonyl CoA-acyl carrier protein transacylase [Thermosinus
           carboxydivorans Nor1]
          Length = 314

 Score =  235 bits (599), Expect = 8e-60,   Method: Compositional matrix adjust.
 Identities = 136/309 (44%), Positives = 189/309 (61%), Gaps = 5/309 (1%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
            T   FPGQGSQ +GMG++LYD+F  A+ VF+  D  L  ++++L +NG +EEL  T N 
Sbjct: 3   KTAFVFPGQGSQAVGMGKELYDAFSIAQTVFKTADEALGFSITELCFNGPEEELRKTYNT 62

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPA+  VS+A  +V+E+ GL  K DI  VAGHSLGEY+AL AA A   +D ++LVR RG+
Sbjct: 63  QPAILTVSVACYKVLEEKGL--KPDI--VAGHSLGEYSALVAAGAIDFADAVQLVRKRGQ 118

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQAS-RVGICEIANDNGGGQVVISGLQDAVKC 180
            MQEAVP G G M AI+GL+   V  +C Q   +VG  +  N N  GQ+VI+G   AV+ 
Sbjct: 119 YMQEAVPLGEGGMAAIMGLERDKVVEVCRQVQDQVGPVQAVNFNCPGQIVIAGRTAAVEK 178

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A +     GAKRAV LPVSAPFHS+LM P ++ +   L+ +T +D VVP++ N     V+
Sbjct: 179 AVEELKAVGAKRAVMLPVSAPFHSTLMQPAAEKLAIELEKITVRDAVVPVVANVNGQIVT 238

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
             + I   LV+Q    V W + +      G     EVG GKVLTG  K+I K +  +++ 
Sbjct: 239 KGETIKASLVQQAANPVLWEDCVAQIVRSGANVFVEVGPGKVLTGFTKKIAKDVVTLNVE 298

Query: 301 KVEDIDLAL 309
            +  ++ AL
Sbjct: 299 DLASLEKAL 307


>gi|313901962|ref|ZP_07835378.1| (Acyl-carrier-protein) S-malonyltransferase [Thermaerobacter
           subterraneus DSM 13965]
 gi|313467751|gb|EFR63249.1| (Acyl-carrier-protein) S-malonyltransferase [Thermaerobacter
           subterraneus DSM 13965]
          Length = 317

 Score =  235 bits (599), Expect = 8e-60,   Method: Compositional matrix adjust.
 Identities = 134/306 (43%), Positives = 188/306 (61%), Gaps = 6/306 (1%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
            T + FPGQG+Q +GMG+DLY+ FPEAR VF E       +++ L + G +++L  T   
Sbjct: 3   GTAVVFPGQGAQYVGMGKDLYEQFPEAREVFAEASAAAGFDVARLCFEGPEDQLQLTEFQ 62

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPAL AV +A  RV+   GL    + +  AG SLGEY AL AA    L+D  R+VR RGK
Sbjct: 63  QPALLAVGVACWRVLAARGL----EPAMAAGLSLGEYGALVAAGVLELADAARVVRLRGK 118

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQA--SRVGICEIANDNGGGQVVISGLQDAVK 179
            MQEAVPPG G+M A++GL+   V++IC Q   +  G+ E AN N  GQ+V++G + AV+
Sbjct: 119 FMQEAVPPGEGAMAALLGLEAGTVENICRQVMDAGAGVVEPANYNCPGQIVVAGQRAAVE 178

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            A +     GA+RAV LPVSAPFH  LM P ++ +  +L  V  +   +P++ N  A PV
Sbjct: 179 AAVERARAAGARRAVLLPVSAPFHCRLMEPAARRLAGVLAEVPFRPARIPVVANVTAEPV 238

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
           +  + I  LLV+QV   VRW ++++     G+  + E+G GK LTG A+RIDK L AV+ 
Sbjct: 239 TDPERIRELLVQQVDHPVRWEQSVRRMQREGITRLVEMGPGKTLTGFARRIDKHLEAVAA 298

Query: 300 SKVEDI 305
              E+I
Sbjct: 299 GTAEEI 304


>gi|304316943|ref|YP_003852088.1| malonyl CoA-acyl carrier protein transacylase
           [Thermoanaerobacterium thermosaccharolyticum DSM 571]
 gi|302778445|gb|ADL69004.1| malonyl CoA-acyl carrier protein transacylase
           [Thermoanaerobacterium thermosaccharolyticum DSM 571]
          Length = 310

 Score =  235 bits (599), Expect = 8e-60,   Method: Compositional matrix adjust.
 Identities = 132/312 (42%), Positives = 188/312 (60%), Gaps = 5/312 (1%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M     +PGQG+Q  GMG+++YD+F EAR +FEE + +L  +++ L + G  EEL  T N
Sbjct: 1   MKIAFIYPGQGAQYTGMGKEIYDNFSEAREIFEEANDSLGYDIARLCFEGPDEELMKTEN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
            QPA+  VS+A  +V+   GL  K D++  AG SLGEY+AL  +   S  D +RLV+ RG
Sbjct: 61  TQPAILTVSIALTKVLSNKGL--KADVT--AGLSLGEYSALVYSGVLSFKDAVRLVKKRG 116

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           + MQ AVP G+G M AIIGLD+  V++IC     VGI E AN N  GQ+ I+G   A++ 
Sbjct: 117 EYMQNAVPIGIGGMAAIIGLDNETVENICCDVKDVGIVEPANYNCPGQLSIAGEIKALEK 176

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A +    KGAK+AV LPVSAPFH S++      ++  L  +   D  VP++ N  A    
Sbjct: 177 AVEIAKAKGAKKAVMLPVSAPFHCSMLKEAGFKLEEDLKEIYTYDMSVPVITNVTAD-YE 235

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
            IDE+ ++LV+QV+  V W ++I+      V +  E+G GK LTG  KRIDK+  AV+  
Sbjct: 236 RIDEVKKMLVKQVSSPVLWEQSIRRMIEDHVDTFIEIGPGKTLTGFMKRIDKTKKAVNFE 295

Query: 301 KVEDIDLALRSI 312
            +  +D  L S+
Sbjct: 296 DMGTLDKLLSSL 307


>gi|209517234|ref|ZP_03266079.1| malonyl CoA-acyl carrier protein transacylase [Burkholderia sp.
           H160]
 gi|209502370|gb|EEA02381.1| malonyl CoA-acyl carrier protein transacylase [Burkholderia sp.
           H160]
          Length = 311

 Score =  234 bits (598), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 134/302 (44%), Positives = 174/302 (57%), Gaps = 10/302 (3%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFE---EVDHTLNQNLSDLMWNGSQEELTA 57
           M     FPGQGSQ +GM     ++F +  LV E   E    LNQ+L  L+  G  E+L  
Sbjct: 1   MKFAFVFPGQGSQAVGM----LNAFADHALVRETVQEASDALNQDLGKLIAEGPAEDLNL 56

Query: 58  TCNAQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVR 117
           T N QP +   + A  R  ++ G       + VAGHSLGEYTAL AA A +  D + LVR
Sbjct: 57  TTNTQPVMLTAAYAVYRAWQQAGGPAP---AIVAGHSLGEYTALVAAGALAFRDAVPLVR 113

Query: 118 ARGKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDA 177
            R ++MQ AVP G G M AI+GLDD  V ++CA+AS  G+ E  N N   QVVI+G + A
Sbjct: 114 FRAQAMQTAVPVGEGGMAAILGLDDDTVRAVCAEASAAGVVEAVNFNAPAQVVIAGHKAA 173

Query: 178 VKCAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCAS 237
           V+ A +    KGAKRA+ LPVSAPFHSSL+ P S  ++  L S+  + P +P++ N   +
Sbjct: 174 VEKACEVAKAKGAKRALPLPVSAPFHSSLLKPASDQLREYLASIDVRVPSIPVINNVDVA 233

Query: 238 PVSSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAV 297
            V+    I   LV Q  G VRW E++Q  A  G+  V E G GKVL GL KRID SL   
Sbjct: 234 VVNEPSGIKDALVRQAAGPVRWVESVQAMAAQGITHVIECGPGKVLAGLTKRIDGSLVGA 293

Query: 298 SI 299
           S+
Sbjct: 294 SV 295


>gi|28209900|ref|NP_780844.1| acyl-carrier-protein S-malonyltransferase [Clostridium tetani E88]
 gi|28202335|gb|AAO34781.1| malonyl coA-acyl carrier protein transacylase [Clostridium tetani
           E88]
          Length = 312

 Score =  234 bits (598), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 122/306 (39%), Positives = 185/306 (60%), Gaps = 5/306 (1%)

Query: 7   FPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPALT 66
           FPGQGSQ +GMG++LYD+F E R +F   +  L+ N++DL + G  E+L  T   QPA+ 
Sbjct: 9   FPGQGSQYVGMGKELYDNFKECRDIFNRAEELLDFNVTDLCFKGPDEKLNKTEFTQPAIL 68

Query: 67  AVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQEA 126
            VS+A  ++++K G  +K +I+  AG SLGEY+AL  +   S  D ++LVR RGK M+EA
Sbjct: 69  TVSIAISKLIKKRG--IKAEIA--AGLSLGEYSALIYSGMLSFEDGVKLVRKRGKFMEEA 124

Query: 127 VPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAADTCL 186
           VP G G M AIIGL +  +  +C + S +GI E AN N  GQ+VISG  +A++ A + C 
Sbjct: 125 VPKGTGGMAAIIGLKEEEIYKVCHEVSHIGIVEPANFNCPGQIVISGEINALRIACEMCQ 184

Query: 187 NKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSIDEIS 246
            KGA +   L VS PFHSSL+   +  ++  L+++  Q   +P++ N  A     +D+I 
Sbjct: 185 EKGALKVAMLKVSGPFHSSLLKKAADNLEKELNNIQFQKGNIPVITNVTAD-FMELDKIK 243

Query: 247 RLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVEDID 306
             L  QV   V+W ++++     GV +  E+G GK LT   K+ID+ +SA +I  ++ +D
Sbjct: 244 DTLKSQVMHSVKWEQSMREMIKDGVNTFIEIGPGKTLTTFLKKIDRKISAYNIEDIKSLD 303

Query: 307 LALRSI 312
             L  +
Sbjct: 304 KTLNKL 309


>gi|218230903|ref|YP_002368653.1| malonyl CoA-acyl carrier protein transacylase [Bacillus cereus
           B4264]
 gi|218158860|gb|ACK58852.1| malonyl CoA-acyl carrier protein transacylase [Bacillus cereus
           B4264]
          Length = 314

 Score =  234 bits (597), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 124/311 (39%), Positives = 185/311 (59%), Gaps = 9/311 (2%)

Query: 7   FPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPALT 66
           FPGQGSQ +GMG+ L ++  E   VF + D  L  +LS++++ G QE+LT T NAQPAL 
Sbjct: 8   FPGQGSQAVGMGKQLAENNKEVAKVFAKADEVLEDSLSEVIFEGPQEKLTLTTNAQPALL 67

Query: 67  AVSMAFIRVMEKNGLCVKRDIS--YVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQ 124
             S A +  +++       DI+  +VAGHSLGEY+AL AA A +  D +  VR RG+ M+
Sbjct: 68  TTSFAILTALKE------YDITPDFVAGHSLGEYSALVAAGALTFEDAVYAVRKRGEYME 121

Query: 125 EAVPPGLGSMVAIIGLDDCVVDSICAQASRVGIC-EIANDNGGGQVVISGLQDAVKCAAD 183
           EAVP G G+M AI+G D  ++  +  + +  G   +IAN N   Q+VISG +  V+ A+ 
Sbjct: 122 EAVPGGEGAMAAILGADPHMLKQVTEEVTSEGYAVQIANMNSTKQIVISGTKQGVEVASQ 181

Query: 184 TCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSID 243
                GAKRA+ L VS PFHSSLM P ++  + +L+ +T  D  +P++ N  A  ++   
Sbjct: 182 RAKENGAKRAIPLKVSGPFHSSLMKPAAEKFQSVLNEITIHDTNIPVIANVTAEVITRGA 241

Query: 244 EISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVE 303
           +I   L+EQ+   V W  +I++  + GV +  E+G GKVL GL K ID S+ A +I   E
Sbjct: 242 DIQEKLIEQLYSPVLWYPSIEYMVSQGVDTFIEIGPGKVLAGLMKSIDSSVKAYAIYDEE 301

Query: 304 DIDLALRSIVG 314
            +   + ++ G
Sbjct: 302 TLKDTISNLRG 312


>gi|205373338|ref|ZP_03226142.1| hypothetical protein Bcoam_08450 [Bacillus coahuilensis m4-4]
          Length = 314

 Score =  234 bits (597), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 124/310 (40%), Positives = 187/310 (60%), Gaps = 9/310 (2%)

Query: 5   LTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPA 64
             FPGQGSQ +GMG D  +S+ E+ +VF + +  L  +   LM  G  E+LT T NAQPA
Sbjct: 6   FIFPGQGSQTVGMGMDYKESYEESMVVFGQCEDVLGHDFIRLMQEGPLEQLTLTENAQPA 65

Query: 65  LTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQ 124
           L   S+A   V++K G+       YV+GHSLGEY+AL A  + S  D ++ VR RG+ M+
Sbjct: 66  LVTASIAMYEVLKKEGI----QPDYVSGHSLGEYSALVATGSLSFKDAVKTVRKRGELME 121

Query: 125 EAVPPGLGSMVAIIGLDDCVVDSICAQASRVGI-CEIANDNGGGQVVISGLQDAVKCAAD 183
           +AVP G+G+M A++G D  ++++I  +A + G   +IAN NG GQ+VISG ++ V+ A+ 
Sbjct: 122 QAVPKGIGAMSAVMGFDARLLEAIIQEAKQQGQSVDIANYNGPGQIVISGSKEGVEFASI 181

Query: 184 TCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSID 243
              + GAKR + L VS PFHS LM P S   +  L  ++  +  VP++ N  A+P+    
Sbjct: 182 KAKDAGAKRVIPLNVSGPFHSELMKPASIQFERFLKEISMTEMTVPLVANVTATPIEDSS 241

Query: 244 EISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVE 303
            I  LLV+Q+   VR+ E+I      GV +  EVG  KVL GL ++I+++++ + +  VE
Sbjct: 242 AIQELLVKQLYSPVRFEESINRMIEDGVTTFVEVGPLKVLQGLIRKINRNVTVLGVQDVE 301

Query: 304 DIDLALRSIV 313
               AL+S +
Sbjct: 302 ----ALQSTI 307


>gi|288553098|ref|YP_003425033.1| acyl-carrier-protein S-malonyltransferase [Bacillus pseudofirmus
           OF4]
 gi|288544258|gb|ADC48141.1| acyl-carrier-protein S-malonyltransferase [Bacillus pseudofirmus
           OF4]
          Length = 315

 Score =  234 bits (597), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 122/309 (39%), Positives = 186/309 (60%), Gaps = 5/309 (1%)

Query: 7   FPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPALT 66
           FPGQGSQ +GMG +L  + P+ + + +  D  L  +L+ +M  G +E+L  T N QPAL 
Sbjct: 8   FPGQGSQAVGMGVELRTNEPKCKEILDRADSRLGYSLTKIMAEGPEEKLRRTENTQPALV 67

Query: 67  AVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQEA 126
            +S+A + ++++  +       YVAGHSLGEY+AL AA + S  D +  V  RG  M+EA
Sbjct: 68  TMSIAVLELLKEENITP----DYVAGHSLGEYSALVAAGSLSFEDAVYAVHNRGLFMEEA 123

Query: 127 VPPGLGSMVAIIGLDDCVVDSICAQASRVG-ICEIANDNGGGQVVISGLQDAVKCAADTC 185
           VP G G+M A++G++  ++  +C +    G + E+AN N  GQ+VISG  + V    +  
Sbjct: 124 VPYGEGAMSAVLGMEADLLAEVCKEIQAKGHVAELANLNCPGQIVISGCSEGVALCGELA 183

Query: 186 LNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSIDEI 245
             KGAKR + LPVS PFHSSLM P +  ++ +L  +T +D  VP++ N  A   +  +EI
Sbjct: 184 KEKGAKRVIPLPVSGPFHSSLMKPAADKLEGVLKEITIKDAKVPVIANVTAKAQTDANEI 243

Query: 246 SRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVEDI 305
            + LVEQV   VRW ETI+   + GV +  EVGSG VLTGL K++++   A +++  E +
Sbjct: 244 EQKLVEQVYSPVRWEETIRELQDLGVDTFIEVGSGNVLTGLVKKVNRRAQAFAVNDRESL 303

Query: 306 DLALRSIVG 314
           +  +  + G
Sbjct: 304 NKVVAKLEG 312


>gi|229086405|ref|ZP_04218581.1| Malonyl CoA-acyl carrier protein transacylase [Bacillus cereus
           Rock3-44]
 gi|228696921|gb|EEL49730.1| Malonyl CoA-acyl carrier protein transacylase [Bacillus cereus
           Rock3-44]
          Length = 316

 Score =  234 bits (597), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 124/311 (39%), Positives = 183/311 (58%), Gaps = 9/311 (2%)

Query: 7   FPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPALT 66
           FPGQGSQ +GMGR L +++ E   VF++ D  L ++LS+L++ G QE+LT T NAQPAL 
Sbjct: 8   FPGQGSQAVGMGRQLAENYTEVASVFQKADEVLQESLSNLIFEGPQEKLTLTTNAQPALL 67

Query: 67  AVSMAFIRVMEKNGLCVKRDIS--YVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQ 124
             S A +  +++       DI+  YVAGHSLGEY+AL AA A +  D +  VR RG+ M+
Sbjct: 68  TTSFAILTALKE------YDITPDYVAGHSLGEYSALVAAGALTFEDAVYAVRKRGEYME 121

Query: 125 EAVPPGLGSMVAIIGLDDCVVDSICAQASRVGI-CEIANDNGGGQVVISGLQDAVKCAAD 183
           EAVP G G+M AI+G D  ++  +  + +  G   ++AN N   Q+VISG +  V+ A+ 
Sbjct: 122 EAVPSGEGAMAAILGADPDILKQVTEEVTNEGYPVQVANMNSTKQIVISGTKQGVELASQ 181

Query: 184 TCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSID 243
                GAKRA+ L VS PFHSSLM P ++  + +L  +  QD  +P++ N  A  ++   
Sbjct: 182 KAKENGAKRAIPLRVSGPFHSSLMKPAAEKFQGVLSEIAIQDAKIPVIANVTADCITRST 241

Query: 244 EISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVE 303
           +I   L+EQ+   V W  +I+     GV +  E+G GKVL GL K I  S+   +I   E
Sbjct: 242 DIQEKLIEQLYSPVLWYPSIERMVEQGVDTFIEIGPGKVLAGLMKSIAPSVKVYAIYDEE 301

Query: 304 DIDLALRSIVG 314
            +   + ++ G
Sbjct: 302 TLKDTISNLRG 312


>gi|78065706|ref|YP_368475.1| [Acyl-carrier-protein] S-malonyltransferase [Burkholderia sp. 383]
 gi|77966451|gb|ABB07831.1| [Acyl-carrier-protein] S-malonyltransferase [Burkholderia sp. 383]
          Length = 310

 Score =  234 bits (597), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 134/310 (43%), Positives = 175/310 (56%), Gaps = 4/310 (1%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M     FPGQGSQ +GM  + +      R   +E    LNQ+L  L+  G  E+L  T N
Sbjct: 1   MKFAFVFPGQGSQAVGM-LNAFADLAIVRETVQEASDALNQDLGKLIAEGPVEDLNLTTN 59

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
            QP +   + A  R  ++ G       S VAGHSLGEYTAL AA A +  D + LVR R 
Sbjct: 60  TQPVMLTAAYACYRAWQQAGGPAP---SIVAGHSLGEYTALVAAGALAFKDAVPLVRFRA 116

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           ++MQ AVP G G M AI+GLDD  V ++CA+A+  G+ E  N N   QVVI+G + AV+ 
Sbjct: 117 QAMQTAVPVGQGGMAAILGLDDDTVRAVCAEAAEAGVVEAVNFNAPAQVVIAGNKAAVEK 176

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A +    KGAKRA+ LPVSAPFHSSL+ P S  ++  L +V  + P +P++ N   + V 
Sbjct: 177 ACEIAKAKGAKRALPLPVSAPFHSSLLKPASDQLRDYLANVDVKAPQIPVVNNIDVAVVG 236

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
               I   LV Q  G VRW E +Q  A  GV  V E G GKVL GL KRID +L+  S+ 
Sbjct: 237 DPAAIKDALVRQAAGPVRWVECVQHIAGTGVTHVIECGPGKVLAGLTKRIDSNLTGASVF 296

Query: 301 KVEDIDLALR 310
               +D AL+
Sbjct: 297 DPASLDEALK 306


>gi|291278584|ref|YP_003495419.1| [acyl-carrier-protein] S-malonyltransferase [Deferribacter
           desulfuricans SSM1]
 gi|290753286|dbj|BAI79663.1| [acyl-carrier-protein] S-malonyltransferase [Deferribacter
           desulfuricans SSM1]
          Length = 308

 Score =  234 bits (596), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 125/300 (41%), Positives = 176/300 (58%), Gaps = 6/300 (2%)

Query: 7   FPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPALT 66
           FPGQGSQ +GMG+D +D F E +++ E+ D  L  +LS LM++G +EEL  T N QPAL 
Sbjct: 8   FPGQGSQYVGMGKDFFDKFEEYKVLIEKADEILKYDLSKLMFDGPEEELRLTYNTQPALL 67

Query: 67  AVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQEA 126
            +S+    +++      K +    AGHSLGEY+A+ AA   +  D +  V  RGK MQEA
Sbjct: 68  VMSVGIFNLIKD-----KINFDGFAGHSLGEYSAVVAAGGLTFEDALLAVHNRGKFMQEA 122

Query: 127 VPPGLGSMVAIIGLDDCVVDSICAQASRVG-ICEIANDNGGGQVVISGLQDAVKCAADTC 185
           VP G+G+M A+IG +   V+ +C   S+ G + E AN N   Q+V++G  DAV+      
Sbjct: 123 VPVGVGAMAAVIGANVEDVERLCISISKEGFLVEPANYNSSNQIVVAGHSDAVEEFMSRA 182

Query: 186 LNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSIDEI 245
               AKR V LPVSAPFH +LM P  + MK  L+ V   D   P+  N  A       EI
Sbjct: 183 KEISAKRVVKLPVSAPFHCALMKPAEEKMKNYLEKVRFSDIDKPVYSNVTADLEFKATEI 242

Query: 246 SRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVEDI 305
              L++QV+  VRW + I+     G  +  E+G+G VLTGL K+I++ +  V+ISKVED+
Sbjct: 243 KENLIKQVSSPVRWSQLIEKMIEDGFTTFVEIGAGNVLTGLIKKINRQVKTVNISKVEDL 302


>gi|1502420|gb|AAC44306.1| malonyl-CoA:Acyl carrier protein transacylase [Bacillus subtilis
           subsp. subtilis str. 168]
          Length = 318

 Score =  234 bits (596), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 124/308 (40%), Positives = 186/308 (60%), Gaps = 6/308 (1%)

Query: 7   FPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPALT 66
           FPGQGSQ IGMG++LY+  P A+ +F+E D TL   LS L++ G  EELT T NAQPAL 
Sbjct: 8   FPGQGSQFIGMGKELYEQVPAAKRLFDEADETLETKLSSLIFEGDAEELTLTYNAQPALL 67

Query: 67  AVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQEA 126
             S+A +   +++G+       + AGHSLGEY+AL AA A S  D +  VR RG+ M EA
Sbjct: 68  TTSIAVLEKFKESGITP----DFTAGHSLGEYSALVAAGALSFKDAVYTVRKRGEFMNEA 123

Query: 127 -VPPGLGSMVAIIGLDDCVVDSICAQASRVG-ICEIANDNGGGQVVISGLQDAVKCAADT 184
                     AI+G+D   +  +  + +  G + ++AN N  GQ+VISG    V+ A++ 
Sbjct: 124 GCRLAKEQWAAILGMDAEALKQVTDKVTEEGNLVQLANLNCPGQIVISGTAKGVELASEL 183

Query: 185 CLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSIDE 244
               GAKRA+ L VS PFHS LM P ++ +K +LD+   +D  VP++ N  A  ++   +
Sbjct: 184 AKENGAKRAIPLEVSGPFHSELMKPAAEKLKEVLDACDIKDADVPVISNVSADVMTEKAD 243

Query: 245 ISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVED 304
           I   L+EQ+   VR+ E+I      GV +  E+G GKVL+GL K++++ L  +++S  E 
Sbjct: 244 IKEKLIEQLYSPVRFEESINKLIAEGVTTFIEIGPGKVLSGLVKKVNRRLKTIAVSDPET 303

Query: 305 IDLALRSI 312
           I+LA++++
Sbjct: 304 IELAIQTL 311


>gi|170700229|ref|ZP_02891245.1| malonyl CoA-acyl carrier protein transacylase [Burkholderia
           ambifaria IOP40-10]
 gi|170134862|gb|EDT03174.1| malonyl CoA-acyl carrier protein transacylase [Burkholderia
           ambifaria IOP40-10]
          Length = 310

 Score =  234 bits (596), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 134/310 (43%), Positives = 174/310 (56%), Gaps = 4/310 (1%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M     FPGQGSQ +GM  + +      R   +E    LNQ+L  L+  G  EEL  T N
Sbjct: 1   MKFAFVFPGQGSQSVGM-LNAFADLAIVRETLQEASDALNQDLGKLIAEGPAEELNLTTN 59

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
            QP +   +    R  ++ G       S VAGHSLGEYTAL AA A +  D + LVR R 
Sbjct: 60  TQPVMLTAAYVCYRAWQQAGGPAP---SIVAGHSLGEYTALVAAGAIAFKDAVPLVRFRA 116

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           ++MQ AVP G G M AI+GLDD  + ++CA+A+  G+ E  N N   QVVI+G + AV+ 
Sbjct: 117 QAMQTAVPVGQGGMAAILGLDDDTMRAVCAEAAEAGVVEAVNFNAPAQVVIAGAKAAVEK 176

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A +    KGAKRA+ LPVSAPFHSSL+ P S  ++  L +V  + P +P++ N   + VS
Sbjct: 177 ACEIAKAKGAKRALPLPVSAPFHSSLLKPASDQLRDYLANVDVKAPQIPVVNNIDVAVVS 236

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
               I   LV Q  G VRW E +Q  A  GV  V E G GKVL GL KRID +L   S+ 
Sbjct: 237 DPAAIKDALVRQAAGPVRWVECVQHIAGTGVTHVIECGPGKVLAGLTKRIDGNLVGASVF 296

Query: 301 KVEDIDLALR 310
               +D AL+
Sbjct: 297 DPASLDEALK 306


>gi|91784719|ref|YP_559925.1| [Acyl-carrier-protein] S-malonyltransferase [Burkholderia
           xenovorans LB400]
 gi|91688673|gb|ABE31873.1| [Acyl-carrier-protein] S-malonyltransferase [Burkholderia
           xenovorans LB400]
          Length = 311

 Score =  233 bits (595), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 135/299 (45%), Positives = 170/299 (56%), Gaps = 4/299 (1%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M     FPGQGSQ +GM     D     R   +E    LNQ+L  L+  G  E+L  T N
Sbjct: 1   MKFAFVFPGQGSQSVGMLNAFADQ-AVVRETVQEASDALNQDLGKLIAEGPAEDLNLTTN 59

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
            QP +   S A  R   + G       + VAGHSLGEYTAL AA A +  D + LVR R 
Sbjct: 60  TQPVMLTASYAMYRAWLQAG---GPKPAIVAGHSLGEYTALVAAGAIAFRDAVPLVRFRA 116

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           ++MQ AVP G G+M AI+GLDD  V ++CA+AS  G+ E  N N   QVVI+G + AV+ 
Sbjct: 117 QAMQTAVPVGEGAMAAILGLDDDTVRAVCAEASVAGVVEAVNFNAPAQVVIAGNKAAVEK 176

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A +    KGAKRA+ LPVSAPFHSSL+ P S  ++  L SV  Q P +P++ N   + V+
Sbjct: 177 ACEVAKAKGAKRALPLPVSAPFHSSLLKPASDQLREYLASVDVQVPAIPVINNVDVAVVN 236

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
               I   LV Q  G VRW E++Q  +  GV  V E G GKVL GL KRID +L   SI
Sbjct: 237 EPAAIKDALVRQAAGAVRWVESVQAMSAQGVTHVIECGPGKVLAGLTKRIDGNLVGASI 295


>gi|320449671|ref|YP_004201767.1| malonyl CoA-acyl carrier protein transacylase [Thermus scotoductus
           SA-01]
 gi|320149840|gb|ADW21218.1| malonyl CoA-acyl carrier protein transacylase [Thermus scotoductus
           SA-01]
          Length = 305

 Score =  233 bits (595), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 138/303 (45%), Positives = 171/303 (56%), Gaps = 8/303 (2%)

Query: 7   FPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPALT 66
           FPGQGSQ +GMG+ LY++ P A+ V +  + TL   L  LMW G +E LT T N QPAL 
Sbjct: 6   FPGQGSQRVGMGKALYEASPAAKEVLDRAEATLP-GLLKLMWEGPEEALTLTENQQPALL 64

Query: 67  AVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQEA 126
           AV  A  R     G     + S  AGHSLGE+TA  AA    L D +RLVR RG+ MQEA
Sbjct: 65  AVGYAAYRAFLAEGGT---EPSLAAGHSLGEWTAHVAAGTLELEDALRLVRLRGRYMQEA 121

Query: 127 VPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAADTCL 186
           VPPG G+M AI+ L    +    A    V   EIAN N   Q VISG ++AV+ AA+   
Sbjct: 122 VPPGEGAMAAILKLPLEAIQEALAGLEGV---EIANLNAPEQTVISGRKEAVEEAAERLK 178

Query: 187 NKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSIDEIS 246
            K A R VFLPVSAPFHSSLM P  + +   L  VT + P  P+  N  A P      I 
Sbjct: 179 EKRA-RVVFLPVSAPFHSSLMAPAKERLAQDLAQVTLKKPRFPVYSNVTAKPEEDPGRIR 237

Query: 247 RLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVEDID 306
           +LL+EQ+T  VRW E ++     GV+   E GSG+VL GL  R  K   A+S+   E + 
Sbjct: 238 QLLLEQITAPVRWVEILKDMERRGVRRFLEFGSGEVLKGLVARTLKEAQALSVGDPEGVR 297

Query: 307 LAL 309
            AL
Sbjct: 298 KAL 300


>gi|290968965|ref|ZP_06560500.1| [acyl-carrier-protein] S-malonyltransferase [Megasphaera genomosp.
           type_1 str. 28L]
 gi|290780921|gb|EFD93514.1| [acyl-carrier-protein] S-malonyltransferase [Megasphaera genomosp.
           type_1 str. 28L]
          Length = 313

 Score =  233 bits (594), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 133/306 (43%), Positives = 175/306 (57%), Gaps = 8/306 (2%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M     FPGQG+Q +GM +DLYDS+   R VFEE D TL  +L+ L + G  EEL  TCN
Sbjct: 1   MKKAFVFPGQGAQKVGMVKDLYDSYSIVREVFEEADDTLGFSLTSLCFEGPDEELMKTCN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
            QPA+   S A  RV+   G  +  DI  VAGHSLGEY+AL AA + S +D +R VRARG
Sbjct: 61  TQPAILTASTACFRVLRAEG--IMPDI--VAGHSLGEYSALVAAGSLSFADAVRTVRARG 116

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQAS-RVGICEIANDNGGGQVVISGLQDAVK 179
           + MQEAVP G G+M A++GL+   +  ICA  S + G+ E  N N  GQ+VI+G   AV+
Sbjct: 117 QFMQEAVPLGEGAMAAVLGLEGDKIKEICAAVSAQGGVVEAVNFNCPGQIVIAGTAKAVE 176

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            A       GAKRAV L VSAPFHSSLM P +  +  +L  +T Q   +P++ N      
Sbjct: 177 TAITELKAAGAKRAVLLHVSAPFHSSLMAPAAHRLAEVLAQITIQPAAIPVVANVNGKME 236

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
           +    I   L++Q    V W +  +     G     EVG GK L G  ++ID+S+ +   
Sbjct: 237 TDAAVIKDALIKQAASPVLWVDCTKTIQQFGASVFVEVGPGKTLCGFNRKIDRSIHS--- 293

Query: 300 SKVEDI 305
             VEDI
Sbjct: 294 ENVEDI 299


>gi|229098321|ref|ZP_04229268.1| Malonyl CoA-acyl carrier protein transacylase [Bacillus cereus
           Rock3-29]
 gi|228685219|gb|EEL39150.1| Malonyl CoA-acyl carrier protein transacylase [Bacillus cereus
           Rock3-29]
          Length = 314

 Score =  233 bits (594), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 125/296 (42%), Positives = 177/296 (59%), Gaps = 9/296 (3%)

Query: 7   FPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPALT 66
           FPGQGSQ +GMGR L ++  E   VF + D  L+ +LS++++ G QE+LT T NAQPAL 
Sbjct: 8   FPGQGSQAVGMGRQLAENNNEVAKVFAKADEVLHDSLSEVIFEGPQEKLTLTTNAQPALL 67

Query: 67  AVSMAFIRVMEKNGLCVKRDIS--YVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQ 124
             S A +  +++       DI+  +VAGHSLGEY+AL AA A +  D +  VR RG+ M+
Sbjct: 68  TTSFAILTALKE------YDITPDFVAGHSLGEYSALVAAGAITFEDAVYAVRKRGEYME 121

Query: 125 EAVPPGLGSMVAIIGLDDCVVDSICAQASRVGIC-EIANDNGGGQVVISGLQDAVKCAAD 183
           EAVP G G+M AI+G D  ++  +  + +  G   +IAN N   Q+VISG    V+ A+ 
Sbjct: 122 EAVPGGEGAMAAILGADPDMLKRVTEEVTSEGYAVQIANMNSTKQIVISGTNQGVELASQ 181

Query: 184 TCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSID 243
                GAKRA+ L VS PFHSSLM P ++  + +LD +T QD  +P++ N  A  ++   
Sbjct: 182 RAKENGAKRAISLKVSGPFHSSLMKPAAEKFQSVLDEITIQDTNIPVIANVTADVITRGA 241

Query: 244 EISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
           +I   L+EQ+   V W  +I+     GV    E+G GKVL GL K ID S+ A +I
Sbjct: 242 DIQEKLIEQLYSPVLWYPSIETMVKQGVDIFIEIGPGKVLAGLMKSIDSSVKAYAI 297


>gi|229174518|ref|ZP_04302050.1| Malonyl CoA-acyl carrier protein transacylase [Bacillus cereus MM3]
 gi|228609078|gb|EEK66368.1| Malonyl CoA-acyl carrier protein transacylase [Bacillus cereus MM3]
          Length = 314

 Score =  233 bits (594), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 126/311 (40%), Positives = 184/311 (59%), Gaps = 9/311 (2%)

Query: 7   FPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPALT 66
           FPGQGSQ +GMG+ L ++  E   VF + D  L  +LS++++ G QE+LT T NAQPAL 
Sbjct: 8   FPGQGSQAVGMGKQLAENNKEVANVFAKADEVLQDSLSEVIFEGPQEKLTLTTNAQPALL 67

Query: 67  AVSMAFIRVMEKNGLCVKRDIS--YVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQ 124
             S A +  +++       DI+  +VAGHSLGEY+AL AA A +  D +  VR RG+ M+
Sbjct: 68  TTSFAILTALKE------YDITPDFVAGHSLGEYSALVAAGAITFEDAVYAVRKRGEYME 121

Query: 125 EAVPPGLGSMVAIIGLDDCVVDSICAQASRVGIC-EIANDNGGGQVVISGLQDAVKCAAD 183
           EAVP G G+M AI+G D  ++  +  + +  G   +IAN N   Q+VISG +  V+ A+ 
Sbjct: 122 EAVPGGEGAMAAILGADPHMLKQVTEEVTSEGYAVQIANMNSTKQIVISGTKQGVEIASQ 181

Query: 184 TCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSID 243
                GAKRA+ L VS PFHSSLM P ++  + +L  +T QD  +P++ N  A  +++  
Sbjct: 182 RAKENGAKRAIPLKVSGPFHSSLMKPAAEKFQSVLKEITIQDTNIPVIANVTADVITNGA 241

Query: 244 EISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVE 303
            I   L+EQ+   V W  +I+   N GV +  E+G GKVL GL K ID S+ A +I   E
Sbjct: 242 LIQEKLIEQLYSPVLWYPSIENMVNQGVDTFIEIGPGKVLAGLMKSIDSSVKAYAIYDEE 301

Query: 304 DIDLALRSIVG 314
            +   + ++ G
Sbjct: 302 TLKDTISNLRG 312


>gi|229192021|ref|ZP_04318991.1| Malonyl CoA-acyl carrier protein transacylase [Bacillus cereus ATCC
           10876]
 gi|228591572|gb|EEK49421.1| Malonyl CoA-acyl carrier protein transacylase [Bacillus cereus ATCC
           10876]
          Length = 314

 Score =  233 bits (594), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 124/311 (39%), Positives = 184/311 (59%), Gaps = 9/311 (2%)

Query: 7   FPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPALT 66
           FPGQGSQ +GMG+ L ++  E   VF + D  L  +LS++++ G QE+LT T NAQPAL 
Sbjct: 8   FPGQGSQAVGMGKQLAENNKEVAKVFVKADELLQDSLSEVIFEGPQEKLTLTTNAQPALL 67

Query: 67  AVSMAFIRVMEKNGLCVKRDIS--YVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQ 124
             S A +  +++       DI+  +VAGHSLGEY+AL AA A +  D +  VR RG+ M+
Sbjct: 68  TTSFAILTALKE------YDITPDFVAGHSLGEYSALVAAGALTFEDAVYAVRKRGEYME 121

Query: 125 EAVPPGLGSMVAIIGLDDCVVDSICAQASRVGIC-EIANDNGGGQVVISGLQDAVKCAAD 183
           EAVP G G+M AI+G D  ++  +  + +  G   +IAN N   Q+VISG +  V+ A+ 
Sbjct: 122 EAVPGGEGAMAAILGADPHMLKQVTEEVTSEGYAVQIANMNSTKQIVISGTKQGVEVASQ 181

Query: 184 TCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSID 243
                GAKRA+ L VS PFHSSLM P ++  + +L+ +T  D  +P++ N  A  ++   
Sbjct: 182 RAKENGAKRAIPLKVSGPFHSSLMKPAAEKFQSVLNEITIHDTNIPVIANVTAEVITRGA 241

Query: 244 EISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVE 303
           +I   L+EQ+   V W  +I++    GV +  E+G GKVL GL K ID S+ A +I   E
Sbjct: 242 DIQEKLIEQLYSPVLWYPSIEYMVKQGVDTFIEIGPGKVLAGLMKSIDSSVKAYAIYDEE 301

Query: 304 DIDLALRSIVG 314
            +   + ++ G
Sbjct: 302 TLKDTISNLRG 312


>gi|134295152|ref|YP_001118887.1| [Acyl-carrier-protein] S-malonyltransferase [Burkholderia
           vietnamiensis G4]
 gi|134138309|gb|ABO54052.1| [Acyl-carrier-protein] S-malonyltransferase [Burkholderia
           vietnamiensis G4]
          Length = 310

 Score =  233 bits (594), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 134/310 (43%), Positives = 174/310 (56%), Gaps = 4/310 (1%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M     FPGQGSQ +GM  + +      R    E    L Q+L  L+  G  EEL  T N
Sbjct: 1   MKFAFVFPGQGSQSVGM-LNAFADLAVVRETLAEASDALGQDLGKLIAEGPAEELNLTTN 59

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
            QP +   + A  R  ++ G       S VAGHSLGEYTAL AA A +  D + LVR R 
Sbjct: 60  TQPVMLTAAYACYRAWQQAGGPAP---SIVAGHSLGEYTALVAAGALAFKDAVPLVRFRA 116

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           ++MQ AVP G G M AI+GLDD  V ++CA+A++ G+ E  N N   QVVI+G + AV+ 
Sbjct: 117 QAMQTAVPVGQGGMAAILGLDDDTVRAVCAEAAQAGVVEAVNFNAPAQVVIAGAKAAVEK 176

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A +    KGAKRA+ LPVSAPFHSSL+ P S  ++  L ++  + P +P++ N   + VS
Sbjct: 177 ACEIAKAKGAKRALPLPVSAPFHSSLLKPASDQLRDYLANIDVKAPQIPVVNNIDVAVVS 236

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
               I   LV Q  G VRW E +Q  A  GV  V E G GKVL GL KRID +L   S+ 
Sbjct: 237 DPAAIKDALVRQAAGPVRWVECVQHIAATGVTHVIECGPGKVLAGLTKRIDGNLVGASVF 296

Query: 301 KVEDIDLALR 310
               +D AL+
Sbjct: 297 DPASLDEALK 306


>gi|121998024|ref|YP_001002811.1| malonyl CoA-acyl carrier protein transacylase [Halorhodospira
           halophila SL1]
 gi|121589429|gb|ABM62009.1| [Acyl-carrier-protein] S-malonyltransferase [Halorhodospira
           halophila SL1]
          Length = 317

 Score =  233 bits (593), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 136/307 (44%), Positives = 177/307 (57%), Gaps = 6/307 (1%)

Query: 5   LTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPA 64
           + FPGQGSQ +GM     D     R  F E    L  +L DL+ NG  EEL  T   QPA
Sbjct: 10  MAFPGQGSQAVGMMAPWQD-HDTVRATFREASEALGYDLWDLVANGPSEELDRTDRTQPA 68

Query: 65  LTAVSMAFIRV-MEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSM 123
           +   S+A  RV  E++G     + + +AGHSLGEY+AL AA+A  L D   LV  RG+ M
Sbjct: 69  ILVASVALWRVWQERDGA----EPAVLAGHSLGEYSALVAAEALQLGDAAALVAERGRYM 124

Query: 124 QEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAAD 183
           QEAVP G G+M AIIGLDD  +  ICA A++  + +  N N  GQVVI+G  +AV+ A  
Sbjct: 125 QEAVPAGEGAMAAIIGLDDDRIREICATAAQGAVVQPVNFNAPGQVVIAGNHEAVERAGS 184

Query: 184 TCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSID 243
                GAKR + LPVS P H SLM P ++ +   L+ V   +P  P++ N   S    + 
Sbjct: 185 AAKEAGAKRVLPLPVSVPSHCSLMHPAAERLAQRLEEVVINEPRRPVIHNVDVSVSRDVA 244

Query: 244 EISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVE 303
            I R LVEQ+   VRW ET+Q  +  GV+ V E G GKVLTGL +RID+SL   ++S+ E
Sbjct: 245 SIRRRLVEQLASPVRWTETVQKMSADGVQVVAECGPGKVLTGLTRRIDRSLQGGTLSEPE 304

Query: 304 DIDLALR 310
             D  LR
Sbjct: 305 AFDDMLR 311


>gi|253699785|ref|YP_003020974.1| malonyl CoA-acyl carrier protein transacylase [Geobacter sp. M21]
 gi|251774635|gb|ACT17216.1| malonyl CoA-acyl carrier protein transacylase [Geobacter sp. M21]
          Length = 311

 Score =  232 bits (592), Expect = 4e-59,   Method: Compositional matrix adjust.
 Identities = 126/304 (41%), Positives = 179/304 (58%), Gaps = 3/304 (0%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
           S    FPGQGSQ  GMG++L ++F  AR+ FEE D  L  +LS L + G +EEL  T N 
Sbjct: 3   SYAFIFPGQGSQHAGMGKELAENFKSARISFEEADDALGFSLSRLCFEGPEEELKLTANT 62

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPA+ A S+A +RV+ +         S++AGHSLGEY+AL A+ A   +D +R VRARG 
Sbjct: 63  QPAILAASVAALRVLREETPLTP---SFLAGHSLGEYSALVASGALDFADALRTVRARGS 119

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCA 181
            MQ+AVP G+G+M AI+G +   +  ICA+A++  +   AN N  GQ+V++G   AV  A
Sbjct: 120 FMQDAVPVGVGAMAAILGAEAEQLAEICAEAAQGEVVSPANFNSPGQIVVAGHTAAVNRA 179

Query: 182 ADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSS 241
            +    KG ++A+ LPVSAPFH +LM   ++ +   L  V       P++ N  A P S 
Sbjct: 180 IEIAKAKGFRKAMLLPVSAPFHCALMQKAAERLAETLQPVQVNPLATPVVTNVEAKPNSD 239

Query: 242 IDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISK 301
              +  LLVEQV   V W + +Q     GV +  E+G GKVL GL KRI+K  ++ ++  
Sbjct: 240 PARVKPLLVEQVCAPVLWDQIVQQIIAAGVTNFVEIGPGKVLAGLVKRINKETASFNVQD 299

Query: 302 VEDI 305
           V  +
Sbjct: 300 VAGV 303


>gi|116873243|ref|YP_850024.1| malonyl CoA-acyl carrier protein transacylase [Listeria welshimeri
           serovar 6b str. SLCC5334]
 gi|116742121|emb|CAK21245.1| malonyl CoA-acyl carrier protein transacylase [Listeria welshimeri
           serovar 6b str. SLCC5334]
          Length = 313

 Score =  232 bits (592), Expect = 4e-59,   Method: Compositional matrix adjust.
 Identities = 125/311 (40%), Positives = 187/311 (60%), Gaps = 5/311 (1%)

Query: 5   LTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPA 64
             FPGQG+Q IGMG+D+  ++PEA+ ++++ D  L  +++D++  G  E LT + NAQPA
Sbjct: 6   FVFPGQGAQKIGMGQDVAAAYPEAKKIYDDADERLGFSITDIITEGPMELLTKSENAQPA 65

Query: 65  LTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQ 124
           L + S+A +R +E  G  VK D  YVAGHSLGEY+AL A      SD I LVR RG+ M+
Sbjct: 66  LVSTSVAILRALETYG--VKAD--YVAGHSLGEYSALVAGGFLEASDAIYLVRKRGELME 121

Query: 125 EAVPPGLGSMVAIIGLDDCVVDSICAQASRVG-ICEIANDNGGGQVVISGLQDAVKCAAD 183
           +AVP G G+M A++G+D   +  I  + ++ G   ++AN N  GQ+VISG    V+ A +
Sbjct: 122 KAVPNGAGAMAAVLGVDREALKEITEEVTKAGDAVQLANLNCPGQIVISGTTTGVEKAGE 181

Query: 184 TCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSID 243
                GAKR + L VS PFHSSLM P +   + +L  V   D  +PI+ N  A   +   
Sbjct: 182 KAKANGAKRVLPLAVSGPFHSSLMEPAALAFRDILAEVEIADGKIPIVNNVDAKQTTDKA 241

Query: 244 EISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVE 303
           EIS  L++Q+   V W + ++    +GV +  E+GSGKVL GL K+I++ ++ +S   VE
Sbjct: 242 EISDKLIKQIYSPVLWEDIVEELIENGVDTFVEIGSGKVLAGLIKKINRDVTVLSAGDVE 301

Query: 304 DIDLALRSIVG 314
            +     ++ G
Sbjct: 302 SVKSVAETLKG 312


>gi|239996666|ref|ZP_04717190.1| malonyl CoA-acyl carrier protein transacylase [Alteromonas
           macleodii ATCC 27126]
          Length = 309

 Score =  232 bits (592), Expect = 5e-59,   Method: Compositional matrix adjust.
 Identities = 130/306 (42%), Positives = 182/306 (59%), Gaps = 6/306 (1%)

Query: 3   TVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQ 62
           T   FPGQGSQ +GM ++L ++ P     F+E    L  +L DL+ N +  +L  T   Q
Sbjct: 4   TACVFPGQGSQSVGMLKELAETSPIIEATFKEASDALGYDLWDLVQNDTDGKLNETHITQ 63

Query: 63  PALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKS 122
           PAL A S+A  RV+ + G+    D+ Y+AGHSLGEY+AL    A   +D I+LV ARGK 
Sbjct: 64  PALLAASVAIWRVIREQGI----DVDYLAGHSLGEYSALVCGGAMDFADAIKLVEARGKY 119

Query: 123 MQEAVPPGLGSMVAIIGLDDCVVDSICAQASRV--GICEIANDNGGGQVVISGLQDAVKC 180
           MQEAVP G G+M AIIGLDD  +  IC Q +     +    N N  GQVVI+G ++A + 
Sbjct: 120 MQEAVPAGAGAMYAIIGLDDAAIADICQQTAIATGDVVAPVNFNSPGQVVIAGEKNAAEQ 179

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           AA+ C   GAKRA+ L VS P H  LM P +  ++  L S+   +P + I+ N   +  +
Sbjct: 180 AANACKEAGAKRALPLAVSVPSHCELMRPAADKLEDALSSLNVNEPAINIVNNVDVTIET 239

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
             D I   LV Q+   V+W  T+++ A  GV+ V EVG GKVLTGL KRIDKSL +++++
Sbjct: 240 QGDAIKNALVRQLYCPVQWTRTVEYLAAAGVERVIEVGPGKVLTGLNKRIDKSLESLAVN 299

Query: 301 KVEDID 306
             + ++
Sbjct: 300 TPDGVE 305


>gi|229104414|ref|ZP_04235083.1| Malonyl CoA-acyl carrier protein transacylase [Bacillus cereus
           Rock3-28]
 gi|228679112|gb|EEL33320.1| Malonyl CoA-acyl carrier protein transacylase [Bacillus cereus
           Rock3-28]
          Length = 314

 Score =  232 bits (591), Expect = 6e-59,   Method: Compositional matrix adjust.
 Identities = 124/296 (41%), Positives = 177/296 (59%), Gaps = 9/296 (3%)

Query: 7   FPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPALT 66
           FPGQGSQ +GMGR L ++  E   VF + D  L  +LS++++ G QE+LT T NAQPAL 
Sbjct: 8   FPGQGSQAVGMGRQLAENNNEVAKVFAKADEVLQDSLSEVIFEGPQEKLTLTTNAQPALL 67

Query: 67  AVSMAFIRVMEKNGLCVKRDIS--YVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQ 124
             S A +  +++       DI+  +VAGHSLGEY+AL AA A +  D +  VR RG+ M+
Sbjct: 68  TTSFAILTALKE------YDITPDFVAGHSLGEYSALVAAGAITFEDAVYAVRKRGEYME 121

Query: 125 EAVPPGLGSMVAIIGLDDCVVDSICAQASRVGIC-EIANDNGGGQVVISGLQDAVKCAAD 183
           EAVP G G+M AI+G D  ++  +  + +  G   +IAN N   Q+VISG    V+ A+ 
Sbjct: 122 EAVPGGEGAMAAILGADPDMLKRVTEEVTSEGYAVQIANMNSTKQIVISGTNQGVELASQ 181

Query: 184 TCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSID 243
                GAKRA+ L VS PFHSSLM P ++  + +L+ +T QD  +P++ N  A  ++   
Sbjct: 182 RAKENGAKRAIPLKVSGPFHSSLMKPAAEKFQSVLNEITIQDTNIPVIANVTADVITRGA 241

Query: 244 EISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
           +I   L+EQ+   V W  +I+     GV +  E+G GKVL GL K ID S+ A +I
Sbjct: 242 DIQEKLIEQLYSPVLWYPSIETMVKQGVDTFIEIGPGKVLAGLMKSIDSSVKAYAI 297


>gi|229180128|ref|ZP_04307472.1| Malonyl CoA-acyl carrier protein transacylase [Bacillus cereus
           172560W]
 gi|228603337|gb|EEK60814.1| Malonyl CoA-acyl carrier protein transacylase [Bacillus cereus
           172560W]
          Length = 314

 Score =  232 bits (591), Expect = 6e-59,   Method: Compositional matrix adjust.
 Identities = 124/311 (39%), Positives = 184/311 (59%), Gaps = 9/311 (2%)

Query: 7   FPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPALT 66
           FPGQGSQ +GMG+ L ++  E   VF + D  L ++LS++++ G QE+LT T NAQPAL 
Sbjct: 8   FPGQGSQAVGMGKQLAENNKEVAKVFAKADEVLQESLSEVIFEGPQEKLTLTTNAQPALL 67

Query: 67  AVSMAFIRVMEKNGLCVKRDIS--YVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQ 124
             S A +  +++       DI+  +VAGHSLGEY+AL AA A +  D +  VR RG+ M+
Sbjct: 68  TTSFAILTALKE------YDITPDFVAGHSLGEYSALVAAGALTFEDAVYAVRKRGEYME 121

Query: 125 EAVPPGLGSMVAIIGLDDCVVDSICAQASRVGIC-EIANDNGGGQVVISGLQDAVKCAAD 183
           EAVP G G+M AI+G D  ++  +  + +  G   +IAN N   Q+VISG +  V+ A+ 
Sbjct: 122 EAVPGGEGAMAAILGADPHMLKQVTEEVTSEGYAVQIANMNSTKQIVISGTKQGVEVASQ 181

Query: 184 TCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSID 243
                GAKRA+ L VS PFHSSLM P ++  + +L+ +T  D  +P++ N  A  ++   
Sbjct: 182 RAKENGAKRAIPLKVSGPFHSSLMKPAAEKFQSVLNEITIHDTNIPVIANVTADVITRGA 241

Query: 244 EISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVE 303
           +I   L+EQ+   V W  +I+     GV +  E+G GKVL GL K ID S+ A +I   E
Sbjct: 242 DIQEKLIEQLYSPVLWYPSIECMVKQGVDTFIEIGPGKVLAGLMKSIDSSVKAYAIYDEE 301

Query: 304 DIDLALRSIVG 314
            +   + ++ G
Sbjct: 302 TLKDTISNLRG 312


>gi|297584003|ref|YP_003699783.1| malonyl CoA-acyl carrier protein transacylase [Bacillus
           selenitireducens MLS10]
 gi|297142460|gb|ADH99217.1| malonyl CoA-acyl carrier protein transacylase [Bacillus
           selenitireducens MLS10]
          Length = 316

 Score =  232 bits (591), Expect = 6e-59,   Method: Compositional matrix adjust.
 Identities = 127/308 (41%), Positives = 184/308 (59%), Gaps = 5/308 (1%)

Query: 3   TVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQ 62
           T + FPGQGSQ  GMG +L+ ++   + +  + D  LN++LS++M++GS++EL  T N Q
Sbjct: 4   TAVMFPGQGSQTPGMGHELFMNYSGVKEIHAKADRVLNRSLSEMMFSGSEDELKKTVNTQ 63

Query: 63  PALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKS 122
           PAL     A  R +E NG+       +  GHSLGEYTAL A+ A   SD + LV  RG+ 
Sbjct: 64  PALVTSGTAIWRELEANGVHA----DFACGHSLGEYTALVASGALRFSDAVTLVEKRGQL 119

Query: 123 MQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVG-ICEIANDNGGGQVVISGLQDAVKCA 181
           M+EAVP G G+M AI+GLD   +  I  +  ++G + E AN N  GQ+VISG +  V+ A
Sbjct: 120 MEEAVPDGKGAMAAIMGLDGDSLSEISEEIRQIGEVAEPANYNAEGQIVISGTKAGVEQA 179

Query: 182 ADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSS 241
            +    +GA+RA+ L VS PFHSSLM P S+ M+ +L  VT  D  +P++ N  A P +S
Sbjct: 180 CERAKARGARRAIPLNVSGPFHSSLMKPASERMEQVLQPVTVGDMNIPVIANVTAKPYTS 239

Query: 242 IDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISK 301
             EI  LL  Q+   VRW +TI++  + GV +  E G GKVL GL K++ +  + + +  
Sbjct: 240 SSEIKDLLTAQIHSPVRWTDTIRYLVDQGVDTFIEAGPGKVLAGLVKKVSRRATVLPVYD 299

Query: 302 VEDIDLAL 309
            E    A+
Sbjct: 300 EETFQKAV 307


>gi|228992580|ref|ZP_04152507.1| Malonyl CoA-acyl carrier protein transacylase [Bacillus
           pseudomycoides DSM 12442]
 gi|228998628|ref|ZP_04158215.1| Malonyl CoA-acyl carrier protein transacylase [Bacillus mycoides
           Rock3-17]
 gi|228761096|gb|EEM10055.1| Malonyl CoA-acyl carrier protein transacylase [Bacillus mycoides
           Rock3-17]
 gi|228767214|gb|EEM15850.1| Malonyl CoA-acyl carrier protein transacylase [Bacillus
           pseudomycoides DSM 12442]
          Length = 316

 Score =  232 bits (591), Expect = 6e-59,   Method: Compositional matrix adjust.
 Identities = 127/311 (40%), Positives = 184/311 (59%), Gaps = 9/311 (2%)

Query: 7   FPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPALT 66
           FPGQGSQ +GMG+ L  +  E   +F++ D  L ++LS L++ G QE+LT T NAQPAL 
Sbjct: 8   FPGQGSQAVGMGQQLAGNNKEVAKIFQKADEVLQESLSSLIFEGPQEKLTLTTNAQPALL 67

Query: 67  AVSMAFIRVMEKNGLCVKRDIS--YVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQ 124
             S+A +  +++       DI+  YVAGHSLGEY+AL AA A +  D +  VR RG+ M+
Sbjct: 68  TTSIAILTALKQ------YDITPDYVAGHSLGEYSALVAAGALTFEDAVYAVRKRGEYME 121

Query: 125 EAVPPGLGSMVAIIGLDDCVVDSICAQASRVG-ICEIANDNGGGQVVISGLQDAVKCAAD 183
           EAVP G G+M AI+G D  V+  +  + +  G   +IAN N   Q+VISG +  V+ A+ 
Sbjct: 122 EAVPSGEGAMAAILGADPDVLKQVTEEVTSEGHAVQIANMNSTKQIVISGTKRGVELASQ 181

Query: 184 TCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSID 243
                GAKRA+ L VS PFHSSLM P ++  + +L+ +T QD  +P++ N  A+ V+  +
Sbjct: 182 KVKENGAKRAIPLRVSGPFHSSLMKPAAEKFQNVLNEITIQDANIPVVANVTANCVNRSE 241

Query: 244 EISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVE 303
           +I   L+EQ+   V W  +I+     GV +  E+G GKVL GL K I  S    +I   E
Sbjct: 242 DIQEKLIEQLYSPVLWYPSIEQMVEQGVDTFIEIGPGKVLAGLMKSIAPSAKVYAIYDEE 301

Query: 304 DIDLALRSIVG 314
            +   + S+ G
Sbjct: 302 TLKDTISSLRG 312


>gi|229117338|ref|ZP_04246716.1| Malonyl CoA-acyl carrier protein transacylase [Bacillus cereus
           Rock1-3]
 gi|228666238|gb|EEL21702.1| Malonyl CoA-acyl carrier protein transacylase [Bacillus cereus
           Rock1-3]
          Length = 314

 Score =  232 bits (591), Expect = 7e-59,   Method: Compositional matrix adjust.
 Identities = 125/296 (42%), Positives = 177/296 (59%), Gaps = 9/296 (3%)

Query: 7   FPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPALT 66
           FPGQGSQ +GMGR L ++  E   VF + D  L+ +LS++++ G QE+LT T NAQPAL 
Sbjct: 8   FPGQGSQAVGMGRQLAENNNEVAKVFAKADEVLHDSLSEVIFEGPQEKLTLTTNAQPALL 67

Query: 67  AVSMAFIRVMEKNGLCVKRDIS--YVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQ 124
             S A +  +++       DI+  +VAGHSLGEY+AL AA A +  D +  VR RG+ M+
Sbjct: 68  TTSFAILTALKE------YDITPDFVAGHSLGEYSALVAAGAITFEDAVYAVRKRGEYME 121

Query: 125 EAVPPGLGSMVAIIGLDDCVVDSICAQASRVGIC-EIANDNGGGQVVISGLQDAVKCAAD 183
           EAVP G G+M AI+G D  ++  +  + +  G   +IAN N   Q+VISG    V+ A+ 
Sbjct: 122 EAVPGGEGAMAAILGADPDMLKRVTEEVTSEGYAVQIANMNSTKQIVISGTIQGVELASQ 181

Query: 184 TCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSID 243
                GAKRA+ L VS PFHSSLM P ++  + +LD +T QD  +P++ N  A  ++   
Sbjct: 182 RAKENGAKRAISLKVSGPFHSSLMKPAAEKFQSVLDEITIQDTNIPVIANVTADVITRGA 241

Query: 244 EISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
           +I   L+EQ+   V W  +I+     GV    E+G GKVL GL K ID S+ A +I
Sbjct: 242 DIQEKLIEQLYSPVLWYPSIETMVKQGVDIFIEIGPGKVLAGLMKSIDSSVKAYAI 297


>gi|194333022|ref|YP_002014882.1| malonyl CoA-acyl carrier protein transacylase [Prosthecochloris
           aestuarii DSM 271]
 gi|194310840|gb|ACF45235.1| malonyl CoA-acyl carrier protein transacylase [Prosthecochloris
           aestuarii DSM 271]
          Length = 304

 Score =  231 bits (590), Expect = 7e-59,   Method: Compositional matrix adjust.
 Identities = 126/305 (41%), Positives = 176/305 (57%), Gaps = 6/305 (1%)

Query: 5   LTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPA 64
             FPGQGSQ  GM +D+Y++FP+A+ V ++ +  L  +++D+M++  +EEL  T   QPA
Sbjct: 4   FVFPGQGSQYCGMAKDIYNAFPQAKAVMDKANDILGYSITDIMFDAPEEELRKTQYTQPA 63

Query: 65  LTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQ 124
           +   S+A   ++ K G      +   AGHSLGEYTALC A A S  D +++V  RG+ MQ
Sbjct: 64  IFLHSIAVAELLGKEG------VDMAAGHSLGEYTALCFAGAMSFEDAMKIVARRGELMQ 117

Query: 125 EAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAADT 184
            A     GSM AIIG+ D V+D +  +A   GI + AN N  GQ+VISG   AVK A + 
Sbjct: 118 HAGTRNPGSMAAIIGMKDDVLDELLKEAGETGIVQAANFNSPGQIVISGEISAVKKAVEL 177

Query: 185 CLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSIDE 244
              KGA+ A  LPVS  FHS LM P  + +K  LD++T  D  +P+  N  A PV    +
Sbjct: 178 APLKGARMAKELPVSGAFHSPLMKPAEEELKAALDAITIHDAAIPVCMNVTAEPVCKAAD 237

Query: 245 ISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVED 304
           I   LV Q+T  VRW ++++     GV    E+G  KVL GL KRID++++   I   E 
Sbjct: 238 IRNNLVLQLTSPVRWTQSVETMIAGGVTLFSEIGPQKVLQGLIKRIDRNVTIQGIDNAEQ 297

Query: 305 IDLAL 309
           I   L
Sbjct: 298 IQQQL 302


>gi|193211805|ref|YP_001997758.1| malonyl CoA-acyl carrier protein transacylase [Chlorobaculum parvum
           NCIB 8327]
 gi|193085282|gb|ACF10558.1| malonyl CoA-acyl carrier protein transacylase [Chlorobaculum parvum
           NCIB 8327]
          Length = 303

 Score =  231 bits (590), Expect = 8e-59,   Method: Compositional matrix adjust.
 Identities = 126/304 (41%), Positives = 174/304 (57%), Gaps = 6/304 (1%)

Query: 5   LTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPA 64
             FPGQGSQ  GMGRDLY+ FPE + + ++ D  L  +++++M+NGS+EEL  T   Q A
Sbjct: 4   FVFPGQGSQYCGMGRDLYERFPEVKALMDKADEILGFSITNIMFNGSEEELKQTRYTQLA 63

Query: 65  LTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQ 124
           +   S A   ++ + G      +   AGHSLGEYTALC A A    D +RLV  RG+ MQ
Sbjct: 64  IFLHSYAAATLLGREG------VEMAAGHSLGEYTALCFAGALDFEDAVRLVAKRGELMQ 117

Query: 125 EAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAADT 184
            A     G+M AIIG+ D  +D +  +A   GI + AN N  GQ+VISG  DAV+ A + 
Sbjct: 118 NAGQQNPGTMAAIIGMADEALDGLLQEAGSAGIVQAANFNSPGQIVISGDVDAVRKAVEL 177

Query: 185 CLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSIDE 244
             +KGA+ A  L VS  FHS LM P  K +   LD++  +D  +P+  N  A PV++  E
Sbjct: 178 APSKGARMAKELVVSGAFHSPLMKPAEKELAETLDTIAIRDAEIPVCMNVVAKPVTAAAE 237

Query: 245 ISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVED 304
           I   L+ Q+T  V W +++Q   + GV    EVG  KVL GL KRI K+ S   +   + 
Sbjct: 238 IRANLISQLTSSVLWSQSVQAMVDAGVTEFVEVGPQKVLQGLIKRISKAASIAGVDTADQ 297

Query: 305 IDLA 308
           +D A
Sbjct: 298 VDAA 301


>gi|325291123|ref|YP_004267304.1| (Acyl-carrier-protein) S-malonyltransferase [Syntrophobotulus
           glycolicus DSM 8271]
 gi|324966524|gb|ADY57303.1| (Acyl-carrier-protein) S-malonyltransferase [Syntrophobotulus
           glycolicus DSM 8271]
          Length = 313

 Score =  231 bits (590), Expect = 8e-59,   Method: Compositional matrix adjust.
 Identities = 125/288 (43%), Positives = 176/288 (61%), Gaps = 4/288 (1%)

Query: 7   FPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPALT 66
           F GQG+Q +GMG+DLY  F  AR +F+  D  L+ +LS L + GS+EEL  T N QPA+ 
Sbjct: 8   FAGQGAQYVGMGQDLYQHFAAAREIFDLADGQLDGSLSKLCFEGSKEELDKTENTQPAIL 67

Query: 67  AVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQEA 126
            VS+A  RV+E++G  +K D++  AG SLGEY+AL AA A S  +T+RLVR RGK MQEA
Sbjct: 68  TVSIAAWRVLEESG--IKADVA--AGLSLGEYSALIAAGALSFEETVRLVRQRGKFMQEA 123

Query: 127 VPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAADTCL 186
           VP G G M AI+GLD+ +V+  C      GI ++AN N  GQ VI+G  +A+  A     
Sbjct: 124 VPLGTGGMAAILGLDNELVEEACLAGRTAGIVQVANYNCPGQTVIAGENEALALAVAKAR 183

Query: 187 NKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSIDEIS 246
             GAKR + L VS PFH++++   ++ +   L+ +T +   +P+L N     +  I EI 
Sbjct: 184 ELGAKRVLPLDVSGPFHTTMLQDAAEKLARELEKITIKPLTMPVLTNVTGDYIRDIIEIK 243

Query: 247 RLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSL 294
            LL +QV   VRW ++I+     GV +  EVG G  L G  K++D+ L
Sbjct: 244 PLLKKQVMSPVRWEDSIKRMIADGVDTFVEVGPGSALRGFVKKVDRKL 291


>gi|296158246|ref|ZP_06841078.1| malonyl CoA-acyl carrier protein transacylase [Burkholderia sp.
           Ch1-1]
 gi|295891582|gb|EFG71368.1| malonyl CoA-acyl carrier protein transacylase [Burkholderia sp.
           Ch1-1]
          Length = 311

 Score =  231 bits (590), Expect = 8e-59,   Method: Compositional matrix adjust.
 Identities = 133/299 (44%), Positives = 170/299 (56%), Gaps = 4/299 (1%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M     FPGQGSQ +GM  + +      R   +E    LNQ+L  L+  G  E+L  T N
Sbjct: 1   MKFAFVFPGQGSQSVGM-LNAFADHAVVRETVQEASDALNQDLGKLIAEGPAEDLNLTTN 59

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
            QP +   S A  R   + G       + VAGHSLGEYTAL AA A +  D + LVR R 
Sbjct: 60  TQPVMLTASYAMYRAWLQAG---GPKPAIVAGHSLGEYTALVAAGAIAFRDAVPLVRFRA 116

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           ++MQ AVP G G M AI+GLDD  V ++CA+AS  G+ E  N N   QVVI+G + AV+ 
Sbjct: 117 QAMQTAVPVGEGGMAAILGLDDDTVRAVCAEASAAGVVEAVNFNAPAQVVIAGNKAAVEK 176

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A +    KGAKRA+ LPVSAPFHSSL+ P S  ++  L SV  Q P +P++ N   + V+
Sbjct: 177 ACEVAKAKGAKRALPLPVSAPFHSSLLKPASDQLREYLASVDVQVPAIPVINNVDVAVVN 236

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
               I   LV Q  G VRW E+++  +  GV  V E G GKVL GL KRID +L   SI
Sbjct: 237 EPAGIKDALVRQAAGAVRWVESVRAMSAQGVTHVIECGPGKVLAGLTKRIDGNLVGASI 295


>gi|238019513|ref|ZP_04599939.1| hypothetical protein VEIDISOL_01382 [Veillonella dispar ATCC 17748]
 gi|237864212|gb|EEP65502.1| hypothetical protein VEIDISOL_01382 [Veillonella dispar ATCC 17748]
          Length = 320

 Score =  231 bits (590), Expect = 9e-59,   Method: Compositional matrix adjust.
 Identities = 127/315 (40%), Positives = 177/315 (56%), Gaps = 5/315 (1%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M T   FPGQGSQ +GM +DLY+++P  +  FEE D  L  ++S L + G   EL  T N
Sbjct: 8   MKTAFVFPGQGSQKVGMLQDLYNAYPIVKQRFEEADEALGYSISKLCFEGPDTELVKTAN 67

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
            QPA+   S+A   V+++ G     DI  V GHSLGEY+AL AA   +  D + +V  RG
Sbjct: 68  TQPAILTASVACYEVLKEQGFT--PDI--VGGHSLGEYSALVAAGVLNFKDAVYVVHKRG 123

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQAS-RVGICEIANDNGGGQVVISGLQDAVK 179
           + MQEAVP G G+M AI+ L    V  IC + +  VG  +  N N  GQ+VI+G   AV+
Sbjct: 124 EYMQEAVPLGKGAMAAILALPREQVVEICKEVNDSVGSVQAVNFNCPGQIVIAGETAAVE 183

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            AA+     GAKRAV LPVSAPFHS LM P +  +K  LD +   D  +P++ N     +
Sbjct: 184 TAAEKMKEAGAKRAVMLPVSAPFHSRLMEPAALRLKEELDKIQVSDAQIPVVANVTGKIL 243

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
           ++ ++I   LV Q    V W + +    N GV    EVG GKVLTG  K+I+K +   ++
Sbjct: 244 TNANDIKESLVTQAANPVLWEDCVAEMVNFGVTRFVEVGPGKVLTGFTKKINKDMELANV 303

Query: 300 SKVEDIDLALRSIVG 314
             +  ++  L  + G
Sbjct: 304 EDIASLEKTLEFLKG 318


>gi|294791667|ref|ZP_06756815.1| malonyl CoA-acyl carrier protein transacylase [Veillonella sp.
           6_1_27]
 gi|294456897|gb|EFG25259.1| malonyl CoA-acyl carrier protein transacylase [Veillonella sp.
           6_1_27]
          Length = 313

 Score =  231 bits (590), Expect = 9e-59,   Method: Compositional matrix adjust.
 Identities = 126/315 (40%), Positives = 178/315 (56%), Gaps = 5/315 (1%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M T   FPGQGSQ +GM +DLY+++P  +  FEE D  L  ++S L + G   EL  T N
Sbjct: 1   MKTAFVFPGQGSQKVGMLQDLYNAYPIVKQRFEEADEALGYSISKLCFEGPDTELVKTAN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
            QPA+   S+A   ++++ G     DI  V GHSLGEY+AL AA   +  D + +V  RG
Sbjct: 61  TQPAILTASVACYEILKEQGFM--PDI--VGGHSLGEYSALVAAGVLNFKDAVYVVHKRG 116

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQA-SRVGICEIANDNGGGQVVISGLQDAVK 179
           + MQEAVP G G+M AI+ L    V  IC +  + VG  +  N N  GQ+VI+G   AV+
Sbjct: 117 EYMQEAVPLGKGAMAAILALPREQVVEICEEVNASVGSVQAVNFNCPGQIVIAGETAAVE 176

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            AA+     GAKRAV LPVSAPFHS LM P +  +K  LD +   D  +P++ N     +
Sbjct: 177 TAAEKMKEAGAKRAVMLPVSAPFHSRLMEPAALRLKEELDKIQVSDAQIPVVANVTGKIL 236

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
           ++ ++I + LV Q    V W + +    N GV    EVG GKVLTG  K+I+K +   ++
Sbjct: 237 TNANDIKKSLVTQAANPVLWEDCVAEMVNFGVTRFVEVGPGKVLTGFTKKINKDMELANV 296

Query: 300 SKVEDIDLALRSIVG 314
             +  ++  L  + G
Sbjct: 297 EDIASLEKTLEFLKG 311


>gi|303231098|ref|ZP_07317838.1| [acyl-carrier-protein] S-malonyltransferase [Veillonella atypica
           ACS-049-V-Sch6]
 gi|302514229|gb|EFL56231.1| [acyl-carrier-protein] S-malonyltransferase [Veillonella atypica
           ACS-049-V-Sch6]
          Length = 313

 Score =  231 bits (589), Expect = 9e-59,   Method: Compositional matrix adjust.
 Identities = 128/315 (40%), Positives = 175/315 (55%), Gaps = 5/315 (1%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M T   FPGQGSQ +GM +DLY+++P  +  FEE D  L  ++S L + G   EL  T N
Sbjct: 1   MKTAFVFPGQGSQKVGMLQDLYNAYPIVKQRFEEADEALGYSISKLCFEGPDTELVKTAN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
            QPA+   S+A   V+++ G     DI  V GHSLGEY+AL AA      D + +V  RG
Sbjct: 61  TQPAILTASVACYEVLKEQGFT--PDI--VGGHSLGEYSALVAAGVLDFKDAVYVVHKRG 116

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQAS-RVGICEIANDNGGGQVVISGLQDAVK 179
           + MQEAVP G G+M AI+ L    V  IC Q +  VG  +  N N  GQ+VI+G   AV+
Sbjct: 117 EYMQEAVPLGKGAMAAILALPREQVVEICQQVNDTVGSVQAVNFNCPGQIVIAGETAAVE 176

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            AA+     GAKRAV LPVSAPFHS LM P +  +K  LD +   D  +P++ N     +
Sbjct: 177 TAAEKMKEAGAKRAVMLPVSAPFHSRLMEPAALRLKEELDKIQVNDAKIPVVANVTGKIL 236

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
           ++  +I   LV Q    V W + +    N GV    EVG GKVLTG  K+I+K +   ++
Sbjct: 237 TNASDIKESLVTQAANPVLWEDCVAEMVNFGVTRFVEVGPGKVLTGFTKKINKEMELANV 296

Query: 300 SKVEDIDLALRSIVG 314
             +  ++  L  + G
Sbjct: 297 EDIPSLEKTLEFLKG 311


>gi|187924887|ref|YP_001896529.1| malonyl CoA-acyl carrier protein transacylase [Burkholderia
           phytofirmans PsJN]
 gi|187716081|gb|ACD17305.1| malonyl CoA-acyl carrier protein transacylase [Burkholderia
           phytofirmans PsJN]
          Length = 311

 Score =  231 bits (589), Expect = 9e-59,   Method: Compositional matrix adjust.
 Identities = 133/299 (44%), Positives = 171/299 (57%), Gaps = 4/299 (1%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M     FPGQGSQ +GM  + +      R   +E    LNQ+L  L+  G  E+L  T N
Sbjct: 1   MKFAFVFPGQGSQSVGM-LNAFADHAVVRETVQEASDALNQDLGKLIAEGPVEDLNLTTN 59

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
            QP +   + A  R   + G       + VAGHSLGEYTAL AA A +  D + LVR R 
Sbjct: 60  TQPVMLTAAYAMYRAWLQAG---GPKPAIVAGHSLGEYTALVAAGAIAFRDAVPLVRFRA 116

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           ++MQ AVP G G M AI+GLDD  V ++CA+AS  G+ E  N N   QVVI+G + AV+ 
Sbjct: 117 QAMQTAVPVGEGGMAAILGLDDDAVRAVCAEASVAGVVEAVNFNAPAQVVIAGNKAAVEK 176

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A +    KGAKRA+ LPVSAPFHSSL+ P S  ++  L SV  Q P +P++ N   + V+
Sbjct: 177 ACEVAKAKGAKRALPLPVSAPFHSSLLKPASDQLREYLASVEVQVPAIPVINNVDVAVVN 236

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
              +I   LV Q  G VRW E++Q  +  GV  V E G GKVL GL KRID +L   SI
Sbjct: 237 EPVKIKDALVRQAAGAVRWVESVQAMSAQGVTHVIECGPGKVLAGLTKRIDGNLIGASI 295


>gi|254514404|ref|ZP_05126465.1| malonyl CoA-acyl carrier protein transacylase [gamma
           proteobacterium NOR5-3]
 gi|219676647|gb|EED33012.1| malonyl CoA-acyl carrier protein transacylase [gamma
           proteobacterium NOR5-3]
          Length = 315

 Score =  231 bits (589), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 136/308 (44%), Positives = 174/308 (56%), Gaps = 5/308 (1%)

Query: 7   FPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPALT 66
           FPGQGSQ +GM     + FPE   VFEE    L  +LS L+ NG  E+L  T   QPAL 
Sbjct: 9   FPGQGSQRVGMLAQAAEEFPEVAAVFEESSEALGFDLSALILNGDPEQLNLTEFTQPALL 68

Query: 67  AVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQEA 126
           A S+A  R     G       S +AGHSLGE++ALC A A SL D + LVR RG+ MQ A
Sbjct: 69  ASSVALWRSWVARGGVTP---SAMAGHSLGEFSALCCAGALSLGDAVTLVRERGRFMQTA 125

Query: 127 VPPGLGSMVAIIGLDDCVVDSICAQ--ASRVGICEIANDNGGGQVVISGLQDAVKCAADT 184
           VP G+GSM AI+GLDD VV   CAQ  A   G+ E  N N  GQVVI+G   AV  A   
Sbjct: 126 VPVGVGSMAAILGLDDEVVSQTCAQVSADNEGVVEAVNFNAPGQVVIAGNCAAVDTAIAA 185

Query: 185 CLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSIDE 244
             + GAKRA+ LPVSAPFH+SLM P  + +  +L  +T + P +P++ N  A      + 
Sbjct: 186 LKDAGAKRAMPLPVSAPFHTSLMVPAGEQLAEVLADITIEAPQIPVVHNVHAQTEGEPER 245

Query: 245 ISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVED 304
           I  LLV Q++  VRW   I    + G     E G+G VL GL +RID+  +     K ED
Sbjct: 246 IRELLVRQISAPVRWTACISKLQSMGAVQFAECGAGNVLGGLLRRIDRGAACAYFEKPED 305

Query: 305 IDLALRSI 312
           +  A+ ++
Sbjct: 306 LKAAVLAL 313


>gi|229006128|ref|ZP_04163816.1| Malonyl CoA-acyl carrier protein transacylase [Bacillus mycoides
           Rock1-4]
 gi|228755204|gb|EEM04561.1| Malonyl CoA-acyl carrier protein transacylase [Bacillus mycoides
           Rock1-4]
          Length = 316

 Score =  231 bits (589), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 127/311 (40%), Positives = 184/311 (59%), Gaps = 9/311 (2%)

Query: 7   FPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPALT 66
           FPGQGSQ +GMG+ L  +  E   +F++ D  L ++LS L++ G QE+LT T NAQPAL 
Sbjct: 8   FPGQGSQAVGMGQQLAGNNKEVAKIFQKADEVLQESLSSLIFEGPQEKLTLTTNAQPALL 67

Query: 67  AVSMAFIRVMEKNGLCVKRDIS--YVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQ 124
             S+A +  +++       DI+  YVAGHSLGEY+AL AA A +  D +  VR RG+ M+
Sbjct: 68  TTSIAILTALKQ------YDITPDYVAGHSLGEYSALVAAGALTFEDAVYAVRKRGEYME 121

Query: 125 EAVPPGLGSMVAIIGLDDCVVDSICAQASRVG-ICEIANDNGGGQVVISGLQDAVKCAAD 183
           EAVP G G+M AI+G D  V+  +  + +  G   +IAN N   Q+VISG +  V+ A+ 
Sbjct: 122 EAVPSGEGAMAAILGADPDVLKQVTEEVTSEGHAVQIANMNSTKQIVISGTKRGVELASQ 181

Query: 184 TCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSID 243
                GAKRA+ L VS PFHSSLM P ++  + +L+ +T QD  +P++ N  A+ V+  +
Sbjct: 182 KVKENGAKRAIPLRVSGPFHSSLMKPAAEKFQNVLNEITIQDANIPVVANVTANCVNRSE 241

Query: 244 EISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVE 303
           +I   L+EQ+   V W  +I+     GV +  E+G GKVL GL K I  S    +I   E
Sbjct: 242 DIQEKLIEQLYSPVLWYPSIEQMVEQGVDTFIEIGPGKVLAGLMKSIVPSAKVYAIYDEE 301

Query: 304 DIDLALRSIVG 314
            +   + S+ G
Sbjct: 302 TLKDTISSLRG 312


>gi|170695410|ref|ZP_02886555.1| malonyl CoA-acyl carrier protein transacylase [Burkholderia
           graminis C4D1M]
 gi|170139601|gb|EDT07784.1| malonyl CoA-acyl carrier protein transacylase [Burkholderia
           graminis C4D1M]
          Length = 311

 Score =  231 bits (589), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 133/302 (44%), Positives = 175/302 (57%), Gaps = 10/302 (3%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFE---EVDHTLNQNLSDLMWNGSQEELTA 57
           M     FPGQGSQ +GM     ++F +  +V E   E    L+Q+L  L+  G  E+L  
Sbjct: 1   MKFAFVFPGQGSQSVGM----LNAFADHAIVRETVQEASDALSQDLGKLIAEGPAEDLNL 56

Query: 58  TCNAQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVR 117
           T N QP +   + A  R  ++ G       + VAGHSLGEYTAL AA A +  D + LVR
Sbjct: 57  TTNTQPVMLTAAYAIYRAWQQAGGPAP---AIVAGHSLGEYTALVAAGAIAFRDAVPLVR 113

Query: 118 ARGKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDA 177
            R ++MQ AVP G G M AI+GLDD  V ++CA+AS  G+ E  N N   QVVI+G + A
Sbjct: 114 FRAQAMQTAVPVGEGGMAAILGLDDDTVRAVCAEASVAGVVEAVNFNAPAQVVIAGHKAA 173

Query: 178 VKCAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCAS 237
           V+ A +    KGAKRA+ LPVSAPFHSSL+ P S  ++  L SV  + P +P++ N   +
Sbjct: 174 VEKACEVAKAKGAKRALPLPVSAPFHSSLLKPASDQLREYLASVDVKVPSIPVINNVDVA 233

Query: 238 PVSSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAV 297
            V+   +I   LV Q  G VRW E++Q  A  GV  V E G GKVL GL KRID +L   
Sbjct: 234 IVNEPAQIKDALVRQAAGAVRWVESVQAMAAQGVTHVVECGPGKVLAGLTKRIDGNLVGA 293

Query: 298 SI 299
           S+
Sbjct: 294 SV 295


>gi|303229656|ref|ZP_07316444.1| [acyl-carrier-protein] S-malonyltransferase [Veillonella atypica
           ACS-134-V-Col7a]
 gi|302515781|gb|EFL57735.1| [acyl-carrier-protein] S-malonyltransferase [Veillonella atypica
           ACS-134-V-Col7a]
          Length = 313

 Score =  231 bits (589), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 128/315 (40%), Positives = 175/315 (55%), Gaps = 5/315 (1%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M T   FPGQGSQ +GM +DLY+++P  +  FEE D  L  ++S L + G   EL  T N
Sbjct: 1   MKTAFVFPGQGSQKVGMLQDLYNAYPIVKQRFEEADEALGYSISKLCFEGPDTELVKTAN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
            QPA+   S+A   V+++ G     DI  V GHSLGEY+AL AA      D + +V  RG
Sbjct: 61  TQPAILTASVACYEVLKEQGFI--PDI--VGGHSLGEYSALVAAGVLDFKDAVYVVHKRG 116

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQAS-RVGICEIANDNGGGQVVISGLQDAVK 179
           + MQEAVP G G+M AI+ L    V  IC Q +  VG  +  N N  GQ+VI+G   AV+
Sbjct: 117 EYMQEAVPLGKGAMAAILALPREQVVEICQQVNDTVGSVQAVNFNCPGQIVIAGETAAVE 176

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            AA+     GAKRAV LPVSAPFHS LM P +  +K  LD +   D  +P++ N     +
Sbjct: 177 TAAEKMKEAGAKRAVMLPVSAPFHSRLMEPAALRLKEELDKIQVNDAKIPVVANVTGKIL 236

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
           ++  +I   LV Q    V W + +    N GV    EVG GKVLTG  K+I+K +   ++
Sbjct: 237 TNASDIKESLVTQAANPVLWEDCVAEMVNFGVTRFVEVGPGKVLTGFTKKINKEMELANV 296

Query: 300 SKVEDIDLALRSIVG 314
             +  ++  L  + G
Sbjct: 297 EDIPSLEKTLEFLKG 311


>gi|197119478|ref|YP_002139905.1| malonyl-CoA--acyl carrier protein transacylase [Geobacter
           bemidjiensis Bem]
 gi|197088838|gb|ACH40109.1| malonyl-CoA--acyl carrier protein transacylase [Geobacter
           bemidjiensis Bem]
          Length = 311

 Score =  231 bits (588), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 125/304 (41%), Positives = 180/304 (59%), Gaps = 3/304 (0%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
           S    FPGQGSQ  GMG++L ++F  AR+ FEE D  L  +LS L + G +++L  T N 
Sbjct: 3   SFAFIFPGQGSQHAGMGKELAENFKSARISFEEADDALGFSLSRLCFEGPEDDLKLTANT 62

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPA+ A S+A +RV+ +         S++AGHSLGEY+AL A+ A   +D +R VRARG 
Sbjct: 63  QPAILAASVAALRVLREETPLTP---SFLAGHSLGEYSALVASGALDFADALRTVRARGS 119

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCA 181
            MQ+AVP G+G+M AI+G +   +  ICA+A++  +   AN N  GQ+V++G   AV  A
Sbjct: 120 FMQDAVPVGVGAMAAILGAEAEQLAEICAEAAQGEVVSPANFNSPGQIVVAGHTAAVNRA 179

Query: 182 ADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSS 241
            +    KG ++A+ LPVSAPFH +LM   ++ +   L SV       P++ N  A P S 
Sbjct: 180 IEIAKAKGFRKAMLLPVSAPFHCALMQKAAERLAETLQSVQVNPLATPVVTNVEAKPNSD 239

Query: 242 IDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISK 301
              +  LLVEQV   V W + +Q     GV +  E+G GKVL GL KRI+K  ++ ++  
Sbjct: 240 PARVKPLLVEQVCAPVLWDQIVQQIVAAGVTNFVEIGPGKVLAGLVKRINKETASFNVQD 299

Query: 302 VEDI 305
           V  +
Sbjct: 300 VAGV 303


>gi|28898829|ref|NP_798434.1| acyl carrier protein S-malonyltransferase [Vibrio parahaemolyticus
           RIMD 2210633]
 gi|28807048|dbj|BAC60318.1| malonyl Coa-acyl carrier protein transacylase [Vibrio
           parahaemolyticus RIMD 2210633]
          Length = 307

 Score =  231 bits (588), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 129/304 (42%), Positives = 180/304 (59%), Gaps = 3/304 (0%)

Query: 5   LTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPA 64
           + FPGQGSQ +GM  DL + +   +  F E    L  +L  L+ NG  E+L  T   QPA
Sbjct: 6   IVFPGQGSQAVGMLADLGEQYDVVKQTFAEASDALGYDLWALVQNGPAEDLNQTFRTQPA 65

Query: 65  LTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQ 124
           L A S+A  RV ++ GL      + +AGHSLGEY+AL  A      + I+LV  RGK MQ
Sbjct: 66  LLASSVAIWRVWQELGL---EQPANLAGHSLGEYSALVCAGVIDFKEAIKLVELRGKLMQ 122

Query: 125 EAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAADT 184
           EAVP G G+M AIIGLDD V+   C +A++  +    N N  GQVVI+G +DAV+ A   
Sbjct: 123 EAVPAGTGAMYAIIGLDDDVIAKACEEAAQGDVVSPVNFNSPGQVVIAGSKDAVERAGAL 182

Query: 185 CLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSIDE 244
           C   GAKRA+ LPVS P H +LM P +  +   L+S+    P +P++ N   +  +   +
Sbjct: 183 CKEAGAKRALPLPVSVPSHCALMKPAADKLAVALESIEFNTPQLPVINNVDVAAETDPAK 242

Query: 245 ISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVED 304
           I   LV Q+   VRW E++Q  +  GV+++ E+G GKVLTGL KRI K+LSA +++ V  
Sbjct: 243 IKDALVRQLYSPVRWTESVQLMSEQGVENLLELGPGKVLTGLTKRIVKTLSAAAVNDVAS 302

Query: 305 IDLA 308
           ++ A
Sbjct: 303 LEAA 306


>gi|269797761|ref|YP_003311661.1| malonyl CoA-acyl carrier protein transacylase [Veillonella parvula
           DSM 2008]
 gi|282849035|ref|ZP_06258424.1| [acyl-carrier-protein] S-malonyltransferase [Veillonella parvula
           ATCC 17745]
 gi|269094390|gb|ACZ24381.1| malonyl CoA-acyl carrier protein transacylase [Veillonella parvula
           DSM 2008]
 gi|282581310|gb|EFB86704.1| [acyl-carrier-protein] S-malonyltransferase [Veillonella parvula
           ATCC 17745]
          Length = 313

 Score =  231 bits (588), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 126/315 (40%), Positives = 177/315 (56%), Gaps = 5/315 (1%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M T   FPGQGSQ +GM +DLY+++P  +  FEE D  L  ++S L + G   EL  T N
Sbjct: 1   MKTAFVFPGQGSQKVGMLQDLYNAYPIVKQRFEEADEALGYSISKLCFEGPDTELVKTAN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
            QPA+   S+A   ++++ G     DI  V GHSLGEY+AL AA   +  D + +V  RG
Sbjct: 61  TQPAILTASVACYEILKEQGFT--PDI--VGGHSLGEYSALVAAGVLNFKDAVYVVHKRG 116

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQA-SRVGICEIANDNGGGQVVISGLQDAVK 179
           + MQEAVP G G+M AI+ L    V  IC +  + VG  +  N N  GQ+VI+G   AV+
Sbjct: 117 EYMQEAVPLGKGAMAAILALPREQVVEICEEVNASVGSVQAVNFNCPGQIVIAGETAAVE 176

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            AA+     GAKRAV LPVSAPFHS LM P +  +K  LD +   D  +P++ N     +
Sbjct: 177 TAAEKMKEAGAKRAVMLPVSAPFHSRLMEPAALRLKEELDKIQVSDAQIPVVANVTGKIL 236

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
           ++ ++I   LV Q    V W + +    N GV    EVG GKVLTG  K+I+K +   ++
Sbjct: 237 TNANDIKESLVTQAANPVLWEDCVAEMVNFGVTRFVEVGPGKVLTGFTKKINKDMELANV 296

Query: 300 SKVEDIDLALRSIVG 314
             +  ++  L  + G
Sbjct: 297 EDIASLEKTLEFLKG 311


>gi|292670171|ref|ZP_06603597.1| malonyl CoA-acyl carrier protein transacylase [Selenomonas noxia
           ATCC 43541]
 gi|292648123|gb|EFF66095.1| malonyl CoA-acyl carrier protein transacylase [Selenomonas noxia
           ATCC 43541]
          Length = 311

 Score =  231 bits (588), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 122/306 (39%), Positives = 173/306 (56%), Gaps = 4/306 (1%)

Query: 7   FPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPALT 66
           FPGQG+QV+GMG+D +D++  A+  F E D  L  ++S L + G  ++L  T + QPA+ 
Sbjct: 8   FPGQGAQVVGMGKDFFDAYDLAKKRFAEADEALGYSISKLCFEGPADQLQLTEHTQPAIL 67

Query: 67  AVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQEA 126
            VS+    ++ + G+  +      AGHSLGEY+AL  A   S  D + LV  RG  MQEA
Sbjct: 68  TVSVIAAELLREEGIAPE----IAAGHSLGEYSALVLAGVLSFQDAVALVHKRGAYMQEA 123

Query: 127 VPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAADTCL 186
           VP G G+M A+IGLDD  + ++CA+AS  G  +  N N  GQ VI+G    V+ A +   
Sbjct: 124 VPVGEGAMAAVIGLDDDTIVAVCAEASAAGAVQAVNFNCPGQTVIAGTVKGVEQAVELLQ 183

Query: 187 NKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSIDEIS 246
            KGAK+AV LPVSAPFHS+LM P +K +   LD V   D   P++ N+      +  EI 
Sbjct: 184 EKGAKKAVILPVSAPFHSTLMEPAAKKLAAELDKVQLHDAAFPVVSNYTGGLQQTAAEIK 243

Query: 247 RLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVEDID 306
             LV Q    VRW   +      G  +  E G GK L G  KRIDK+L+++++  V  + 
Sbjct: 244 ANLVAQADHPVRWIACVNTMRTFGADTYVECGPGKTLAGFNKRIDKALTSLNVENVASLQ 303

Query: 307 LALRSI 312
             L ++
Sbjct: 304 KTLDTL 309


>gi|126452756|ref|YP_001067099.1| malonyl CoA-acyl carrier protein transacylase [Burkholderia
           pseudomallei 1106a]
 gi|167846669|ref|ZP_02472177.1| malonyl CoA-acyl carrier protein transacylase [Burkholderia
           pseudomallei B7210]
 gi|242317242|ref|ZP_04816258.1| malonyl CoA-acyl carrier protein transacylase [Burkholderia
           pseudomallei 1106b]
 gi|254195792|ref|ZP_04902218.1| malonyl CoA-acyl carrier protein transacylase [Burkholderia
           pseudomallei S13]
 gi|254296859|ref|ZP_04964312.1| malonyl CoA-acyl carrier protein transacylase [Burkholderia
           pseudomallei 406e]
 gi|126226398|gb|ABN89938.1| malonyl CoA-acyl carrier protein transacylase [Burkholderia
           pseudomallei 1106a]
 gi|157807915|gb|EDO85085.1| malonyl CoA-acyl carrier protein transacylase [Burkholderia
           pseudomallei 406e]
 gi|169652537|gb|EDS85230.1| malonyl CoA-acyl carrier protein transacylase [Burkholderia
           pseudomallei S13]
 gi|242140481|gb|EES26883.1| malonyl CoA-acyl carrier protein transacylase [Burkholderia
           pseudomallei 1106b]
          Length = 310

 Score =  231 bits (588), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 133/313 (42%), Positives = 178/313 (56%), Gaps = 10/313 (3%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHT---LNQNLSDLMWNGSQEELTA 57
           M     FPGQGSQ +GM     ++F +  +V E +D     L Q++  L+ +G  +EL  
Sbjct: 1   MKFAFVFPGQGSQSVGM----LNAFADVAVVRETLDEASDALGQDIGKLIADGPADELNL 56

Query: 58  TCNAQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVR 117
           T N QP +   + A  R  ++ G       S VAGHSLGEYTAL AA A +  D + LVR
Sbjct: 57  TTNTQPVMLTAAYACYRAWQQAG---GAQPSIVAGHSLGEYTALVAAGAIAFRDALPLVR 113

Query: 118 ARGKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDA 177
            R ++MQ AVP G+G M AI+GLDD  V ++CA+AS  G+ E  N N   QVVI+G +  
Sbjct: 114 FRAQAMQTAVPVGVGGMAAILGLDDDTVRAVCAEASATGVVEAVNFNAPAQVVIAGTKAG 173

Query: 178 VKCAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCAS 237
           ++ A +    KGAKRA+ LPVSAPFHSSL+ P S  ++  L  V  + P + ++ N   +
Sbjct: 174 IEKACEIAKAKGAKRALPLPVSAPFHSSLLKPASDKLREYLAGVDVKAPKISVVNNIDVA 233

Query: 238 PVSSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAV 297
            VS    I   LV Q  G VRW E +Q  A  GV  V+E G GKVL GL KRID +L   
Sbjct: 234 VVSDPAAIKDALVRQAAGPVRWVECVQHIAREGVTHVFECGPGKVLAGLTKRIDGNLVGA 293

Query: 298 SISKVEDIDLALR 310
           S+     +D AL+
Sbjct: 294 SVFDPASLDEALK 306


>gi|315282809|ref|ZP_07871132.1| malonyl CoA-acyl carrier protein transacylase [Listeria marthii FSL
           S4-120]
 gi|313613538|gb|EFR87359.1| malonyl CoA-acyl carrier protein transacylase [Listeria marthii FSL
           S4-120]
          Length = 313

 Score =  231 bits (588), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 124/302 (41%), Positives = 183/302 (60%), Gaps = 5/302 (1%)

Query: 5   LTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPA 64
             FPGQG+Q IGMG+D+   +P A+ ++++ D  L  +++D++  G  E LT + NAQPA
Sbjct: 6   FVFPGQGAQKIGMGQDVAAEYPAAKKIYDDADERLGFSITDVITEGPIELLTKSENAQPA 65

Query: 65  LTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQ 124
           L + S+A +R +E  G  VK D  YVAGHSLGEY+AL A      SD I LVR RG+ M+
Sbjct: 66  LVSTSVAILRALETYG--VKAD--YVAGHSLGEYSALVAGGFLEASDAIYLVRKRGELME 121

Query: 125 EAVPPGLGSMVAIIGLDDCVVDSICAQASRVG-ICEIANDNGGGQVVISGLQDAVKCAAD 183
            AVP G G+M A++G+D   + +I  + +R G   ++AN N  GQ+VISG    V+ A +
Sbjct: 122 AAVPNGAGAMAAVLGVDRATLKTITEEVTREGDAVQLANLNCPGQIVISGTTAGVEKAGE 181

Query: 184 TCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSID 243
                GAKR + L VS PFHSSLM P +   + +L  VT  D  +P++ N  A   +   
Sbjct: 182 KAKASGAKRVLPLAVSGPFHSSLMEPAALAFRDILAEVTISDGNIPVVNNVDAKQTTDKA 241

Query: 244 EISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVE 303
           EIS  L++Q+   V W + ++    +GV +  E+GSGKVL GL K+I++ ++ +S   VE
Sbjct: 242 EISDKLIKQIYSPVLWEDIVEELVKNGVDTFVEIGSGKVLAGLIKKINRDVTVLSAGDVE 301

Query: 304 DI 305
            +
Sbjct: 302 SV 303


>gi|189499166|ref|YP_001958636.1| malonyl CoA-acyl carrier protein transacylase [Chlorobium
           phaeobacteroides BS1]
 gi|189494607|gb|ACE03155.1| malonyl CoA-acyl carrier protein transacylase [Chlorobium
           phaeobacteroides BS1]
          Length = 303

 Score =  231 bits (588), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 124/301 (41%), Positives = 177/301 (58%), Gaps = 6/301 (1%)

Query: 5   LTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPA 64
             FPGQGSQ  GM +++YD +PEAR + +  D  L  +++D+M+NGS+++L  T   QPA
Sbjct: 4   FVFPGQGSQYCGMAKEIYDRYPEARSLMDRADEILGYSITDIMFNGSEDDLRQTRYTQPA 63

Query: 65  LTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQ 124
           +   S+A  +++  N           AGHSLGEYTALC A A S  D I +V  RG+ MQ
Sbjct: 64  IFLHSIAVAKLLGDN------QAGMTAGHSLGEYTALCYADAMSFDDAIHIVAKRGELMQ 117

Query: 125 EAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAADT 184
            A     G+M A+IG+ D  ++++ A+A   GI + AN N  GQVVISG  DAV+ A + 
Sbjct: 118 NAGTINPGTMAAVIGMKDTDLENLLAEAETEGIVQAANFNSPGQVVISGDIDAVRKAVEL 177

Query: 185 CLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSIDE 244
             +KGA+ A  L VS  FHS LM P  + +K  LD++T  D  +P+  N  A PV   +E
Sbjct: 178 APSKGARMAKELVVSGAFHSPLMKPAEEELKASLDAITINDARIPVCMNVVAQPVRRKEE 237

Query: 245 ISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVED 304
           I   LV Q+T  V+W+++++     GV S  E G  KVL GL KRID+S++   +   + 
Sbjct: 238 IRNNLVLQLTSSVKWQQSVEAMIAEGVTSFVETGPQKVLQGLIKRIDRSVTIDGVDTADQ 297

Query: 305 I 305
           I
Sbjct: 298 I 298


>gi|167619223|ref|ZP_02387854.1| malonyl CoA-acyl carrier protein transacylase [Burkholderia
           thailandensis Bt4]
          Length = 309

 Score =  231 bits (588), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 132/313 (42%), Positives = 178/313 (56%), Gaps = 10/313 (3%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHT---LNQNLSDLMWNGSQEELTA 57
           M     FPGQGSQ +GM     ++F +  +V E +D     L Q++  L+ +G  +EL  
Sbjct: 1   MKFAFVFPGQGSQSVGM----LNAFADVAVVRETLDEASDALGQDIGKLIADGPADELNL 56

Query: 58  TCNAQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVR 117
           T N QP +   + A  R  ++ G       S VAGHSLGEYTAL AA A +  D + LVR
Sbjct: 57  TTNTQPVMLTAAYACYRAWQQAG---GAQASIVAGHSLGEYTALVAAGAIAFRDALPLVR 113

Query: 118 ARGKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDA 177
            R ++MQ AVP G+G M AI+GLDD  V ++CA+AS  G+ E  N N   QVVI+G +  
Sbjct: 114 FRAQAMQTAVPVGVGGMAAILGLDDDTVRAVCAEASAAGVVEAVNFNAPAQVVIAGTKAG 173

Query: 178 VKCAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCAS 237
           ++ A +    KGAKRA+ LPVSAPFHSSL+ P S  ++  L +V  + P +P++ N   +
Sbjct: 174 IEMACEIAKAKGAKRALPLPVSAPFHSSLLKPASDKLRDYLANVDVKTPRIPVVNNIDVA 233

Query: 238 PVSSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAV 297
            VS    I   LV Q  G VRW E ++  A  G   V E G GKVL GL KRID +L   
Sbjct: 234 VVSDPAAIKDALVRQAAGPVRWVECVRHIAREGATHVIECGPGKVLAGLTKRIDSNLVGA 293

Query: 298 SISKVEDIDLALR 310
           S+     +D AL+
Sbjct: 294 SVFDPASLDEALK 306


>gi|206971148|ref|ZP_03232099.1| malonyl CoA-acyl carrier protein transacylase [Bacillus cereus
           AH1134]
 gi|206733920|gb|EDZ51091.1| malonyl CoA-acyl carrier protein transacylase [Bacillus cereus
           AH1134]
          Length = 314

 Score =  230 bits (587), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 125/311 (40%), Positives = 182/311 (58%), Gaps = 9/311 (2%)

Query: 7   FPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPALT 66
           FPGQGSQ +GMG+ L ++  E   VF + D  L  +LS++++ G QE+LT T NAQPAL 
Sbjct: 8   FPGQGSQAVGMGKQLAENNKEVAKVFAKADEVLQDSLSEVIFEGPQEKLTLTTNAQPALL 67

Query: 67  AVSMAFIRVMEKNGLCVKRDIS--YVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQ 124
             S A +  +++       DI+  +VAGHSLGEY+AL AA A +  D I  VR RG+ M+
Sbjct: 68  TTSFAILTALKQ------YDITPDFVAGHSLGEYSALVAAGALTFEDAIYAVRKRGEYME 121

Query: 125 EAVPPGLGSMVAIIGLDDCVVDSICAQASRVGIC-EIANDNGGGQVVISGLQDAVKCAAD 183
           EAVP G G+M AI+G D  ++  +  + +  G   +IAN N   Q+VISG +  V+ A+ 
Sbjct: 122 EAVPGGEGAMAAILGADPHMLKQVTEEVTSEGYAVQIANMNSTKQIVISGTKQGVEVASQ 181

Query: 184 TCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSID 243
                GAKRA+ L VS PFHSSLM P ++  + +L+ +T  D  +P++ N  A  ++   
Sbjct: 182 RAKENGAKRAIPLKVSGPFHSSLMKPAAEKFQSVLNEITIHDTNIPVIANVTADVITRGA 241

Query: 244 EISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVE 303
           +I   L+EQ+   V W  +I+     GV +  E+G GKVL GL K ID S+ A  I   E
Sbjct: 242 DIQEKLIEQLYSPVLWYPSIECMVKQGVDTFIEIGPGKVLAGLMKSIDSSVKAYVIYDEE 301

Query: 304 DIDLALRSIVG 314
            +   + ++ G
Sbjct: 302 TLKDTISNLRG 312


>gi|229071350|ref|ZP_04204573.1| Malonyl CoA-acyl carrier protein transacylase [Bacillus cereus
           F65185]
 gi|229081107|ref|ZP_04213617.1| Malonyl CoA-acyl carrier protein transacylase [Bacillus cereus
           Rock4-2]
 gi|228702151|gb|EEL54627.1| Malonyl CoA-acyl carrier protein transacylase [Bacillus cereus
           Rock4-2]
 gi|228711804|gb|EEL63756.1| Malonyl CoA-acyl carrier protein transacylase [Bacillus cereus
           F65185]
          Length = 314

 Score =  230 bits (587), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 124/311 (39%), Positives = 183/311 (58%), Gaps = 9/311 (2%)

Query: 7   FPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPALT 66
           FPGQGSQ +GMG+ L ++  E   VF + D  L  +LS++++ G QE+LT T NAQPAL 
Sbjct: 8   FPGQGSQAVGMGKQLAENNKEVAKVFAKADEVLQDSLSEVIFEGPQEKLTLTTNAQPALL 67

Query: 67  AVSMAFIRVMEKNGLCVKRDIS--YVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQ 124
             S A +  +++       DI+  +VAGHSLGEY+AL AA A +  D +  VR RG+ M+
Sbjct: 68  TTSFAILTALKE------YDITPDFVAGHSLGEYSALVAAGALTFEDAVYAVRKRGEYME 121

Query: 125 EAVPPGLGSMVAIIGLDDCVVDSICAQASRVGIC-EIANDNGGGQVVISGLQDAVKCAAD 183
           EAVP G G+M AI+G D  ++  +  + +  G   +IAN N   Q+VISG +  V+ A+ 
Sbjct: 122 EAVPGGEGAMAAILGADPHMLKQVTEEVTSEGYAVQIANMNSTKQIVISGTKQGVEVASQ 181

Query: 184 TCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSID 243
                GAKRA+ L VS PFHSSLM P ++  + +L+ +T  D  +P++ N  A  ++   
Sbjct: 182 RAKENGAKRAIPLKVSGPFHSSLMKPAAEKFQSVLNEITIHDTNIPVIANVTADVITRGA 241

Query: 244 EISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVE 303
           +I   L+EQ+   V W  +I+     GV +  E+G GKVL GL K ID S+ A +I   E
Sbjct: 242 DIQEKLIEQLYSPVLWYPSIECMVKQGVDTFIEIGPGKVLAGLMKSIDSSVKAYAIYDEE 301

Query: 304 DIDLALRSIVG 314
            +   + ++ G
Sbjct: 302 TLKDTISNLRG 312


>gi|313892563|ref|ZP_07826150.1| [acyl-carrier-protein] S-malonyltransferase [Dialister
           microaerophilus UPII 345-E]
 gi|313118960|gb|EFR42165.1| [acyl-carrier-protein] S-malonyltransferase [Dialister
           microaerophilus UPII 345-E]
          Length = 316

 Score =  230 bits (587), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 127/307 (41%), Positives = 181/307 (58%), Gaps = 5/307 (1%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           ++T   FPGQGSQ +GM RDLY+ +   + + +E D TL  ++S LM+ G +E L  T  
Sbjct: 4   LTTAFLFPGQGSQKVGMIRDLYEKYDSVKNIVKEADETLGFSISKLMFEGPEETLMKTEF 63

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
            QPA+   S+A  +V+ +NG+    D   VAGHSLGEY+AL AA+A S +D +  V  RG
Sbjct: 64  TQPAILTASVACWKVLFENGV----DPCVVAGHSLGEYSALVAAEAMSFADAVHTVNLRG 119

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASR-VGICEIANDNGGGQVVISGLQDAVK 179
           K MQEAVP G G+M A+IG+    V+ IC   S      +  N N  GQVVI+G+  AV+
Sbjct: 120 KFMQEAVPLGQGAMAAVIGMKAETVEEICETISTDEEPLQAVNYNCPGQVVIAGVTSAVE 179

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            A      KGAKRA+ L VS PFHS LM P +  +K +LD +  +D  +PI+ N  A+  
Sbjct: 180 KACKVFKEKGAKRALMLKVSGPFHSILMKPAALKLKEVLDKIEIKDSFIPIVANVNANVE 239

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
           +S +EI   L+ Q    VRW ++I++   +GV    E G G VL+G  +RIDK++     
Sbjct: 240 NSAEEIRENLINQTFNPVRWEDSIRFMLENGVTKFVECGPGTVLSGFMRRIDKTVFNCHA 299

Query: 300 SKVEDID 306
             +E ++
Sbjct: 300 ENIETVN 306


>gi|253681315|ref|ZP_04862113.1| malonyl CoA-acyl carrier protein transacylase [Clostridium
           botulinum D str. 1873]
 gi|253562553|gb|EES92004.1| malonyl CoA-acyl carrier protein transacylase [Clostridium
           botulinum D str. 1873]
          Length = 314

 Score =  230 bits (587), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 122/315 (38%), Positives = 187/315 (59%), Gaps = 5/315 (1%)

Query: 1   MSTV-LTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATC 59
           MS +   F GQG+Q +GMG++LYD+  E R VF + D  L   +SD+ + GS+EEL  T 
Sbjct: 1   MSKIAFIFSGQGAQYVGMGKELYDNIEECREVFYKADKALGFPISDICFKGSKEELDRTE 60

Query: 60  NAQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRAR 119
           N QPA+   S+A ++ +EK+G  VK DI  VAG SLGEY+AL  +  F   D + +V+ R
Sbjct: 61  NTQPAILTTSIAALKALEKSG--VKADI--VAGLSLGEYSALVCSGVFDFQDAVTVVKKR 116

Query: 120 GKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVK 179
           GK MQE VP G+G+M AIIGLD   V   C +    GI E+AN N   Q+VI+G  +AV 
Sbjct: 117 GKFMQEEVPEGVGAMAAIIGLDREKVSKACEECEEYGIVEVANYNCSSQIVIAGEINAVD 176

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            A ++    GAKR + L VSAPFH+S++    + +   L+ VT     +P++ N  A+ +
Sbjct: 177 KACESAKKLGAKRVIKLSVSAPFHTSMLKGAGEKLYKELEKVTLNHINIPVVTNVTANYI 236

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
           + I+++  +L  QV   V W + ++   N GV +  EVG GK L+G  K+I++ +  +++
Sbjct: 237 TDINDVKDILRRQVMSSVLWEDIVKKMINEGVDTFIEVGPGKALSGFVKKINRKVKVLNV 296

Query: 300 SKVEDIDLALRSIVG 314
             +  ++  +  + G
Sbjct: 297 EDLASLNKTIYELKG 311


>gi|118580163|ref|YP_901413.1| malonyl CoA-acyl carrier protein transacylase [Pelobacter
           propionicus DSM 2379]
 gi|118502873|gb|ABK99355.1| [Acyl-carrier-protein] S-malonyltransferase [Pelobacter propionicus
           DSM 2379]
          Length = 306

 Score =  230 bits (587), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 127/291 (43%), Positives = 179/291 (61%), Gaps = 5/291 (1%)

Query: 3   TVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQ 62
           T   FPGQGSQ  GMG++L+D++  +R VFEE D  L   LS L + G ++EL  T N Q
Sbjct: 4   TAFVFPGQGSQYPGMGKELFDTYRVSREVFEEADEALGLKLSTLCFEGGEDELKLTANTQ 63

Query: 63  PALTAVSMAFIR-VMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           PA+   S+A ++ ++++ GL  K D  YVAGHSLGE++AL      SL+D +R VR+RG 
Sbjct: 64  PAILTTSIAILKALLQETGL--KPD--YVAGHSLGEFSALVCTGTLSLADAVRTVRSRGF 119

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCA 181
            MQ+AVP G G+M AI+ +   V+D IC +A++  I   AN N  GQVVI+G   AV  A
Sbjct: 120 FMQDAVPVGTGAMAAILSVSAEVLDEICQEAAQGEIVAPANFNSPGQVVIAGHSGAVHRA 179

Query: 182 ADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSS 241
                 +G K+A+ LPVSAPFH +LM P ++ +  +L+ V      VP + N  A P ++
Sbjct: 180 ITIAKERGFKKALMLPVSAPFHCALMQPAAERLAEVLERVKFAHVKVPYVANADAEPNTN 239

Query: 242 IDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDK 292
              I  LL+ QV   V W ++++  A+ GV+   E+G GKVL+GL KRI K
Sbjct: 240 RTRIKPLLITQVCAPVLWEQSVRKMASLGVERFVEIGPGKVLSGLVKRIAK 290


>gi|86159171|ref|YP_465956.1| [acyl-carrier-protein] S-malonyltransferase [Anaeromyxobacter
           dehalogenans 2CP-C]
 gi|85775682|gb|ABC82519.1| [Acyl-carrier-protein] S-malonyltransferase [Anaeromyxobacter
           dehalogenans 2CP-C]
          Length = 313

 Score =  230 bits (587), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 141/312 (45%), Positives = 187/312 (59%), Gaps = 6/312 (1%)

Query: 5   LTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPA 64
             FPGQGSQ +GMG+DL+D+FPEAR +FEEVD  L + LS L + G +++L  T N QP+
Sbjct: 6   FVFPGQGSQAVGMGKDLHDAFPEAREIFEEVDEALGEKLSALCFGGPEDQLKLTANTQPS 65

Query: 65  LTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQ 124
           +  VS A   V+   GL       +VAGHSLGEY+AL A  A   ++  R VRARG  MQ
Sbjct: 66  ILTVSSAAAAVLANQGLVP----DFVAGHSLGEYSALVAVGACGAAEAARAVRARGTFMQ 121

Query: 125 EAVPPGLGSMVAIIGLDDCVVDSICAQ-ASRVG-ICEIANDNGGGQVVISGLQDAVKCAA 182
           EAVP G G+M A++GLD   V  ICA  AS  G +   AN N   Q VI+G   AV+ A 
Sbjct: 122 EAVPAGQGAMSAVLGLDPARVREICAAVASETGQVVSPANYNEPAQTVIAGAAGAVEQAG 181

Query: 183 DTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSI 242
                 GAKR + LPVSAPFHS+LM PV   ++ +L  +  + P+ P++ N  A P    
Sbjct: 182 ARLKEAGAKRVLPLPVSAPFHSALMAPVKARLEPVLRGIAWKAPLRPVVTNVEAKPNQDA 241

Query: 243 DEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKV 302
             +  LLVEQVT  VRW E ++     GV  V EVG GKVL+GL +RID+S+ A ++   
Sbjct: 242 ARVVPLLVEQVTAPVRWIECVEELVRLGVTRVVEVGPGKVLSGLIRRIDRSVEAFNVEDR 301

Query: 303 EDIDLALRSIVG 314
             ++  L ++ G
Sbjct: 302 ASLEKTLAALKG 313


>gi|197123243|ref|YP_002135194.1| malonyl CoA-acyl carrier protein transacylase [Anaeromyxobacter sp.
           K]
 gi|196173092|gb|ACG74065.1| malonyl CoA-acyl carrier protein transacylase [Anaeromyxobacter sp.
           K]
          Length = 313

 Score =  230 bits (587), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 140/312 (44%), Positives = 188/312 (60%), Gaps = 6/312 (1%)

Query: 5   LTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPA 64
             FPGQGSQ +GMG+DL+D+FPEAR +F+EVD  L + LS L + G +++L  T N QP+
Sbjct: 6   FVFPGQGSQAVGMGKDLHDAFPEAREIFQEVDEALGEKLSALCFGGPEDQLKLTANTQPS 65

Query: 65  LTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQ 124
           +  VS A   V+   GL       YVAGHSLGEY+AL A  A   ++  R VRARG  MQ
Sbjct: 66  ILTVSSAAAAVLANQGLVP----DYVAGHSLGEYSALVAVGACGAAEAARAVRARGTFMQ 121

Query: 125 EAVPPGLGSMVAIIGLDDCVVDSICAQ-ASRVG-ICEIANDNGGGQVVISGLQDAVKCAA 182
           EAVP G G+M A++GLD   V  ICA  A+  G +   AN N   Q VI+G   AV+ A 
Sbjct: 122 EAVPAGQGAMSAVLGLDPARVREICAAVAAETGQVVSPANYNEPAQTVIAGAAGAVEQAG 181

Query: 183 DTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSI 242
                 GAKR + LPVSAPFHS+LM PV   ++ +L ++  + P+ P++ N  A P    
Sbjct: 182 ARLKEAGAKRVLPLPVSAPFHSALMAPVKARLEPVLRAMPWRAPLRPVVTNVEAKPNQDA 241

Query: 243 DEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKV 302
             +  LLVEQVT  VRW E ++     GV  V EVG GKVL+GL +RID+S+ A ++   
Sbjct: 242 SRVVPLLVEQVTAPVRWIECVEELVRLGVTRVVEVGPGKVLSGLVRRIDRSVEAFNVEDR 301

Query: 303 EDIDLALRSIVG 314
             ++  L ++ G
Sbjct: 302 ASLEKTLAALKG 313


>gi|220931871|ref|YP_002508779.1| malonyl CoA-acyl carrier protein transacylase [Halothermothrix
           orenii H 168]
 gi|219993181|gb|ACL69784.1| malonyl CoA-acyl carrier protein transacylase [Halothermothrix
           orenii H 168]
          Length = 309

 Score =  230 bits (587), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 123/303 (40%), Positives = 175/303 (57%), Gaps = 6/303 (1%)

Query: 7   FPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPALT 66
           FPGQGSQ +GMG++L + +P     F++ +H L  +L +L +NG + +L  T   QPA+ 
Sbjct: 9   FPGQGSQYVGMGQELIEHYPGTDDFFKKANHILGYDLKELCFNGPESKLNNTKYTQPAIF 68

Query: 67  AVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQEA 126
            VSM    ++  N   +  D+  VAGHSLGEY+AL AA  F+  D ++LV  RG  M EA
Sbjct: 69  TVSMIIYSILNSNN--IYPDV--VAGHSLGEYSALAAAGVFTFEDGLKLVHRRGNLMDEA 124

Query: 127 VPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAADTCL 186
           +P G G+M AIIGL+   V SIC Q    G+CE+AN N   Q+VI+G   AV+ A     
Sbjct: 125 LPEGQGTMAAIIGLEKKQVLSICQQVD--GVCEVANYNSPSQLVITGETPAVQEAMKLAE 182

Query: 187 NKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSIDEIS 246
            +GAK+ V L VS PFHSSLM P    +   ++ +   DP VP++ N     V     I 
Sbjct: 183 QEGAKKVVGLDVSGPFHSSLMKPARDKLSNYINEINFNDPQVPVVANVTGDYVKDSAGIK 242

Query: 247 RLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVEDID 306
           +LL+ Q+TG VRW E++      GV    EVG G+VL GL +RI++     +I  ++ ++
Sbjct: 243 KLLINQLTGSVRWVESMNRLLEDGVDIFIEVGPGRVLKGLMRRINRKARVYNIENIKTLN 302

Query: 307 LAL 309
             L
Sbjct: 303 KLL 305


>gi|186475594|ref|YP_001857064.1| malonyl CoA-acyl carrier protein transacylase [Burkholderia
           phymatum STM815]
 gi|184192053|gb|ACC70018.1| malonyl CoA-acyl carrier protein transacylase [Burkholderia
           phymatum STM815]
          Length = 310

 Score =  230 bits (587), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 133/312 (42%), Positives = 170/312 (54%), Gaps = 4/312 (1%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M     FPGQGSQ +GM     D+    R   +E    LNQ++  L+  G  E+L  T N
Sbjct: 1   MKFAFVFPGQGSQAVGMLNAFADN-AIVRETLQEASDALNQDIGKLIAEGPAEDLNLTTN 59

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
            QP +   + A  R  +  G       + VAGHSLGEYTAL A  A    D + LVR R 
Sbjct: 60  TQPVMLTAAYAIFRAWQAAGGPAP---TIVAGHSLGEYTALVAGGALKFRDAVPLVRFRA 116

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           ++MQ AVP G G M AI+GLDD  V  +C +AS  G+ E  N N   QVVI+G + AV+ 
Sbjct: 117 QAMQNAVPVGQGGMAAILGLDDDTVREVCKEASAAGVVEAVNFNAPAQVVIAGHKAAVEK 176

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A +    KGAKRA+ LPVSAPFHSSL+ P S  ++  L SV  Q P +P++ N   + V+
Sbjct: 177 ACEVAKAKGAKRALPLPVSAPFHSSLLKPASDQLREYLASVDVQVPSIPVVNNVDVAIVN 236

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
               I   LV Q  G VRW E +Q  A  GV  V E G GKVL GL KRID +L   +I 
Sbjct: 237 EPAGIKDALVRQAAGAVRWVECVQSIAKQGVTHVIECGPGKVLAGLTKRIDANLVGAAIV 296

Query: 301 KVEDIDLALRSI 312
               +D  L+ +
Sbjct: 297 DPATLDEVLKVV 308


>gi|167837361|ref|ZP_02464244.1| malonyl CoA-acyl carrier protein transacylase [Burkholderia
           thailandensis MSMB43]
          Length = 310

 Score =  230 bits (586), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 133/313 (42%), Positives = 179/313 (57%), Gaps = 10/313 (3%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHT---LNQNLSDLMWNGSQEELTA 57
           M     FPGQGSQ +GM     ++F +  +V E +D     L Q++  L+ +G  +EL  
Sbjct: 1   MKFAFVFPGQGSQSVGM----LNAFADVAVVRETLDEASDALGQDIGKLIADGPADELNL 56

Query: 58  TCNAQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVR 117
           T N QP +   + A  R  ++ G       S VAGHSLGEYTAL AA A +  D + LVR
Sbjct: 57  TTNTQPVMLTAAYACYRAWKQAG---GAQPSIVAGHSLGEYTALVAAGAIAFRDALPLVR 113

Query: 118 ARGKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDA 177
            R ++MQ AVP G+G M AI+GLDD  V ++CA+AS  G+ E  N N   QVVI+G +  
Sbjct: 114 FRAQAMQTAVPVGVGGMAAILGLDDDTVRAVCAEASASGVVEAVNFNAPAQVVIAGTKAG 173

Query: 178 VKCAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCAS 237
           ++ A +    KGAKRA+ LPVSAPFHSSL+ P S  ++  L +V  + P +P++ N   +
Sbjct: 174 IEKACEIAKAKGAKRALPLPVSAPFHSSLLEPASDKLREYLANVDVKAPRIPVVNNIDVA 233

Query: 238 PVSSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAV 297
            VS    I   LV Q  G VRW E ++  A  GV  V E G GKVL GL KRID +L   
Sbjct: 234 VVSDPAAIKDALVRQAAGPVRWVECVRHIAREGVTHVIECGPGKVLAGLTKRIDSNLVGA 293

Query: 298 SISKVEDIDLALR 310
           S+     +D AL+
Sbjct: 294 SVFDPASLDEALK 306


>gi|126440256|ref|YP_001059812.1| malonyl CoA-acyl carrier protein transacylase [Burkholderia
           pseudomallei 668]
 gi|126219749|gb|ABN83255.1| [acyl-carrier-protein] S-malonyltransferase [Burkholderia
           pseudomallei 668]
          Length = 310

 Score =  230 bits (586), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 133/313 (42%), Positives = 178/313 (56%), Gaps = 10/313 (3%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHT---LNQNLSDLMWNGSQEELTA 57
           M+    FPGQGSQ +GM     ++F +  +V E +D     L Q++  L+ +G  +EL  
Sbjct: 1   MTFAFVFPGQGSQSVGM----LNAFADVAVVRETLDEASDALGQDIGKLIADGPADELNL 56

Query: 58  TCNAQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVR 117
           T N QP +   + A  R  ++ G       S VAGHSLGEYTAL AA A +  D + LVR
Sbjct: 57  TTNTQPVMLTAAYACYRAWQQAG---GAQPSIVAGHSLGEYTALVAAGAIAFRDALPLVR 113

Query: 118 ARGKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDA 177
            R ++MQ AVP G+G M AI+GLDD  V ++CA+AS  G+ E  N N   QVVI+G +  
Sbjct: 114 FRAQAMQTAVPVGVGGMAAILGLDDDTVRAVCAEASATGVVEAVNFNAPAQVVIAGTKAG 173

Query: 178 VKCAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCAS 237
           ++ A +    KGAKRA+ LPVSAPFHSSL+ P S  ++  L  V  + P + ++ N   +
Sbjct: 174 IEKACEIAKEKGAKRALPLPVSAPFHSSLLKPASDKLREYLAGVDVKAPKISVVNNIDVA 233

Query: 238 PVSSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAV 297
            VS    I   LV Q  G VRW E +Q  A  GV  V E G GKVL GL KRID +L   
Sbjct: 234 VVSDPAAIKDALVRQAAGPVRWVECVQHIAREGVTHVIECGPGKVLAGLTKRIDGNLVGA 293

Query: 298 SISKVEDIDLALR 310
           S+     +D AL+
Sbjct: 294 SVFDPASLDEALK 306


>gi|307246931|ref|ZP_07528996.1| Malonyl CoA-acyl carrier protein transacylase [Actinobacillus
           pleuropneumoniae serovar 1 str. 4074]
 gi|307255913|ref|ZP_07537714.1| Malonyl CoA-acyl carrier protein transacylase [Actinobacillus
           pleuropneumoniae serovar 9 str. CVJ13261]
 gi|307260366|ref|ZP_07542073.1| Malonyl CoA-acyl carrier protein transacylase [Actinobacillus
           pleuropneumoniae serovar 11 str. 56153]
 gi|306852216|gb|EFM84456.1| Malonyl CoA-acyl carrier protein transacylase [Actinobacillus
           pleuropneumoniae serovar 1 str. 4074]
 gi|306861181|gb|EFM93174.1| Malonyl CoA-acyl carrier protein transacylase [Actinobacillus
           pleuropneumoniae serovar 9 str. CVJ13261]
 gi|306865617|gb|EFM97498.1| Malonyl CoA-acyl carrier protein transacylase [Actinobacillus
           pleuropneumoniae serovar 11 str. 56153]
          Length = 311

 Score =  230 bits (586), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 131/304 (43%), Positives = 180/304 (59%), Gaps = 4/304 (1%)

Query: 5   LTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPA 64
           + FPGQGSQ +GM  DL  ++P     F++    L  +L DL+ NGS E+L  T   QPA
Sbjct: 6   MVFPGQGSQAVGMLADLATAYPIVEETFKQASDVLGYDLWDLVQNGSAEDLGQTQRTQPA 65

Query: 65  LTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQ 124
           L A S+A  RV ++    +K   S +AGHSLGEY+AL  A      D I+LV  RG +MQ
Sbjct: 66  LLASSVAIYRVWQQKYPELKP--SVMAGHSLGEYSALVCAGVLDFQDAIKLVELRGNAMQ 123

Query: 125 EAVPPGLGSMVAIIGLDDCVVDSICAQA-SRVG-ICEIANDNGGGQVVISGLQDAVKCAA 182
           +AVP G G+M AIIGLD+  + + C QA + VG I    N N  GQVVI+G + A + A 
Sbjct: 124 QAVPAGTGAMYAIIGLDNEAIINACEQAQAEVGEIVSAVNFNSPGQVVIAGTKAAAEKAG 183

Query: 183 DTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSI 242
           + C   GAKRA+ L VS P H +LM P +  +   L ++T   PVVP++ N   S  +  
Sbjct: 184 ELCKAAGAKRALPLAVSVPSHCALMKPAADKLAEALQNITLNAPVVPVINNVDVSVETDA 243

Query: 243 DEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKV 302
           + I   LV Q+   VRW ET++  AN GV ++YE+G GKVLTGL  RI K L A +++ +
Sbjct: 244 EAIRNALVRQLYSPVRWTETVEKMANEGVTTLYEIGPGKVLTGLTSRIVKELKAQAVNDL 303

Query: 303 EDID 306
             ++
Sbjct: 304 VSLE 307


>gi|114330489|ref|YP_746711.1| malonyl CoA-acyl carrier protein transacylase [Nitrosomonas
           eutropha C91]
 gi|114307503|gb|ABI58746.1| [Acyl-carrier-protein] S-malonyltransferase [Nitrosomonas eutropha
           C91]
          Length = 312

 Score =  230 bits (586), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 128/303 (42%), Positives = 168/303 (55%), Gaps = 7/303 (2%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M     FPGQGSQ +GM  D Y   P  R  F E    L Q+L  L  NG  + L  T N
Sbjct: 1   MKIAFIFPGQGSQSVGM-MDGYSELPSIRETFNEASDILQQDLWSLASNGPADTLNLTTN 59

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
            QP +    +A  R  ++ G        Y+AGHSLGEY AL AA++ SL D ++LVR R 
Sbjct: 60  TQPVMLTADVAIYRAWQQAG---GTQPHYLAGHSLGEYAALVAAESLSLGDALKLVRHRA 116

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRV---GICEIANDNGGGQVVISGLQDA 177
           + MQE VP G G M AI+GLD+  + S+CA+   +      E AN N  GQVVI+G   A
Sbjct: 117 EVMQETVPEGTGGMAAIVGLDNDTISSVCAEVINMLPDTSLEPANFNAPGQVVIAGHSQA 176

Query: 178 VKCAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCAS 237
           +  A     +KGAK AV LP+S P H SLM P ++    +L+ +T Q P +P+L N    
Sbjct: 177 IAQAVTLAKSKGAKLAVILPMSIPSHCSLMQPAAEKFALLLEKITFQPPRIPVLHNVDVQ 236

Query: 238 PVSSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAV 297
               I  I  +L  Q+   VRW ETIQ  A  GV+ V E G GKVL+GL +RIDK+L  +
Sbjct: 237 QHPEIASIREILAHQLDNPVRWTETIQALAGLGVRHVVECGPGKVLSGLTRRIDKNLENI 296

Query: 298 SIS 300
           +++
Sbjct: 297 ALT 299


>gi|218899005|ref|YP_002447416.1| malonyl CoA-acyl carrier protein transacylase [Bacillus cereus
           G9842]
 gi|228902355|ref|ZP_04066512.1| Malonyl CoA-acyl carrier protein transacylase [Bacillus
           thuringiensis IBL 4222]
 gi|228966800|ref|ZP_04127844.1| Malonyl CoA-acyl carrier protein transacylase [Bacillus
           thuringiensis serovar sotto str. T04001]
 gi|218542537|gb|ACK94931.1| malonyl CoA-acyl carrier protein transacylase [Bacillus cereus
           G9842]
 gi|228792899|gb|EEM40457.1| Malonyl CoA-acyl carrier protein transacylase [Bacillus
           thuringiensis serovar sotto str. T04001]
 gi|228857324|gb|EEN01827.1| Malonyl CoA-acyl carrier protein transacylase [Bacillus
           thuringiensis IBL 4222]
          Length = 314

 Score =  230 bits (586), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 122/309 (39%), Positives = 182/309 (58%), Gaps = 5/309 (1%)

Query: 7   FPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPALT 66
           FPGQGSQ +GMG+ L ++  E   VF + D  L  +LS++++ G QE+LT T NAQPAL 
Sbjct: 8   FPGQGSQAVGMGKQLAENNKEVAKVFAKADEVLQDSLSEVIFEGPQEKLTLTTNAQPALL 67

Query: 67  AVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQEA 126
             S A +  +++  +      ++VAGHSLGEY+AL AA A +  D +  VR RG+ M+EA
Sbjct: 68  TTSFAILTALKEYDITP----NFVAGHSLGEYSALVAAGALTFEDAVYAVRKRGEYMEEA 123

Query: 127 VPPGLGSMVAIIGLDDCVVDSICAQASRVGIC-EIANDNGGGQVVISGLQDAVKCAADTC 185
           VP G G+M AI+G D  ++  +  + +  G   +IAN N   Q+VISG +  V+ A+   
Sbjct: 124 VPDGEGAMAAILGADLDMLKQVTEEVTSEGYAVQIANMNSTKQIVISGTKQGVEVASQRA 183

Query: 186 LNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSIDEI 245
              GAKRA+ L VS PFHSSLM P ++  + +L+ +T  D  +P++ N  A  ++   +I
Sbjct: 184 KENGAKRAIPLKVSGPFHSSLMKPAAEKFQSVLNEITIHDTNIPVIANVTADVITRGADI 243

Query: 246 SRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVEDI 305
              L+EQ+   V W  +I+     GV +  E+G GKVL GL K ID S+ A +I   E +
Sbjct: 244 QEKLIEQLYSPVLWYPSIECMVQQGVDTFIEIGPGKVLAGLMKSIDSSVKAYAIYDEETL 303

Query: 306 DLALRSIVG 314
              + ++ G
Sbjct: 304 KDTISNLRG 312


>gi|21674924|ref|NP_662989.1| malonyl CoA-acyl carrier protein transacylase [Chlorobium tepidum
           TLS]
 gi|21648152|gb|AAM73331.1| malonyl CoA-acyl carrier protein transacylase [Chlorobium tepidum
           TLS]
          Length = 305

 Score =  230 bits (586), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 127/307 (41%), Positives = 179/307 (58%), Gaps = 7/307 (2%)

Query: 5   LTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPA 64
             FPGQGSQ  GMGRDLY+ FPEA+ + ++ D  L  +++++M+NGS++EL  T   Q A
Sbjct: 4   FVFPGQGSQYCGMGRDLYERFPEAQELMDKADSILGFSITNIMFNGSEDELKQTRYTQLA 63

Query: 65  LTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQ 124
           +   S A   ++ + G      +   AGHSLGEYTALC + A S  D +RLV  RG+ MQ
Sbjct: 64  IFLHSFAAATLLGREG------VKMAAGHSLGEYTALCFSGAISFEDAVRLVAKRGELMQ 117

Query: 125 EAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAADT 184
            A     G+M AIIG+ D  +D++  +AS  GI + AN N  GQ+VISG  DAV+ A + 
Sbjct: 118 NAGQQNPGTMAAIIGMADDALDALLEEASASGIVQAANFNSPGQIVISGDVDAVRKAVEL 177

Query: 185 CLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSIDE 244
             +KGA+ A  L VS  FHS LM P  K     LD++  +D  +P+  N  A PV++  E
Sbjct: 178 ASSKGARMAKELVVSGAFHSPLMKPAEKEFAETLDTIAIRDAEIPVCMNVVAKPVTAATE 237

Query: 245 ISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVED 304
           I   L+ Q+T  V W +++Q   + G+    EVG  KVL GL KRI KS     +   + 
Sbjct: 238 IRANLISQLTSSVLWSQSVQAMVDAGITEFVEVGPQKVLQGLIKRISKSTMCSGVDTADQ 297

Query: 305 IDLALRS 311
           +D A+R+
Sbjct: 298 VD-AMRT 303


>gi|228909677|ref|ZP_04073500.1| Malonyl CoA-acyl carrier protein transacylase [Bacillus
           thuringiensis IBL 200]
 gi|228849966|gb|EEM94797.1| Malonyl CoA-acyl carrier protein transacylase [Bacillus
           thuringiensis IBL 200]
          Length = 314

 Score =  230 bits (586), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 122/309 (39%), Positives = 182/309 (58%), Gaps = 5/309 (1%)

Query: 7   FPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPALT 66
           FPGQGSQ +GMG+ L ++  E   VF + D  L  +LS++++ G QE+LT T NAQPAL 
Sbjct: 8   FPGQGSQAVGMGKKLAENNKEVAKVFAKADEVLQDSLSEVIFEGPQEKLTLTTNAQPALL 67

Query: 67  AVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQEA 126
             S A +  +++  +      ++VAGHSLGEY+AL AA A +  D +  VR RG+ M+EA
Sbjct: 68  TTSFAILTALKEYDITP----NFVAGHSLGEYSALVAAGALTFEDAVYAVRKRGEYMEEA 123

Query: 127 VPPGLGSMVAIIGLDDCVVDSICAQASRVGIC-EIANDNGGGQVVISGLQDAVKCAADTC 185
           VP G G+M AI+G D  ++  +  + +  G   +IAN N   Q+VISG +  V+ A+   
Sbjct: 124 VPDGEGAMAAILGADLDMLKQVTEEVTSEGYAVQIANMNSTKQIVISGTKQGVEVASQRA 183

Query: 186 LNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSIDEI 245
              GAKRA+ L VS PFHSSLM P ++  + +L+ +T  D  +P++ N  A  ++   +I
Sbjct: 184 KENGAKRAIPLKVSGPFHSSLMKPAAEKFQSVLNEITIHDTNIPVIANVTADVITRGADI 243

Query: 246 SRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVEDI 305
              L+EQ+   V W  +I+     GV +  E+G GKVL GL K ID S+ A +I   E +
Sbjct: 244 QEKLIEQLYSPVLWYPSIECMVKQGVDTFIEIGPGKVLAGLMKSIDSSVKAYAIYDEETL 303

Query: 306 DLALRSIVG 314
              + ++ G
Sbjct: 304 KDTISNLRG 312


>gi|83721554|ref|YP_442253.1| malonyl CoA-acyl carrier protein transacylase [Burkholderia
           thailandensis E264]
 gi|167581139|ref|ZP_02374013.1| malonyl CoA-acyl carrier protein transacylase [Burkholderia
           thailandensis TXDOH]
 gi|257138446|ref|ZP_05586708.1| malonyl CoA-acyl carrier protein transacylase [Burkholderia
           thailandensis E264]
 gi|83655379|gb|ABC39442.1| malonyl CoA-acyl carrier protein transacylase [Burkholderia
           thailandensis E264]
          Length = 309

 Score =  230 bits (586), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 132/313 (42%), Positives = 178/313 (56%), Gaps = 10/313 (3%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHT---LNQNLSDLMWNGSQEELTA 57
           M     FPGQGSQ +GM     ++F +  +V E +D     L Q++  L+ +G  +EL  
Sbjct: 1   MKFAFVFPGQGSQSVGM----LNAFADVAVVRETLDEASDALGQDIGKLIADGPADELNL 56

Query: 58  TCNAQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVR 117
           T N QP +   + A  R  ++ G       S VAGHSLGEYTAL AA A +  D + LVR
Sbjct: 57  TTNTQPVMLTAAYACYRAWQQAG---GAQPSIVAGHSLGEYTALVAAGAIAFRDALPLVR 113

Query: 118 ARGKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDA 177
            R ++MQ AVP G+G M AI+GLDD  V ++CA+AS  G+ E  N N   QVVI+G +  
Sbjct: 114 FRAQAMQTAVPVGVGGMAAILGLDDDTVRAVCAEASAAGVVEAVNFNAPAQVVIAGTKAG 173

Query: 178 VKCAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCAS 237
           ++ A +    KGAKRA+ LPVSAPFHSSL+ P S  ++  L +V  + P +P++ N   +
Sbjct: 174 IEMACEIAKAKGAKRALPLPVSAPFHSSLLKPASDKLRDYLANVDVKTPRIPVVNNIDVA 233

Query: 238 PVSSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAV 297
            VS    I   LV Q  G VRW E ++  A  G   V E G GKVL GL KRID +L   
Sbjct: 234 VVSDPAAIKDALVRQAAGPVRWVECVRHIAREGATHVIECGPGKVLAGLTKRIDSNLVGA 293

Query: 298 SISKVEDIDLALR 310
           S+     +D AL+
Sbjct: 294 SVFDPASLDEALK 306


>gi|194335358|ref|YP_002017152.1| malonyl CoA-acyl carrier protein transacylase [Pelodictyon
           phaeoclathratiforme BU-1]
 gi|194307835|gb|ACF42535.1| malonyl CoA-acyl carrier protein transacylase [Pelodictyon
           phaeoclathratiforme BU-1]
          Length = 302

 Score =  229 bits (585), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 125/301 (41%), Positives = 180/301 (59%), Gaps = 6/301 (1%)

Query: 5   LTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPA 64
             FPGQGSQ  GMGRD++D+FP AR + E  D  L   ++D+M++GS+EEL  T   QPA
Sbjct: 4   FVFPGQGSQYCGMGRDIFDNFPAARTMMERADSILGYRITDIMFSGSEEELRQTKYTQPA 63

Query: 65  LTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQ 124
           +      F+  +    L  ++DI+  AGHSLGEY+ALC A + S  D +R+V  RG+ MQ
Sbjct: 64  I------FLHSIAVATLLGRQDIAMTAGHSLGEYSALCFAGSISFDDAMRIVAKRGELMQ 117

Query: 125 EAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAADT 184
            A     G+M AIIG+ D  ++++ A+A + G+ + AN N  GQVV+SG   AVK A + 
Sbjct: 118 NAGKENPGTMAAIIGMPDSSLEALLAEAGKEGVIQAANFNSPGQVVLSGDIAAVKKAIEL 177

Query: 185 CLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSIDE 244
             +KGA+ A  L VS  FHS LM PV + +   L  +  +D  +P+  N  A+PV+S  E
Sbjct: 178 APSKGARMAKELVVSGAFHSPLMKPVEEELAAALAEIEIKDAEIPVCMNAVATPVTSAAE 237

Query: 245 ISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVED 304
           I + L+ Q+T  V W ++I+     G++   EVG  KVL GL KRIDK+++   I    D
Sbjct: 238 IRKNLILQLTSSVLWSQSIEAMVQSGMREFIEVGPQKVLQGLIKRIDKTVTIRGIDTAAD 297

Query: 305 I 305
           +
Sbjct: 298 L 298


>gi|212375083|pdb|3EZO|A Chain A, Crystal Structure Of Acyl-Carrier-Protein S-
           Malonyltransferase From Burkholderia Pseudomallei 1710b
          Length = 318

 Score =  229 bits (585), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 133/313 (42%), Positives = 177/313 (56%), Gaps = 10/313 (3%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHT---LNQNLSDLMWNGSQEELTA 57
           M     FPGQGSQ +GM     ++F +  +V E +D     L Q++  L+ +G  +EL  
Sbjct: 9   MKFAFVFPGQGSQSVGM----LNAFADVAVVRETLDEASDALGQDIGKLIADGPADELNL 64

Query: 58  TCNAQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVR 117
           T N QP +   + A  R  ++ G       S VAGHSLGEYTAL AA A +  D + LVR
Sbjct: 65  TTNTQPVMLTAAYACYRAWQQAG---GAQPSIVAGHSLGEYTALVAAGAIAFRDALPLVR 121

Query: 118 ARGKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDA 177
            R ++MQ AVP G+G M AI+GLDD  V ++CA+AS  G+ E  N N   QVVI+G +  
Sbjct: 122 FRAQAMQTAVPVGVGGMAAILGLDDDTVRAVCAEASATGVVEAVNFNAPAQVVIAGTKAG 181

Query: 178 VKCAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCAS 237
           ++ A +    KGAKRA+ LPVSAPFHSSL+ P S  ++  L  V  + P + ++ N   +
Sbjct: 182 IEKACEIAKEKGAKRALPLPVSAPFHSSLLKPASDKLREYLAGVDVKAPKISVVNNIDVA 241

Query: 238 PVSSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAV 297
            VS    I   LV Q  G VRW E +Q  A  GV  V E G GKVL GL KRID +L   
Sbjct: 242 VVSDPAAIKDALVRQAAGPVRWVECVQHIAREGVTHVIECGPGKVLAGLTKRIDGNLVGA 301

Query: 298 SISKVEDIDLALR 310
           S+     +D AL+
Sbjct: 302 SVFDPASLDEALK 314


>gi|328474612|gb|EGF45417.1| malonyl CoA-acyl carrier protein transacylase [Vibrio
           parahaemolyticus 10329]
          Length = 307

 Score =  229 bits (585), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 128/304 (42%), Positives = 179/304 (58%), Gaps = 3/304 (0%)

Query: 5   LTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPA 64
           + FPGQGSQ +GM  DL + +   +  F E    L  +L  L+ NG  E+L  T   QPA
Sbjct: 6   IVFPGQGSQAVGMLADLGEQYDVVKQTFAEASDALGYDLWALVQNGPAEDLNQTFRTQPA 65

Query: 65  LTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQ 124
           L A S+A  RV ++ GL      + +AGHSLGEY+AL  A      + I+LV  RGK MQ
Sbjct: 66  LLASSVAIWRVWQELGL---EQPANLAGHSLGEYSALVCAGVIDFKEAIKLVELRGKLMQ 122

Query: 125 EAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAADT 184
           EAVP G G+M AIIGLDD  +   C +A++  +    N N  GQVVI+G +DAV+ A   
Sbjct: 123 EAVPAGTGAMYAIIGLDDDAIAKACEEAAQGDVVSPVNFNSPGQVVIAGSKDAVERAGAL 182

Query: 185 CLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSIDE 244
           C   GAKRA+ LPVS P H +LM P +  +   L+S+    P +P++ N   +  +   +
Sbjct: 183 CKEAGAKRALPLPVSVPSHCALMKPAADKLAVALESIEFNTPQLPVINNVDVAAETDPAK 242

Query: 245 ISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVED 304
           I   LV Q+   VRW E++Q  +  GV+++ E+G GKVLTGL KRI K+LSA +++ V  
Sbjct: 243 IKDALVRQLYSPVRWTESVQLMSEQGVENLLELGPGKVLTGLTKRIVKTLSAATVNDVAS 302

Query: 305 IDLA 308
           ++ A
Sbjct: 303 LEAA 306


>gi|197334405|ref|YP_002156563.1| malonyl CoA-acyl carrier protein transacylase [Vibrio fischeri
           MJ11]
 gi|197315895|gb|ACH65342.1| malonyl CoA-acyl carrier protein transacylase [Vibrio fischeri
           MJ11]
          Length = 307

 Score =  229 bits (585), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 128/304 (42%), Positives = 176/304 (57%), Gaps = 3/304 (0%)

Query: 5   LTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPA 64
           + FPGQGSQ +GM  +L +        F E    L  +L  L+ NG  E+L  T   QPA
Sbjct: 6   IVFPGQGSQAVGMLAELGEQHEVVTQTFAEASDALGYDLWSLVQNGPAEDLNQTFRTQPA 65

Query: 65  LTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQ 124
           L A S+A  RV ++ GL      S +AGHSLGEY+AL  A      + I+LV  RG+ MQ
Sbjct: 66  LLATSVALWRVWQEQGLA---QPSVLAGHSLGEYSALVCAGVIDFKEAIKLVELRGQLMQ 122

Query: 125 EAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAADT 184
           EAVP G+G+M AIIGLD+  +   C +A++  +    N N  GQVVI+G +DAV+ A   
Sbjct: 123 EAVPAGIGAMYAIIGLDNESIAKACEEAAQGEVVSPVNFNSPGQVVIAGNKDAVERAGAL 182

Query: 185 CLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSIDE 244
           C   GAKRA+ LPVS P H +LM P +  +   L+++    P +P++ N      +   +
Sbjct: 183 CKEAGAKRALPLPVSVPSHCALMKPAADKLAVALENIEFNTPTLPVINNVDVIAETDPAK 242

Query: 245 ISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVED 304
           I   LV Q+ G VRW E ++  A  GV+++YEVG GKVLTGL KRI KSLSA  ++    
Sbjct: 243 IKDALVRQLYGPVRWTEVVEKMAEQGVETLYEVGPGKVLTGLTKRIVKSLSAAEVNDAAS 302

Query: 305 IDLA 308
           ++ A
Sbjct: 303 LEAA 306


>gi|53720047|ref|YP_109033.1| acyl-carrier-protein S-malonyltransferase [Burkholderia
           pseudomallei K96243]
 gi|53725369|ref|YP_102327.1| acyl-carrier-protein S-malonyltransferase [Burkholderia mallei ATCC
           23344]
 gi|67641124|ref|ZP_00439909.1| malonyl CoA-acyl carrier protein transacylase [Burkholderia mallei
           GB8 horse 4]
 gi|76811768|ref|YP_334287.1| acyl-carrier-protein S-malonyltransferase [Burkholderia
           pseudomallei 1710b]
 gi|121598980|ref|YP_993782.1| malonyl CoA-acyl carrier protein transacylase [Burkholderia mallei
           SAVP1]
 gi|124384131|ref|YP_001028752.1| malonyl CoA-acyl carrier protein transacylase [Burkholderia mallei
           NCTC 10229]
 gi|126450420|ref|YP_001081340.1| malonyl CoA-acyl carrier protein transacylase [Burkholderia mallei
           NCTC 10247]
 gi|167000767|ref|ZP_02266574.1| malonyl CoA-acyl carrier protein transacylase [Burkholderia mallei
           PRL-20]
 gi|167816764|ref|ZP_02448444.1| malonyl CoA-acyl carrier protein transacylase [Burkholderia
           pseudomallei 91]
 gi|167895257|ref|ZP_02482659.1| malonyl CoA-acyl carrier protein transacylase [Burkholderia
           pseudomallei 7894]
 gi|167903641|ref|ZP_02490846.1| malonyl CoA-acyl carrier protein transacylase [Burkholderia
           pseudomallei NCTC 13177]
 gi|167919886|ref|ZP_02506977.1| malonyl CoA-acyl carrier protein transacylase [Burkholderia
           pseudomallei BCC215]
 gi|217420517|ref|ZP_03452022.1| [acyl-carrier-protein] S-malonyltransferase [Burkholderia
           pseudomallei 576]
 gi|254178662|ref|ZP_04885317.1| malonyl CoA-acyl carrier protein transacylase [Burkholderia mallei
           ATCC 10399]
 gi|254184198|ref|ZP_04890788.1| malonyl CoA-acyl carrier protein transacylase [Burkholderia
           pseudomallei 1655]
 gi|254199220|ref|ZP_04905586.1| malonyl CoA-acyl carrier protein transacylase [Burkholderia mallei
           FMH]
 gi|254205527|ref|ZP_04911879.1| malonyl CoA-acyl carrier protein transacylase [Burkholderia mallei
           JHU]
 gi|254260114|ref|ZP_04951168.1| malonyl CoA-acyl carrier protein transacylase [Burkholderia
           pseudomallei 1710a]
 gi|254357694|ref|ZP_04973967.1| malonyl CoA-acyl carrier protein transacylase [Burkholderia mallei
           2002721280]
 gi|52210461|emb|CAH36444.1| malonyl CoA-acyl carrier protein transacylase [Burkholderia
           pseudomallei K96243]
 gi|52428792|gb|AAU49385.1| malonyl CoA-acyl carrier protein transacylase [Burkholderia mallei
           ATCC 23344]
 gi|76581221|gb|ABA50696.1| malonyl CoA-acyl carrier protein transacylase [Burkholderia
           pseudomallei 1710b]
 gi|121227790|gb|ABM50308.1| malonyl CoA-acyl carrier protein transacylase [Burkholderia mallei
           SAVP1]
 gi|124292151|gb|ABN01420.1| malonyl CoA-acyl carrier protein transacylase [Burkholderia mallei
           NCTC 10229]
 gi|126243290|gb|ABO06383.1| malonyl CoA-acyl carrier protein transacylase [Burkholderia mallei
           NCTC 10247]
 gi|147748816|gb|EDK55890.1| malonyl CoA-acyl carrier protein transacylase [Burkholderia mallei
           FMH]
 gi|147752970|gb|EDK60035.1| malonyl CoA-acyl carrier protein transacylase [Burkholderia mallei
           JHU]
 gi|148026821|gb|EDK84842.1| malonyl CoA-acyl carrier protein transacylase [Burkholderia mallei
           2002721280]
 gi|160699701|gb|EDP89671.1| malonyl CoA-acyl carrier protein transacylase [Burkholderia mallei
           ATCC 10399]
 gi|184214729|gb|EDU11772.1| malonyl CoA-acyl carrier protein transacylase [Burkholderia
           pseudomallei 1655]
 gi|217395929|gb|EEC35946.1| [acyl-carrier-protein] S-malonyltransferase [Burkholderia
           pseudomallei 576]
 gi|238521989|gb|EEP85436.1| malonyl CoA-acyl carrier protein transacylase [Burkholderia mallei
           GB8 horse 4]
 gi|243063317|gb|EES45503.1| malonyl CoA-acyl carrier protein transacylase [Burkholderia mallei
           PRL-20]
 gi|254218803|gb|EET08187.1| malonyl CoA-acyl carrier protein transacylase [Burkholderia
           pseudomallei 1710a]
          Length = 310

 Score =  229 bits (584), Expect = 4e-58,   Method: Compositional matrix adjust.
 Identities = 133/313 (42%), Positives = 177/313 (56%), Gaps = 10/313 (3%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHT---LNQNLSDLMWNGSQEELTA 57
           M     FPGQGSQ +GM     ++F +  +V E +D     L Q++  L+ +G  +EL  
Sbjct: 1   MKFAFVFPGQGSQSVGM----LNAFADVAVVRETLDEASDALGQDIGKLIADGPADELNL 56

Query: 58  TCNAQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVR 117
           T N QP +   + A  R  ++ G       S VAGHSLGEYTAL AA A +  D + LVR
Sbjct: 57  TTNTQPVMLTAAYACYRAWQQAG---GAQPSIVAGHSLGEYTALVAAGAIAFRDALPLVR 113

Query: 118 ARGKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDA 177
            R ++MQ AVP G+G M AI+GLDD  V ++CA+AS  G+ E  N N   QVVI+G +  
Sbjct: 114 FRAQAMQTAVPVGVGGMAAILGLDDDTVRAVCAEASATGVVEAVNFNAPAQVVIAGTKAG 173

Query: 178 VKCAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCAS 237
           ++ A +    KGAKRA+ LPVSAPFHSSL+ P S  ++  L  V  + P + ++ N   +
Sbjct: 174 IEKACEIAKEKGAKRALPLPVSAPFHSSLLKPASDKLREYLAGVDVKAPKISVVNNIDVA 233

Query: 238 PVSSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAV 297
            VS    I   LV Q  G VRW E +Q  A  GV  V E G GKVL GL KRID +L   
Sbjct: 234 VVSDPAAIKDALVRQAAGPVRWVECVQHIAREGVTHVIECGPGKVLAGLTKRIDGNLVGA 293

Query: 298 SISKVEDIDLALR 310
           S+     +D AL+
Sbjct: 294 SVFDPASLDEALK 306


>gi|294793525|ref|ZP_06758662.1| malonyl CoA-acyl carrier protein transacylase [Veillonella sp.
           3_1_44]
 gi|294455095|gb|EFG23467.1| malonyl CoA-acyl carrier protein transacylase [Veillonella sp.
           3_1_44]
          Length = 313

 Score =  229 bits (584), Expect = 4e-58,   Method: Compositional matrix adjust.
 Identities = 126/315 (40%), Positives = 177/315 (56%), Gaps = 5/315 (1%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M T   FPGQGSQ +GM +DLY+++P  +  FEE D  L  ++S L + G   EL  T N
Sbjct: 1   MKTAFVFPGQGSQKVGMLQDLYNAYPIVKQRFEEADEALGYSISKLCFEGPDTELVKTAN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
            QPA+   S+A   ++++ G     DI  V GHSLGEY+AL AA   +  D + +V  RG
Sbjct: 61  TQPAILTASVACYEILKEQGFT--PDI--VGGHSLGEYSALVAAGVLNFKDAVYVVHKRG 116

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQA-SRVGICEIANDNGGGQVVISGLQDAVK 179
           + MQEAVP G G+M AI+ L    V  IC +  + VG  +  N N  GQ+VI+G   AV+
Sbjct: 117 EYMQEAVPLGKGAMAAILALPREQVVEICEEVNASVGSVQAVNFNCPGQIVIAGETAAVE 176

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            AA+     GAKRAV LPVSAPFHS LM P +  +K  LD +   D  +P++ N     +
Sbjct: 177 TAAEKMKEAGAKRAVMLPVSAPFHSRLMEPAALRLKEELDKIQVCDAQIPVVANVTGKIL 236

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
           ++ ++I   LV Q    V W + +    N GV    EVG GKVLTG  K+I+K +   ++
Sbjct: 237 TNANDIKESLVTQAANPVLWEDCVTEMVNFGVTRFVEVGPGKVLTGFTKKINKDMELANV 296

Query: 300 SKVEDIDLALRSIVG 314
             +  ++  L  + G
Sbjct: 297 EDIASLEKTLEFLKG 311


>gi|134277015|ref|ZP_01763730.1| malonyl CoA-acyl carrier protein transacylase [Burkholderia
           pseudomallei 305]
 gi|167739562|ref|ZP_02412336.1| malonyl CoA-acyl carrier protein transacylase [Burkholderia
           pseudomallei 14]
 gi|237813207|ref|YP_002897658.1| malonyl CoA-acyl carrier protein transacylase [Burkholderia
           pseudomallei MSHR346]
 gi|134250665|gb|EBA50744.1| malonyl CoA-acyl carrier protein transacylase [Burkholderia
           pseudomallei 305]
 gi|237502956|gb|ACQ95274.1| malonyl CoA-acyl carrier protein transacylase [Burkholderia
           pseudomallei MSHR346]
          Length = 310

 Score =  229 bits (583), Expect = 6e-58,   Method: Compositional matrix adjust.
 Identities = 133/313 (42%), Positives = 177/313 (56%), Gaps = 10/313 (3%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHT---LNQNLSDLMWNGSQEELTA 57
           M     FPGQGSQ +GM     ++F +  +V E +D     L Q++  L+ +G  +EL  
Sbjct: 1   MKFAFVFPGQGSQSVGM----LNAFADVAVVRETLDEASDALGQDIGKLIADGPADELNL 56

Query: 58  TCNAQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVR 117
           T N QP +   + A  R  ++ G       S VAGHSLGEYTAL AA A +  D + LVR
Sbjct: 57  TTNTQPVMLTAAYACYRAWQQAG---GAQPSIVAGHSLGEYTALVAAGAIAFRDALPLVR 113

Query: 118 ARGKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDA 177
            R ++MQ AVP G+G M AI+GLDD  V ++CA+AS  G+ E  N N   QVVI+G +  
Sbjct: 114 FRAQAMQTAVPVGVGGMAAILGLDDDTVRAVCAEASATGVVEAVNFNAPAQVVIAGTKAG 173

Query: 178 VKCAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCAS 237
           ++ A +    KGAKRA+ LPVSAPFHSSL+ P S  ++  L  V  + P + ++ N   +
Sbjct: 174 IEKACEIAKAKGAKRALPLPVSAPFHSSLLKPASDKLREYLAGVDVKAPKISVVNNIDVA 233

Query: 238 PVSSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAV 297
            VS    I   LV Q  G VRW E +Q  A  GV  V E G GKVL GL KRID +L   
Sbjct: 234 VVSDPAAIKDALVRQAAGPVRWVECVQHIAREGVTHVIECGPGKVLAGLTKRIDGNLVGA 293

Query: 298 SISKVEDIDLALR 310
           S+     +D AL+
Sbjct: 294 SVFDPASLDEALK 306


>gi|220918032|ref|YP_002493336.1| malonyl CoA-acyl carrier protein transacylase [Anaeromyxobacter
           dehalogenans 2CP-1]
 gi|219955886|gb|ACL66270.1| malonyl CoA-acyl carrier protein transacylase [Anaeromyxobacter
           dehalogenans 2CP-1]
          Length = 313

 Score =  229 bits (583), Expect = 6e-58,   Method: Compositional matrix adjust.
 Identities = 139/312 (44%), Positives = 188/312 (60%), Gaps = 6/312 (1%)

Query: 5   LTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPA 64
             FPGQGSQ +GMG++L+D+FPEAR +F+EVD  L + LS L + G +++L  T N QP+
Sbjct: 6   FVFPGQGSQAVGMGKELHDAFPEAREIFQEVDEALGEKLSALCFGGPEDQLKLTANTQPS 65

Query: 65  LTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQ 124
           +  VS A   V+   GL       YVAGHSLGEY+AL A  A   ++  R VRARG  MQ
Sbjct: 66  ILTVSSAAAAVLANQGLVP----DYVAGHSLGEYSALVAVGACGAAEAARAVRARGTFMQ 121

Query: 125 EAVPPGLGSMVAIIGLDDCVVDSICAQ-ASRVG-ICEIANDNGGGQVVISGLQDAVKCAA 182
           EAVP G G+M A++GLD   V  ICA  A+  G +   AN N   Q VI+G   AV+ A 
Sbjct: 122 EAVPAGQGAMSAVLGLDPARVREICAAVAAETGQVVSPANYNEPAQTVIAGAAGAVEQAG 181

Query: 183 DTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSI 242
                 GAKR + LPVSAPFHS+LM PV   ++ +L ++  + P+ P++ N  A P    
Sbjct: 182 ARLKEAGAKRVLPLPVSAPFHSALMAPVKARLEPVLRAMPWRAPLRPVVTNVEAKPNQDA 241

Query: 243 DEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKV 302
             +  LLVEQVT  VRW E ++     GV  V EVG GKVL+GL +RID+S+ A ++   
Sbjct: 242 SRVVPLLVEQVTAPVRWIECVEELVRLGVTRVVEVGPGKVLSGLLRRIDRSVEAFNVEDR 301

Query: 303 EDIDLALRSIVG 314
             ++  L ++ G
Sbjct: 302 ASLEKTLAALKG 313


>gi|260892845|ref|YP_003238942.1| malonyl CoA-acyl carrier protein transacylase [Ammonifex degensii
           KC4]
 gi|260864986|gb|ACX52092.1| malonyl CoA-acyl carrier protein transacylase [Ammonifex degensii
           KC4]
          Length = 314

 Score =  228 bits (582), Expect = 6e-58,   Method: Compositional matrix adjust.
 Identities = 131/310 (42%), Positives = 182/310 (58%), Gaps = 3/310 (0%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M+    FPGQGSQ +GMG+DLY+ +PEAR VF E D  L   LS L + G    L+ T N
Sbjct: 1   MTLACVFPGQGSQYVGMGKDLYERYPEAREVFAEADAVLGFPLSQLCFEGPASLLSQTMN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
            QPA+  VS+A  RV    G    R  S VAGHSLGE++AL AA A      +RLVR RG
Sbjct: 61  TQPAVLTVSVACWRVYLTQG---GRKPSAVAGHSLGEFSALVAAGALDFPTALRLVRRRG 117

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           + MQEAVP G G M+A++GL    ++ +     + G+ E+AN N  GQ+V+SG   A++ 
Sbjct: 118 ELMQEAVPLGEGGMLALLGLPTEKLERVLEAGKQAGVVEVANYNCPGQIVLSGHMPALEA 177

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           AA     +GAK+ V L VS PFHSSLM   +++    L+ VT + PV+P++ N  A    
Sbjct: 178 AAQAARAEGAKKTVLLAVSGPFHSSLMRRAAELFAQELEQVTIKKPVLPVVLNCTAEYAY 237

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
              EI + L+ Q+T  VRW E+++     GV++  E+G GKVLTGL +RI    + +++ 
Sbjct: 238 RASEIKKALMRQMTSPVRWEESVRRLVKDGVETFVEIGPGKVLTGLIRRIHALATCLNVE 297

Query: 301 KVEDIDLALR 310
               +   LR
Sbjct: 298 DEASLRHTLR 307


>gi|332141137|ref|YP_004426875.1| malonyl CoA-acyl carrier protein transacylase [Alteromonas
           macleodii str. 'Deep ecotype']
 gi|327551159|gb|AEA97877.1| malonyl CoA-acyl carrier protein transacylase [Alteromonas
           macleodii str. 'Deep ecotype']
          Length = 309

 Score =  228 bits (582), Expect = 7e-58,   Method: Compositional matrix adjust.
 Identities = 129/306 (42%), Positives = 179/306 (58%), Gaps = 6/306 (1%)

Query: 3   TVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQ 62
           T   FPGQGSQ +GM ++L ++ P     F+E    L  +L DL+ N +  +L  T   Q
Sbjct: 4   TACVFPGQGSQSVGMLKELAETSPIIEATFKEASDVLGYDLWDLVQNDTDGKLNETHITQ 63

Query: 63  PALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKS 122
           PAL A S+A  RV+ + G+    D+ Y+AGHSLGEY+AL    A   +D I+LV ARGK 
Sbjct: 64  PALLAASVAIWRVIREQGI----DVDYLAGHSLGEYSALVCGGAMDFADAIKLVEARGKY 119

Query: 123 MQEAVPPGLGSMVAIIGLDDCVVDSICAQASRV--GICEIANDNGGGQVVISGLQDAVKC 180
           MQEAVP G G+M AIIGLDD  +  IC Q +     +    N N  GQVVI+G + A + 
Sbjct: 120 MQEAVPAGAGAMYAIIGLDDATIADICQQTAIATGDVVAPVNFNSPGQVVIAGEKHAAEQ 179

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           AA  C + GAKRA+ L VS P H  LM P +  ++  L S+   +P + I+ N   +  +
Sbjct: 180 AASACKDAGAKRALPLAVSVPSHCELMRPAADKLEDALSSLNVNEPAINIVNNVDVTIET 239

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
             D I   LV Q+   V+W  T+++ A  GV+ V EVG GKVLTGL KRI K L A++++
Sbjct: 240 QGDAIKNALVRQLYCPVQWTRTVEYLAAAGVERVIEVGPGKVLTGLNKRISKGLEALAVN 299

Query: 301 KVEDID 306
             + ++
Sbjct: 300 TPDGVE 305


>gi|325577416|ref|ZP_08147823.1| malonyl-CoA-[acyl-carrier-protein] transacylase [Haemophilus
           parainfluenzae ATCC 33392]
 gi|325160645|gb|EGC72768.1| malonyl-CoA-[acyl-carrier-protein] transacylase [Haemophilus
           parainfluenzae ATCC 33392]
          Length = 312

 Score =  228 bits (582), Expect = 7e-58,   Method: Compositional matrix adjust.
 Identities = 126/302 (41%), Positives = 172/302 (56%), Gaps = 2/302 (0%)

Query: 5   LTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPA 64
           + FPGQGSQ +GM  DL + +P     F++    L  +L +L+  G  EEL  T   QPA
Sbjct: 6   MVFPGQGSQAVGMLADLANEYPVVTETFKQASEALGYDLWNLVQQGPAEELNKTWQTQPA 65

Query: 65  LTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQ 124
           L A S+A  RV ++     +   S +AGHSLGEY+AL  A      D I+LV  RGK MQ
Sbjct: 66  LLAASVAIFRVWQEK--YPQLQPSVMAGHSLGEYSALVCAGVIDFKDAIKLVELRGKLMQ 123

Query: 125 EAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAADT 184
           +AVP G G+M AIIGLD+  + + C QA +  +    N N  GQVVI+G ++AV+ AA  
Sbjct: 124 QAVPEGTGAMYAIIGLDNEAIINACKQAEQGEVVSAVNFNSPGQVVIAGAKEAVERAAAL 183

Query: 185 CLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSIDE 244
           C   GAKRA+ L VS P H +LM P +  +   L+ +T   P +P+L N      +   E
Sbjct: 184 CKEAGAKRALPLAVSVPSHCALMKPAADQLAVTLEGITLNAPAIPVLNNVDVKAETESAE 243

Query: 245 ISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVED 304
           I   L+ Q+   VRW ET++  A  GV+ + E+G GKVL GL KRI   L A S++ V  
Sbjct: 244 IRTALIRQLYSPVRWTETVEKMAQDGVEVLVEIGPGKVLNGLTKRIVAELQATSVNDVAS 303

Query: 305 ID 306
           +D
Sbjct: 304 LD 305


>gi|302391787|ref|YP_003827607.1| (acyl-carrier-protein) S-malonyltransferase [Acetohalobium
           arabaticum DSM 5501]
 gi|302203864|gb|ADL12542.1| (Acyl-carrier-protein) S-malonyltransferase [Acetohalobium
           arabaticum DSM 5501]
          Length = 310

 Score =  228 bits (582), Expect = 7e-58,   Method: Compositional matrix adjust.
 Identities = 118/310 (38%), Positives = 181/310 (58%), Gaps = 4/310 (1%)

Query: 3   TVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQ 62
           T   FPGQG+Q +GMG +L   F  A+ VF+  D  L+ ++S L + G  +EL  T N Q
Sbjct: 5   TAFLFPGQGAQKVGMGAELVKEFSAAKEVFDAADEALDLDISKLCFEGPADELKQTENTQ 64

Query: 63  PALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKS 122
           PA+  +S+A   V+++ G+        VAGHSLGEY+AL AA A      ++LVR RG+ 
Sbjct: 65  PAILTMSIAVYEVLKEKGI----QPDTVAGHSLGEYSALVAAGALDFKSAVKLVRKRGQF 120

Query: 123 MQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAA 182
           M+EAVP G G+M A+IGL    V     + SR GI E+AN N   Q VISG ++AV+   
Sbjct: 121 MEEAVPAGEGAMGAVIGLKREGVQEAVKEGSRFGIVELANYNTPIQTVISGEKEAVEKTL 180

Query: 183 DTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSI 242
           +   + GAK+ V L VS PFHSSLM      +   L+ +   +P +P++ N  A  V + 
Sbjct: 181 ELAEDTGAKKTVLLDVSGPFHSSLMKSAGDKLAAELEKIEISEPELPVMANVTADYVETP 240

Query: 243 DEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKV 302
           DEI + L++Q++G V W + I+   ++ +  V E G G+ L    +RID+S++A+++  +
Sbjct: 241 DEIKKALIDQLSGSVYWVDIIELMIDNNLDRVIEAGPGRTLKSFMRRIDRSITALNVRNL 300

Query: 303 EDIDLALRSI 312
             ++  L+ +
Sbjct: 301 SSLEKTLQKL 310


>gi|89098689|ref|ZP_01171571.1| acyl-carrier-protein S-malonyltransferase [Bacillus sp. NRRL
           B-14911]
 gi|89086651|gb|EAR65770.1| acyl-carrier-protein S-malonyltransferase [Bacillus sp. NRRL
           B-14911]
          Length = 315

 Score =  228 bits (582), Expect = 8e-58,   Method: Compositional matrix adjust.
 Identities = 124/309 (40%), Positives = 187/309 (60%), Gaps = 5/309 (1%)

Query: 7   FPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPALT 66
           FPGQGSQ +GMG+ L +S  + + VF++ D  LN  LS L++ G QE LT T NAQPAL 
Sbjct: 8   FPGQGSQTVGMGKSLAESDNKVKAVFDQADQRLNDKLSSLIFEGPQETLTLTVNAQPALL 67

Query: 67  AVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQEA 126
             S+A +    ++G  ++ D  Y AGHSLGEYTAL AA + S  D +  VR RG+ M+ A
Sbjct: 68  TTSIAILAKFRESG--IRAD--YTAGHSLGEYTALVAAGSISFEDAVHAVRKRGEFMEAA 123

Query: 127 VPPGLGSMVAIIGLDDCVVDSICAQASRVGI-CEIANDNGGGQVVISGLQDAVKCAADTC 185
           VP G G+M A++GL    + ++  + S  G   ++AN N  GQ+VISG +  V+ A+   
Sbjct: 124 VPNGEGTMAAVLGLGRDELRAVTEEISGKGHPVQLANLNCPGQIVISGSRQGVEQASAKA 183

Query: 186 LNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSIDEI 245
              GAKR + L VS PFHSSLM P ++ ++ +LDS+T  D  +P++ N  A+ ++   +I
Sbjct: 184 KEAGAKRVLPLDVSGPFHSSLMKPAAENLRGVLDSITVSDAQIPVISNVSAAEMTESGDI 243

Query: 246 SRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVEDI 305
              LV+Q+   V W ++I+     GV +  E+G GKVL+GL K++++S    ++S     
Sbjct: 244 KEKLVQQLYSPVLWEDSIERMIGLGVDTFIEIGPGKVLSGLVKKVNRSAKTYAVSDEASC 303

Query: 306 DLALRSIVG 314
             A+ ++ G
Sbjct: 304 AAAIEALKG 312


>gi|156975182|ref|YP_001446089.1| malonyl CoA-acyl carrier protein transacylase [Vibrio harveyi ATCC
           BAA-1116]
 gi|156526776|gb|ABU71862.1| hypothetical protein VIBHAR_02909 [Vibrio harveyi ATCC BAA-1116]
          Length = 324

 Score =  228 bits (581), Expect = 8e-58,   Method: Compositional matrix adjust.
 Identities = 127/304 (41%), Positives = 180/304 (59%), Gaps = 3/304 (0%)

Query: 5   LTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPA 64
           + FPGQGSQ +GM  DL + +   +  F E    L  +L  L+ NG  E+L  T   QPA
Sbjct: 23  IVFPGQGSQAVGMLADLGEQYDVVKQTFAEASDALGYDLWALVQNGPAEDLNQTFRTQPA 82

Query: 65  LTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQ 124
           L A S+A  RV ++ GL      + +AGHSLGEY+AL  A      + I+LV  RG+ MQ
Sbjct: 83  LLASSVAIWRVWQELGL---EQPANLAGHSLGEYSALVCAGVIDFKEAIKLVELRGQLMQ 139

Query: 125 EAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAADT 184
           EAVP G G+M AIIGLDD  +   C +A++  +    N N  GQVVI+G +DAV+ A   
Sbjct: 140 EAVPSGTGAMYAIIGLDDEAIAKACEEAAQGEVVSPVNFNSPGQVVIAGSKDAVERAGAL 199

Query: 185 CLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSIDE 244
           C   GAKRA+ LPVS P H +LM P ++ +   L+S+    P +P++ N   +  +   +
Sbjct: 200 CKEAGAKRALPLPVSVPSHCALMKPAAEKLAVALESIEFNAPQLPVINNVDVAAETDPAK 259

Query: 245 ISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVED 304
           I   LV Q+   VRW E++Q  +  GV+++ E+G GKVLTGL KRI K+LSA +++ V  
Sbjct: 260 IKDALVRQLHSPVRWTESVQLMSEQGVENLLELGPGKVLTGLTKRIVKTLSAAAVNDVAS 319

Query: 305 IDLA 308
           ++ A
Sbjct: 320 LEAA 323


>gi|117925172|ref|YP_865789.1| [acyl-carrier-protein] S-malonyltransferase [Magnetococcus sp.
           MC-1]
 gi|117608928|gb|ABK44383.1| [Acyl-carrier-protein] S-malonyltransferase [Magnetococcus sp.
           MC-1]
          Length = 312

 Score =  228 bits (581), Expect = 8e-58,   Method: Compositional matrix adjust.
 Identities = 124/301 (41%), Positives = 178/301 (59%), Gaps = 5/301 (1%)

Query: 7   FPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPALT 66
           FPGQGSQ +GMG+ L+ +      +FEE +  L ++L  LM++G + +LT T N QPAL 
Sbjct: 8   FPGQGSQAVGMGQALHGADASCAALFEEANTVLGEDLRGLMFDGPEADLTLTRNTQPALV 67

Query: 67  AVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQEA 126
             +MA   ++ +          +VAGHSLGEY A+CAA   S +D IRL R RG +MQ+A
Sbjct: 68  VTAMAAYTLLRQQS---DLQADFVAGHSLGEYAAICAAGGLSFADAIRLTRLRGDAMQKA 124

Query: 127 VPPGLGSMVAIIGLDDCVVDSICAQASRV--GICEIANDNGGGQVVISGLQDAVKCAADT 184
           VP G+G+M A++ ++  +V+ +C  AS+    +C  AN N   Q+VISG + AV+ A   
Sbjct: 125 VPVGVGAMAAMLNMEAALVEEVCQAASQALGQVCVPANYNTPAQIVISGDKAAVEHAVAL 184

Query: 185 CLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSIDE 244
              +GAKR V L VSAPFH  LM P +  M   L     QD  +P++ N  A   +  + 
Sbjct: 185 AKERGAKRCVMLSVSAPFHCPLMQPAADAMAQALAQTPMQDLSIPLVANVNAGITTDAET 244

Query: 245 ISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVED 304
           + + LV QV G VRW  +I+     GV    E+G+GKVLTG+ KRID S+  V+++  ED
Sbjct: 245 VRQQLVAQVCGSVRWEASIRAMIAQGVDRFVEIGTGKVLTGMLKRIDGSVRGVAVNGPED 304

Query: 305 I 305
           +
Sbjct: 305 M 305


>gi|71083409|ref|YP_266128.1| [acyl-carrier-protein] S-malonyltransferase [Candidatus
           Pelagibacter ubique HTCC1062]
 gi|71062522|gb|AAZ21525.1| [acyl-carrier-protein] S-malonyltransferase [Candidatus
           Pelagibacter ubique HTCC1062]
          Length = 310

 Score =  228 bits (581), Expect = 9e-58,   Method: Compositional matrix adjust.
 Identities = 121/302 (40%), Positives = 184/302 (60%), Gaps = 3/302 (0%)

Query: 7   FPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPALT 66
           FPGQGSQ++GMG+DL+  +   + +F+E D TL  +LS+L+ NG +EEL  T N QPA+ 
Sbjct: 6   FPGQGSQLVGMGKDLHAKYSLVQDLFKEADETLGFSLSNLILNGPKEELDLTENTQPAIF 65

Query: 67  AVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQEA 126
            +S +  +++++          + AGHSLGEY+AL AA + S SDT+++++ RG +MQ +
Sbjct: 66  LLSYSIFKLIKEEFKIDLDKAKFYAGHSLGEYSALTAAGSLSFSDTLKILKIRGNAMQNS 125

Query: 127 VPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISG-LQDAVKCAADTC 185
           VP G+G MVA++G +  ++  I  +      C IANDN  GQ+V+SG ++D  K   D  
Sbjct: 126 VPKGVGGMVAVLGSEIEIIKKIIDENKDKYECFIANDNSVGQIVLSGKIEDLEKIMVD-- 183

Query: 186 LNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSIDEI 245
           L     + + LPVSAPFH  LM   + VMK  +  +   +P   ++ N     +S+ +E+
Sbjct: 184 LKASNIKNIKLPVSAPFHCKLMNNATLVMKEEIAKLNFNEPKNILISNVTGKEISNSNEL 243

Query: 246 SRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVEDI 305
             LLV+Q+   VRWRE++      GV    E+G GKVL+GL KRIDK++   +I+  EDI
Sbjct: 244 KELLVKQIESSVRWRESVLLMIEKGVTEFIEIGPGKVLSGLIKRIDKNVKVSAINSEEDI 303

Query: 306 DL 307
            L
Sbjct: 304 KL 305


>gi|115377148|ref|ZP_01464362.1| malonyl CoA-acyl carrier protein transacylase [Stigmatella
           aurantiaca DW4/3-1]
 gi|310822855|ref|YP_003955213.1| malonyl CoA-acyl carrier protein transacylase [Stigmatella
           aurantiaca DW4/3-1]
 gi|115365857|gb|EAU64878.1| malonyl CoA-acyl carrier protein transacylase [Stigmatella
           aurantiaca DW4/3-1]
 gi|309395927|gb|ADO73386.1| Malonyl CoA-acyl carrier protein transacylase [Stigmatella
           aurantiaca DW4/3-1]
          Length = 312

 Score =  228 bits (581), Expect = 9e-58,   Method: Compositional matrix adjust.
 Identities = 135/313 (43%), Positives = 182/313 (58%), Gaps = 5/313 (1%)

Query: 1   MSTV-LTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATC 59
           MS V   FPGQGSQ +GMG+DL++ FPEAR VFE VD  L   LS   ++G ++EL  T 
Sbjct: 1   MSKVAFVFPGQGSQKVGMGKDLFEKFPEARAVFEAVDDVLGDKLSARCFDGPEDELKLTA 60

Query: 60  NAQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRAR 119
           N QPA+  +S+A   V  + G       ++VAGHSLGEY+AL AA A +L D  + VR R
Sbjct: 61  NTQPAILTMSLAVHAVFSQRGPA----PAFVAGHSLGEYSALVAAGALALGDAAQAVRKR 116

Query: 120 GKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVK 179
           G  MQEAVP G G+M A++GL+   V ++C   +   +   AN N   Q VI+G   AVK
Sbjct: 117 GTFMQEAVPVGTGAMAAVLGLEPGQVKAVCDAVAEGEVLAPANYNSPEQTVIAGHTAAVK 176

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            A       GAKR + LPVSAPFH +LM PV  ++  +L  +    P +P++ N  A P 
Sbjct: 177 RAEAKLKEAGAKRVMHLPVSAPFHCTLMDPVKPLLLDVLGKMKVSAPRIPVVSNVEARPN 236

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
           S    +  LLVEQV+  VRW E ++     GV  V E+G GKVL GL KRI+K +   +I
Sbjct: 237 SEAARVVPLLVEQVSAPVRWLECVEALHAEGVTRVVELGPGKVLAGLVKRINKGIETFNI 296

Query: 300 SKVEDIDLALRSI 312
                ++  L ++
Sbjct: 297 EDSASLEKTLAAL 309


>gi|59712348|ref|YP_205124.1| malonyl-CoA:(acyl carrier protein) S-malonyltransferase [Vibrio
           fischeri ES114]
 gi|59480449|gb|AAW86236.1| malonyl-CoA:(acyl carrier protein) S-malonyltransferase [Vibrio
           fischeri ES114]
          Length = 304

 Score =  228 bits (581), Expect = 9e-58,   Method: Compositional matrix adjust.
 Identities = 128/302 (42%), Positives = 176/302 (58%), Gaps = 3/302 (0%)

Query: 7   FPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPALT 66
           FPGQGSQ +GM  +L +        F E    L  +L  L+ NG  E+L  T   QPAL 
Sbjct: 5   FPGQGSQAVGMLAELGEQHEVVTQTFAEASDALGYDLWSLVQNGPAEDLNQTFRTQPALL 64

Query: 67  AVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQEA 126
           A S+A  RV ++ GL      S +AGHSLGEY+AL  A      + I+LV  RG+ MQEA
Sbjct: 65  ATSVALWRVWQEQGLA---QPSVLAGHSLGEYSALVCAGVIDFKEAIKLVELRGQLMQEA 121

Query: 127 VPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAADTCL 186
           VP G+G+M AIIGLD+  +   C +A++  +    N N  GQVVI+G +DAV+ A   C 
Sbjct: 122 VPAGVGAMYAIIGLDNESIAKACEEAAQGEVVSPVNFNSPGQVVIAGNKDAVERAGVLCK 181

Query: 187 NKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSIDEIS 246
             GAKRA+ LPVS P H +LM P +  +   L+++    P +P++ N      +   +I 
Sbjct: 182 EAGAKRALPLPVSVPSHCALMKPAADKLAVALENIEFNTPTLPVINNVDVIAETDPAKIK 241

Query: 247 RLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVEDID 306
             LV Q+ G VRW E ++  A  GV+++YEVG GKVLTGL KRI KSLSA +++    ++
Sbjct: 242 DALVRQLYGPVRWTEVVEKMAEQGVETLYEVGPGKVLTGLTKRIVKSLSAAAVNDAASLE 301

Query: 307 LA 308
            A
Sbjct: 302 AA 303


>gi|167720571|ref|ZP_02403807.1| malonyl CoA-acyl carrier protein transacylase [Burkholderia
           pseudomallei DM98]
          Length = 310

 Score =  228 bits (581), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 133/313 (42%), Positives = 176/313 (56%), Gaps = 10/313 (3%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHT---LNQNLSDLMWNGSQEELTA 57
           M     FPGQGSQ +GM      +F +  +V E +D     L Q++  L+ +G  +EL  
Sbjct: 1   MKFAFVFPGQGSQSVGM----LSAFADVAVVRETLDEASDALGQDIGKLIADGPADELNL 56

Query: 58  TCNAQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVR 117
           T N QP +   + A  R  ++ G       S VAGHSLGEYTAL AA A +  D + LVR
Sbjct: 57  TTNTQPVMLTAAYACYRAWQQAG---GAQPSIVAGHSLGEYTALVAAGAIAFRDALPLVR 113

Query: 118 ARGKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDA 177
            R ++MQ AVP G+G M AI+GLDD  V ++CA+AS  G+ E  N N   QVVI+G +  
Sbjct: 114 FRAQAMQTAVPVGVGGMAAILGLDDDTVRAVCAEASATGVVEAVNFNAPAQVVIAGTKAG 173

Query: 178 VKCAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCAS 237
           ++ A +    KGAKRA+ LPVSAPFHSSL+ P S  ++  L  V  + P + ++ N   +
Sbjct: 174 IEKACEIAKAKGAKRALPLPVSAPFHSSLLKPASDKLREYLAGVDVKAPKISVVNNIDVA 233

Query: 238 PVSSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAV 297
            VS    I   LV Q  G VRW E +Q  A  GV  V E G GKVL GL KRID +L   
Sbjct: 234 VVSDPAAIKDALVRQAAGPVRWVECVQHIAREGVTHVIECGPGKVLAGLTKRIDGNLVGA 293

Query: 298 SISKVEDIDLALR 310
           S+     +D AL+
Sbjct: 294 SVFDPASLDEALK 306


>gi|330720096|gb|EGG98508.1| Malonyl CoA-acyl carrier protein transacylase [gamma
           proteobacterium IMCC2047]
          Length = 308

 Score =  228 bits (580), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 125/302 (41%), Positives = 172/302 (56%), Gaps = 3/302 (0%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
           S    FPGQGSQ +GM  D+ + FP+ +  F+E    L  +L  L   G  EEL  T   
Sbjct: 4   SLAFVFPGQGSQAVGMLADVAEKFPQVKATFDEASAVLGTDLWQLTQEGPAEELNRTDMT 63

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPAL   S+A  RV  + G       +Y++GHSLGEY+AL  A A +  D ++LV  RG 
Sbjct: 64  QPALLTASVALWRVWNEQG---GAKPAYMSGHSLGEYSALVCAGAIAFEDAVKLVNKRGL 120

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCA 181
            MQ AVP G G+M AIIGLDD  ++S C QA++  +    N N  GQVVI+G  DAV  A
Sbjct: 121 FMQSAVPAGEGAMAAIIGLDDAAIESACEQAAQGEVVSAVNYNSPGQVVIAGQTDAVNRA 180

Query: 182 ADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSS 241
           ++ C   GAKRA+ LPVS P H +LM P ++ +   L+++T   P +P+L N  A     
Sbjct: 181 SELCKEAGAKRALPLPVSVPSHCALMKPAAEQLAAELEAITVNTPDIPVLQNVTAEVTMD 240

Query: 242 IDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISK 301
              I   LV+Q+   V W + +   A  GV+ + E G GKVL+GL KRI + L+  +++ 
Sbjct: 241 ATAIKDNLVQQLYRPVLWVDCVNNMAGKGVERMLECGPGKVLSGLNKRISRGLAVATVAD 300

Query: 302 VE 303
           VE
Sbjct: 301 VE 302


>gi|254831590|ref|ZP_05236245.1| malonyl CoA-acyl carrier protein transacylase [Listeria
           monocytogenes 10403S]
          Length = 313

 Score =  228 bits (580), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 122/302 (40%), Positives = 182/302 (60%), Gaps = 5/302 (1%)

Query: 5   LTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPA 64
             FPGQG+Q IGMG+D+   +PEA+ ++++ D  L  ++++++  G  E LT + NAQPA
Sbjct: 6   FVFPGQGAQKIGMGQDVAAEYPEAKKIYDDADERLGFSITEIITEGPIELLTKSENAQPA 65

Query: 65  LTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQ 124
           L + S+A +R +E  G  VK D  YVAGHSLGEY+AL A      SD I LVR RG+ M+
Sbjct: 66  LVSTSVAILRALETYG--VKAD--YVAGHSLGEYSALVAGGFLEASDAIYLVRKRGELME 121

Query: 125 EAVPPGLGSMVAIIGLDDCVVDSICAQASRVG-ICEIANDNGGGQVVISGLQDAVKCAAD 183
            AVP G G+M A++G+D   + +I  + +R G   ++AN N  GQ+VISG    V+ A +
Sbjct: 122 AAVPNGAGAMAAVLGVDRETLKTITEEVTREGDAVQLANLNCPGQIVISGTTAGVEKAGE 181

Query: 184 TCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSID 243
                GAKR + L VS PFHSSLM P +   + +L  V   D  +P++ N  A   +   
Sbjct: 182 KAKESGAKRVLPLAVSGPFHSSLMEPAALAFREILAEVEISDGNIPVVNNVDAKQTTDKA 241

Query: 244 EISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVE 303
           EIS  L++Q+   V W + ++    +GV +  E+GSGKVL GL K+I++ ++ +S    E
Sbjct: 242 EISDKLIKQIYSPVLWEDIVEELIKNGVDTFVEIGSGKVLAGLIKKINRDVTVLSAGDAE 301

Query: 304 DI 305
            +
Sbjct: 302 SV 303


>gi|114569764|ref|YP_756444.1| [Acyl-carrier-protein] S-malonyltransferase [Maricaulis maris
           MCS10]
 gi|114340226|gb|ABI65506.1| [Acyl-carrier-protein] S-malonyltransferase [Maricaulis maris
           MCS10]
          Length = 315

 Score =  228 bits (580), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 134/301 (44%), Positives = 185/301 (61%), Gaps = 1/301 (0%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M     FPGQGSQ +GM ++L   F  AR V +E+D  L+QNLS LM +G  E LT T N
Sbjct: 1   MKFAFVFPGQGSQSVGMAQELAGEFASARAVLDEIDTALDQNLSGLMADGPIETLTLTEN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
           AQPAL A S+A + V++           +VAGHSLGEY+AL AA A S++D  +L++ RG
Sbjct: 61  AQPALMASSLAVMAVLKAEFDVDVNAAEFVAGHSLGEYSALAAAGALSITDAAKLLKLRG 120

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
            +MQ+AVP G G+M A++G D+ +  +  A  +  G+C IANDN  GQ+VISG   A+  
Sbjct: 121 LAMQKAVPVGEGTMAALLGADEDLAAAAVAAGATAGVCAIANDNAPGQIVISGSTAAIDA 180

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A       G K+A+ LPVSAPFH  +M   +  M   L + T + P VP++ N  A P S
Sbjct: 181 AIAKAAELGLKKAMKLPVSAPFHCPMMQAAADAMAEALAAATIKAPSVPVVANVTARPTS 240

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANH-GVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
            ++ I + LVEQVTGRVRWRE++ W     G+ ++ E GSGKVL+ + KR  K  + V +
Sbjct: 241 DVETIRKQLVEQVTGRVRWRESVLWMVEEAGITTLAEAGSGKVLSTMLKRTTKDATGVPL 300

Query: 300 S 300
           +
Sbjct: 301 N 301


>gi|332306506|ref|YP_004434357.1| malonyl CoA-acyl carrier protein transacylase [Glaciecola
           agarilytica 4H-3-7+YE-5]
 gi|332173835|gb|AEE23089.1| malonyl CoA-acyl carrier protein transacylase [Glaciecola
           agarilytica 4H-3-7+YE-5]
          Length = 309

 Score =  228 bits (580), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 128/303 (42%), Positives = 175/303 (57%), Gaps = 5/303 (1%)

Query: 7   FPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPALT 66
           FPGQGSQ +GM +DL  + P     F      L  +L D++ N S + L  T   QPAL 
Sbjct: 8   FPGQGSQTVGMLKDLAANHPLVEETFSRASKVLGYDLWDVVQNDSAQTLGQTQVTQPALL 67

Query: 67  AVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQEA 126
           A S A  +V++   + +     Y+AGHSLGEY+AL  A   S  D I+LV ARG+ MQ+A
Sbjct: 68  AASFAIFQVLKAQSVNMPH---YLAGHSLGEYSALVCAGVLSFEDGIKLVEARGQFMQQA 124

Query: 127 VPPGLGSMVAIIGLDDCVVDSICAQASR--VGICEIANDNGGGQVVISGLQDAVKCAADT 184
           VP G+G+M AIIGLDD  V   C QA      I    N N  GQ+VI+G   A   AA+ 
Sbjct: 125 VPEGVGAMYAIIGLDDAKVIHACEQAQNDTQQIVSAVNFNSPGQIVIAGNTAAADKAAEL 184

Query: 185 CLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSIDE 244
           C   GAKRA+ L VS P H +LM P +  +  M DSV+   P + ++ N   +  S+++ 
Sbjct: 185 CKEAGAKRALPLAVSVPSHCALMKPAADKLAVMFDSVSFNTPSIGVINNVDVAIESNVEN 244

Query: 245 ISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVED 304
           I   L+ Q+   VRW ET+Q  A+ GV  ++E+G GKVLTGL KRIDKSL+  +++  E 
Sbjct: 245 IKAALLRQLYSPVRWTETVQKLASLGVSQIHEIGPGKVLTGLIKRIDKSLNCEAVNSAET 304

Query: 305 IDL 307
           + +
Sbjct: 305 VSI 307


>gi|82702202|ref|YP_411768.1| malonyl CoA-acyl carrier protein transacylase [Nitrosospira
           multiformis ATCC 25196]
 gi|82410267|gb|ABB74376.1| [Acyl-carrier-protein] S-malonyltransferase [Nitrosospira
           multiformis ATCC 25196]
          Length = 316

 Score =  228 bits (580), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 131/297 (44%), Positives = 176/297 (59%), Gaps = 7/297 (2%)

Query: 7   FPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPALT 66
           FPGQGSQ IGM    YDSFP  R  F E    L  +L  ++ +G  E L  T N QP + 
Sbjct: 11  FPGQGSQSIGMMAG-YDSFPVVRQTFAEASDVLKLDLWGMVCDGPAETLNLTVNTQPLML 69

Query: 67  AVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQEA 126
              +A  R  +  G       S+VAGHSLGEYTAL A++A S +D + LVR R + MQ+A
Sbjct: 70  TAGVAIYRAWQTLGGVRP---SFVAGHSLGEYTALVASEALSFADALPLVRFRAEIMQQA 126

Query: 127 VPPGLGSMVAIIGLDDCVVDSIC---AQASRVGICEIANDNGGGQVVISGLQDAVKCAAD 183
           VP G+G+M AI+GLDD VV SIC    +AS     E AN N  GQVV++G ++AV    +
Sbjct: 127 VPEGVGAMAAILGLDDDVVRSICQEVTEASNGESLEPANFNSPGQVVVAGHKNAVVRGME 186

Query: 184 TCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSID 243
              +KGAKR V LP+S P H SLM P ++ M+  L  VT + P +P+L N        I+
Sbjct: 187 AARSKGAKRTVILPMSIPSHCSLMKPAAEKMRQQLAQVTLRSPKIPLLHNADVEQHEDIE 246

Query: 244 EISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
            I  +LV Q+   VRW E I++ +  G+  V E G GKVL+GL KRID +L +++++
Sbjct: 247 SIKEILVRQLFNPVRWTEIIRFISGAGIHHVVECGPGKVLSGLNKRIDANLQSLALT 303


>gi|260879497|ref|ZP_05891852.1| [acyl-carrier-protein] S-malonyltransferase [Vibrio
           parahaemolyticus AN-5034]
 gi|308093542|gb|EFO43237.1| [acyl-carrier-protein] S-malonyltransferase [Vibrio
           parahaemolyticus AN-5034]
          Length = 313

 Score =  228 bits (580), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 128/302 (42%), Positives = 178/302 (58%), Gaps = 3/302 (0%)

Query: 7   FPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPALT 66
            PGQGSQ +GM  DL + +   +  F E    L  +L  L+ NG  E+L  T   QPAL 
Sbjct: 14  IPGQGSQAVGMLADLGEQYDVVKQTFAEASDALGYDLWALVQNGPAEDLNQTFRTQPALL 73

Query: 67  AVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQEA 126
           A S+A  RV ++ GL      + +AGHSLGEY+AL  A      + I+LV  RGK MQEA
Sbjct: 74  ASSVAIWRVWQELGL---EQPANLAGHSLGEYSALVCAGVIDFKEAIKLVELRGKLMQEA 130

Query: 127 VPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAADTCL 186
           VP G G+M AIIGLDD V+   C +A++  +    N N  GQVVI+G +DAV+ A   C 
Sbjct: 131 VPAGTGAMYAIIGLDDDVIAKACEEAAQGDVVSPVNFNSPGQVVIAGSKDAVERAGALCK 190

Query: 187 NKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSIDEIS 246
             GAKRA+ LPVS P H +LM P +  +   L+S+    P +P++ N   +  +   +I 
Sbjct: 191 EAGAKRALPLPVSVPSHCALMKPAADKLAVALESIEFNTPQLPVINNVDVAAETDPAKIK 250

Query: 247 RLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVEDID 306
             LV Q+   VRW E++Q  +  GV+++ E+G GKVLTGL KRI K+LSA +++ V  ++
Sbjct: 251 DALVRQLYSPVRWTESVQLMSEQGVENLLELGPGKVLTGLTKRIVKTLSAAAVNDVASLE 310

Query: 307 LA 308
            A
Sbjct: 311 AA 312


>gi|255523977|ref|ZP_05390939.1| malonyl CoA-acyl carrier protein transacylase [Clostridium
           carboxidivorans P7]
 gi|296186838|ref|ZP_06855239.1| malonyl CoA-acyl carrier protein transacylase [Clostridium
           carboxidivorans P7]
 gi|255512264|gb|EET88542.1| malonyl CoA-acyl carrier protein transacylase [Clostridium
           carboxidivorans P7]
 gi|296048552|gb|EFG87985.1| malonyl CoA-acyl carrier protein transacylase [Clostridium
           carboxidivorans P7]
          Length = 313

 Score =  227 bits (579), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 116/313 (37%), Positives = 190/313 (60%), Gaps = 5/313 (1%)

Query: 1   MSTV-LTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATC 59
           MS V   F GQG+Q +GMG++LYD+F   + +F   D  L  ++S + + G +EEL  T 
Sbjct: 1   MSKVAFLFSGQGAQYVGMGKELYDNFDVCKNIFNNADEALGFSISSMCFEGPEEELNKTE 60

Query: 60  NAQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRAR 119
           N QPA+   S+A +R+++ NG  +K D++  AG SLGEY+AL A+     ++ + LV+ R
Sbjct: 61  NTQPAILTTSIAALRILQSNG--IKADVT--AGLSLGEYSALVASGVLEFTEAVSLVKKR 116

Query: 120 GKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVK 179
           GK MQEAVP G+G+M AIIGLD+  +  +C     +GI EIAN N  GQVVI+G    ++
Sbjct: 117 GKYMQEAVPEGVGAMAAIIGLDEDNIRKVCDDCKSIGIVEIANLNCPGQVVIAGEAKPLE 176

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            A +     GA++A+ L VS PFH+S++ P ++ ++  L  V+  +  +P++ N     V
Sbjct: 177 IACEKLKEAGARKAIMLSVSGPFHTSMLKPAAEKLEKELQDVSIGNFSIPVITNVTGEVV 236

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
            + DE+   L +QV   V + ++I+   + GV +  E+G GKVL+G  K+ID+  + +++
Sbjct: 237 DNKDEVKGYLKKQVMSTVFFEKSIRRMIDMGVDTFIEIGPGKVLSGFVKKIDRKATILNV 296

Query: 300 SKVEDIDLALRSI 312
             V+ ++  +  +
Sbjct: 297 QDVKSLESTIEKL 309


>gi|241662593|ref|YP_002980953.1| cyclic nucleotide-binding protein [Ralstonia pickettii 12D]
 gi|309781175|ref|ZP_07675912.1| malonyl CoA-acyl carrier protein transacylase [Ralstonia sp.
           5_7_47FAA]
 gi|240864620|gb|ACS62281.1| cyclic nucleotide-binding protein [Ralstonia pickettii 12D]
 gi|308919996|gb|EFP65656.1| malonyl CoA-acyl carrier protein transacylase [Ralstonia sp.
           5_7_47FAA]
          Length = 309

 Score =  227 bits (579), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 129/294 (43%), Positives = 165/294 (56%), Gaps = 4/294 (1%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M+    FPGQGSQ +GM  + +   P       E    L Q++  L+  G  EEL  T N
Sbjct: 1   MTFAFVFPGQGSQSVGM-LNAFADHPAVAATLAEASDALGQDIGKLIAEGPAEELNLTTN 59

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
            QP +   ++A  R  +  G       + VAGHSLGEY+AL AA A +  D + LVR R 
Sbjct: 60  TQPVMLTAAVAVYRAWQAAGGPTP---TVVAGHSLGEYSALVAAGAIAFKDAVPLVRFRA 116

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           K+MQEAVP G G M AI+GL D  V + CA+AS  G+ E  N N   QVVI+G + AV+ 
Sbjct: 117 KAMQEAVPVGEGGMAAILGLSDDDVRAACAEASVAGVVEAVNFNAPAQVVIAGAKAAVEK 176

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A +    KGAKRA+ LPVSAPFHSSL+ P S  ++  L +VT   PV+P++ N   + VS
Sbjct: 177 ACEIAKAKGAKRALPLPVSAPFHSSLLKPASDRLREYLANVTVNAPVIPVINNVDVAVVS 236

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSL 294
               I   LV Q    VRW ET+Q     G+  V E G GKVL GL KRID  +
Sbjct: 237 DPAAIKDALVRQAASPVRWVETVQKMKGDGITRVVECGPGKVLAGLVKRIDGEI 290


>gi|329121265|ref|ZP_08249892.1| malonyl-CoA-[acyl-carrier-protein] transacylase [Dialister
           micraerophilus DSM 19965]
 gi|327470199|gb|EGF15662.1| malonyl-CoA-[acyl-carrier-protein] transacylase [Dialister
           micraerophilus DSM 19965]
          Length = 316

 Score =  227 bits (579), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 126/307 (41%), Positives = 179/307 (58%), Gaps = 5/307 (1%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           ++T   FPGQGSQ +GM RDLY+ +   + + +E D TL   +S LM+ G +E L  T  
Sbjct: 4   LTTAFLFPGQGSQKVGMIRDLYEKYDSVKNIVKEADETLGFPISKLMFEGPEETLMKTEF 63

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
            QPA+   S+A  +V+ +NG+    D   VAGHSLGEY+AL AA A S +D +  V  RG
Sbjct: 64  TQPAILTASVACWKVLFENGV----DPCVVAGHSLGEYSALVAADAMSFADAVHTVNLRG 119

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASR-VGICEIANDNGGGQVVISGLQDAVK 179
           K MQEAVP G G+M A+IG+    V+ IC   S      +  N N  GQVVI+G+  +V+
Sbjct: 120 KFMQEAVPLGQGAMAAVIGMKAETVEEICETISTDEEPLQAVNYNCPGQVVIAGVTSSVE 179

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            A      KGAKRA+ L VS PFHS LM P +  +K +LD +  +D  +PI+ N  A+  
Sbjct: 180 KACKVFKEKGAKRALMLKVSGPFHSILMKPAALKLKEVLDKIEIKDSFIPIVANVNANVE 239

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
           +S +EI   L+ Q    VRW ++I++   +GV    E G G VL+G  +RIDK++     
Sbjct: 240 NSAEEIRENLINQTFNPVRWEDSIRFMLENGVTKFVECGPGTVLSGFMRRIDKTVFNCHA 299

Query: 300 SKVEDID 306
             +E ++
Sbjct: 300 ENIETVN 306


>gi|157154947|ref|YP_001462324.1| malonyl CoA-acyl carrier protein transacylase [Escherichia coli
           E24377A]
 gi|157076977|gb|ABV16685.1| malonyl CoA-acyl carrier protein transacylase [Escherichia coli
           E24377A]
          Length = 309

 Score =  227 bits (579), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 127/306 (41%), Positives = 174/306 (56%), Gaps = 3/306 (0%)

Query: 5   LTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPA 64
             FPGQGSQ +GM  D+  S+P     F E    L  +L  L   G  EEL  T   QPA
Sbjct: 6   FVFPGQGSQTVGMLADMAASYPIVEETFAEASAALGYDLWALTQQGPAEELNKTWQTQPA 65

Query: 65  LTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQ 124
           L   S+A  RV ++ G    +  + +AGHSLGEY+AL  A     +D +RLV  RGK MQ
Sbjct: 66  LLTASVALYRVWQQQG---GKAPAMMAGHSLGEYSALVCAGVIDFADAVRLVEMRGKFMQ 122

Query: 125 EAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAADT 184
           EAVP G G+M AIIGLDD  +   C +A+   +    N N  GQVVI+G ++AV+ A   
Sbjct: 123 EAVPEGTGAMAAIIGLDDASIAKACEEAAEGQVVSPVNFNSPGQVVIAGHKEAVERAGAA 182

Query: 185 CLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSIDE 244
           C   GAKRA+ LPVS P H +LM P +  +   L  +T   P VP++ N      ++ D 
Sbjct: 183 CKAVGAKRALPLPVSVPSHCALMKPAADKLAVELAKITFNAPTVPVVNNVDVKCETNGDA 242

Query: 245 ISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVED 304
           I   LV Q+   V+W +++++ A  GV+ +YEVG GKVLTGL KRI  +L+A ++++   
Sbjct: 243 IRDALVRQLYNPVQWTKSVEYMAAQGVEHLYEVGPGKVLTGLTKRIVDTLTASALNEPSA 302

Query: 305 IDLALR 310
           +  AL 
Sbjct: 303 MAAALE 308


>gi|209695676|ref|YP_002263605.1| malonyl CoA-acyl carrier protein transacylase [Aliivibrio
           salmonicida LFI1238]
 gi|208009628|emb|CAQ79924.1| malonyl CoA-acyl carrier protein transacylase [Aliivibrio
           salmonicida LFI1238]
          Length = 307

 Score =  227 bits (579), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 129/304 (42%), Positives = 176/304 (57%), Gaps = 3/304 (0%)

Query: 5   LTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPA 64
           + FPGQGSQ +GM  +L +        F E    L  +L  L+ NG  E+L  T   QPA
Sbjct: 6   IVFPGQGSQAVGMLAELGEQHEVVTQTFAEASEALGYDLWSLVQNGPAEDLNQTFRTQPA 65

Query: 65  LTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQ 124
           L A S+A  RV ++ GL      S +AGHSLGEY+AL  A      + I+LV  RG+ MQ
Sbjct: 66  LLATSVALWRVWQEQGLA---QPSVLAGHSLGEYSALVCAGVIDFKEAIKLVELRGQLMQ 122

Query: 125 EAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAADT 184
           EAVP G+G+M AIIGLD+  +   C  A++  +    N N  GQVVI+G +DAV+ A   
Sbjct: 123 EAVPAGVGAMFAIIGLDNDSIAKACEDAAQDEVVSPVNFNSPGQVVIAGNKDAVERAGVL 182

Query: 185 CLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSIDE 244
           C   GAKRA+ LPVS P H +LM P +  +   L+S+    PV+P++ N      +  ++
Sbjct: 183 CKEAGAKRALPLPVSVPSHCALMKPAADKLAVALESIEFSTPVLPVINNVDVIAETDPEK 242

Query: 245 ISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVED 304
           I   LV Q+   VRW E ++  A  GV+ +YEVG GKVLTGL KRI KSLSA +++    
Sbjct: 243 IKDALVRQLYCPVRWTEVVEQMAEQGVEMLYEVGPGKVLTGLTKRIVKSLSAAAVNDAAS 302

Query: 305 IDLA 308
           ++ A
Sbjct: 303 LEAA 306


>gi|91762168|ref|ZP_01264133.1| [acyl-carrier-protein] S-malonyltransferase [Candidatus
           Pelagibacter ubique HTCC1002]
 gi|91717970|gb|EAS84620.1| [acyl-carrier-protein] S-malonyltransferase [Candidatus
           Pelagibacter ubique HTCC1002]
          Length = 310

 Score =  227 bits (579), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 121/302 (40%), Positives = 184/302 (60%), Gaps = 3/302 (0%)

Query: 7   FPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPALT 66
           FPGQGSQ++GMG+DL+  +   + +F+E D TL  +LS+L+ NG +EEL  T N QPA+ 
Sbjct: 6   FPGQGSQLVGMGKDLHAKYSLVQDLFKEADDTLGFSLSNLILNGPKEELDLTENTQPAIF 65

Query: 67  AVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQEA 126
            +S +  R++++          + AGHSLGEYTAL AA++   SDT+++++ RG +MQ +
Sbjct: 66  LLSYSIFRLIKEEFKIDLDKAKFYAGHSLGEYTALTAAESLLFSDTLKILKIRGSAMQNS 125

Query: 127 VPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISG-LQDAVKCAADTC 185
           VP G+G MVA++G +  ++  I  +      C IANDN  GQ+V+SG ++D  K   D  
Sbjct: 126 VPKGVGGMVAVLGSEIEIIKKIIDENKDKYECFIANDNSVGQIVLSGKIEDLEKIMVD-- 183

Query: 186 LNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSIDEI 245
           L     + + LPVSAPFH  LM   + VMK  +  +   +P   ++ N     +S+ +E+
Sbjct: 184 LKASNIKNIKLPVSAPFHCKLMNNATLVMKEEIAKLNFNEPKNILISNVTGKEISNSNEL 243

Query: 246 SRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVEDI 305
             LLV+Q+   VRWRE++      GV    E+G GKVL+GL KRI+K++   +I+  EDI
Sbjct: 244 KELLVKQIESSVRWRESVLLMIEKGVTEFIEIGPGKVLSGLIKRINKNVKVSAINSEEDI 303

Query: 306 DL 307
            L
Sbjct: 304 KL 305


>gi|269962041|ref|ZP_06176395.1| acyl carrier protein S-malonyltransferase [Vibrio harveyi 1DA3]
 gi|269833125|gb|EEZ87230.1| acyl carrier protein S-malonyltransferase [Vibrio harveyi 1DA3]
          Length = 307

 Score =  227 bits (579), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 127/304 (41%), Positives = 179/304 (58%), Gaps = 3/304 (0%)

Query: 5   LTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPA 64
           + FPGQGSQ +GM  DL + +   +  F E    L  +L  L+ NG  E+L  T   QPA
Sbjct: 6   IVFPGQGSQAVGMLADLGEQYDVVKQTFAEASDALGYDLWALVQNGPAEDLNQTFRTQPA 65

Query: 65  LTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQ 124
           L A S+A  RV ++ GL      + +AGHSLGEY+AL  A      + I+LV  RG+ MQ
Sbjct: 66  LLASSVAIWRVWQELGL---EQPANLAGHSLGEYSALVCAGVIDFKEAIKLVELRGQLMQ 122

Query: 125 EAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAADT 184
           EAVP G G+M AIIGLDD  +   C  A++  +    N N  GQVVI+G +DAV+ A   
Sbjct: 123 EAVPAGTGAMYAIIGLDDEAIAKACEDAAQGEVVSPVNFNSPGQVVIAGSKDAVERAGAL 182

Query: 185 CLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSIDE 244
           C   GAKRA+ LPVS P H +LM P ++ +   L+S+    P +P++ N   +  +   +
Sbjct: 183 CKEAGAKRALPLPVSVPSHCALMKPAAEKLAVALESIEFNTPQLPVVNNVDVAAETDPAK 242

Query: 245 ISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVED 304
           I   LV Q+   VRW E++Q  +  GV+++ E+G GKVLTGL KRI K+LSA +++ V  
Sbjct: 243 IKDALVRQLHSPVRWTESVQLMSEQGVENLLELGPGKVLTGLTKRIVKTLSAAAVNDVAS 302

Query: 305 IDLA 308
           ++ A
Sbjct: 303 LEAA 306


>gi|16800988|ref|NP_471256.1| acyl-carrier-protein S-malonyltransferase [Listeria innocua
           Clip11262]
 gi|16414423|emb|CAC97152.1| fabD [Listeria innocua Clip11262]
          Length = 313

 Score =  227 bits (579), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 122/302 (40%), Positives = 181/302 (59%), Gaps = 5/302 (1%)

Query: 5   LTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPA 64
             FPGQG+Q IGMG+D+   +PEA+ ++++ D  L  +++D++  G  E LT + NAQPA
Sbjct: 6   FVFPGQGAQKIGMGQDVAAEYPEAKKIYDDADERLGFSITDVITEGPIELLTKSENAQPA 65

Query: 65  LTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQ 124
           L + S+A +R +E  G  VK D  YVAGHSLGEY+AL A      SD I LVR RG+ M+
Sbjct: 66  LVSTSVAILRALETYG--VKAD--YVAGHSLGEYSALVAGGFLEASDAIYLVRKRGELME 121

Query: 125 EAVPPGLGSMVAIIGLDDCVVDSICAQASRVG-ICEIANDNGGGQVVISGLQDAVKCAAD 183
            AVP G G+M A++G+D   +  +  + +  G   ++AN N  GQ+VISG    V+ A +
Sbjct: 122 AAVPNGAGAMAAVLGVDRETLKKVTEEVTAEGDAVQLANLNCPGQIVISGTTAGVEKAGE 181

Query: 184 TCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSID 243
                GAKR + L VS PFHSSLM P +   + +L  V   D  +P++ N  A   +   
Sbjct: 182 KAKENGAKRVLPLAVSGPFHSSLMEPAALAFRDILAEVKISDGQIPVVNNVDAKETTDKS 241

Query: 244 EISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVE 303
           EIS  L++Q+   V W + ++    +GV +  E+GSGKVL GL K+I++ ++ +S   VE
Sbjct: 242 EISDKLIKQIYSPVLWEDIVEELIKNGVDTFVEIGSGKVLAGLIKKINRDVTVLSAGDVE 301

Query: 304 DI 305
            +
Sbjct: 302 SV 303


>gi|217964039|ref|YP_002349717.1| malonyl CoA-acyl carrier protein transacylase [Listeria
           monocytogenes HCC23]
 gi|226224411|ref|YP_002758518.1| malonyl CoA-acyl carrier protein transacylase [Listeria
           monocytogenes Clip81459]
 gi|254852716|ref|ZP_05242064.1| malonyl CoA-acyl carrier protein transacylase [Listeria
           monocytogenes FSL R2-503]
 gi|254933280|ref|ZP_05266639.1| malonyl CoA-acyl carrier protein transacylase [Listeria
           monocytogenes HPB2262]
 gi|254993545|ref|ZP_05275735.1| malonyl CoA-acyl carrier protein transacylase [Listeria
           monocytogenes FSL J2-064]
 gi|290893062|ref|ZP_06556051.1| malonyl CoA-acyl carrier protein transacylase [Listeria
           monocytogenes FSL J2-071]
 gi|300763879|ref|ZP_07073876.1| malonyl CoA-acyl carrier protein transacylase [Listeria
           monocytogenes FSL N1-017]
 gi|217333309|gb|ACK39103.1| malonyl CoA-acyl carrier protein transacylase [Listeria
           monocytogenes HCC23]
 gi|225876873|emb|CAS05582.1| Putative malonyl CoA-acyl carrier protein transacylase [Listeria
           monocytogenes serotype 4b str. CLIP 80459]
 gi|258606037|gb|EEW18645.1| malonyl CoA-acyl carrier protein transacylase [Listeria
           monocytogenes FSL R2-503]
 gi|290557422|gb|EFD90947.1| malonyl CoA-acyl carrier protein transacylase [Listeria
           monocytogenes FSL J2-071]
 gi|293584840|gb|EFF96872.1| malonyl CoA-acyl carrier protein transacylase [Listeria
           monocytogenes HPB2262]
 gi|300515615|gb|EFK42665.1| malonyl CoA-acyl carrier protein transacylase [Listeria
           monocytogenes FSL N1-017]
 gi|307571390|emb|CAR84569.1| malonyl CoA-acyl carrier protein transacylase [Listeria
           monocytogenes L99]
 gi|332312249|gb|EGJ25344.1| Malonyl CoA-acyl carrier protein transacylase [Listeria
           monocytogenes str. Scott A]
          Length = 313

 Score =  227 bits (578), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 121/302 (40%), Positives = 182/302 (60%), Gaps = 5/302 (1%)

Query: 5   LTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPA 64
             FPGQG+Q IGMG+D+   +PEA+ ++++ D  L  ++++++  G  E LT + NAQPA
Sbjct: 6   FVFPGQGAQKIGMGQDVAAEYPEAKKIYDDADERLGFSITEIITEGPIELLTKSENAQPA 65

Query: 65  LTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQ 124
           L + S+A +R +E  G  VK D  YVAGHSLGEY+AL A      SD I LVR RG+ M+
Sbjct: 66  LVSTSVAILRALETYG--VKAD--YVAGHSLGEYSALVAGGFLEASDAIYLVRKRGELME 121

Query: 125 EAVPPGLGSMVAIIGLDDCVVDSICAQASRVG-ICEIANDNGGGQVVISGLQDAVKCAAD 183
            AVP G G+M A++G+D   + +I  + ++ G   ++AN N  GQ+VISG    V+ A +
Sbjct: 122 AAVPNGAGAMAAVLGVDRETLKTITEEVTKEGDAVQLANLNCPGQIVISGTTAGVEKAGE 181

Query: 184 TCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSID 243
                GAKR + L VS PFHSSLM P +   + +L  V   D  +P++ N  A   +   
Sbjct: 182 KAKESGAKRVLPLAVSGPFHSSLMEPAALAFRDVLAEVKISDGQIPVVNNVDAKETTDKS 241

Query: 244 EISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVE 303
           EIS  L++Q+   V W + ++    +GV +  E+GSGKVL GL K+I++ ++ +S    E
Sbjct: 242 EISDKLIKQIYSPVLWEDIVEELIKNGVDTFVEIGSGKVLAGLIKKINRDVTVLSAGDAE 301

Query: 304 DI 305
            +
Sbjct: 302 SV 303


>gi|301154891|emb|CBW14354.1| malonyl-CoA-[acyl-carrier-protein] transacylase [Haemophilus
           parainfluenzae T3T1]
          Length = 312

 Score =  227 bits (578), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 125/302 (41%), Positives = 172/302 (56%), Gaps = 2/302 (0%)

Query: 5   LTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPA 64
           + FPGQGSQ +GM  DL + +P     F++    L  +L +L+  G  EEL  T   QPA
Sbjct: 6   MVFPGQGSQAVGMLADLANEYPVVTETFKQASEALGYDLWNLVQQGPAEELNKTWQTQPA 65

Query: 65  LTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQ 124
           L A S+A  RV ++     +   S +AGHSLGEY+AL  A      D I+LV  RGK MQ
Sbjct: 66  LLAASVAIFRVWQEK--YPQLQPSVMAGHSLGEYSALVCAGVIDFKDAIKLVELRGKLMQ 123

Query: 125 EAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAADT 184
           +AVP G G+M AIIGLD+  + + C QA +  +    N N  GQVVI+G ++AV+ AA  
Sbjct: 124 QAVPEGTGAMYAIIGLDNEAIINACKQAEQGEVVSAVNFNSPGQVVIAGAKEAVERAATL 183

Query: 185 CLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSIDE 244
           C   GAKRA+ L VS P H +LM P ++ +   L+ +T   P  P+L N      +   E
Sbjct: 184 CKEAGAKRALPLAVSVPSHCALMKPAAEQLAVTLEGITLNAPATPVLNNVDVKAETESAE 243

Query: 245 ISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVED 304
           I   L+ Q+   VRW ET++  A  GV+ + E+G GKVL GL KRI   L A S++ V  
Sbjct: 244 IRTALIRQLYSPVRWTETVEKMAQDGVEVLVEIGPGKVLNGLTKRIVAELQATSVNDVAS 303

Query: 305 ID 306
           ++
Sbjct: 304 LN 305


>gi|331268236|ref|YP_004394728.1| malonyl CoA-acyl carrier protein transacylase [Clostridium
           botulinum BKT015925]
 gi|329124786|gb|AEB74731.1| malonyl CoA-acyl carrier protein transacylase [Clostridium
           botulinum BKT015925]
          Length = 314

 Score =  227 bits (578), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 116/310 (37%), Positives = 186/310 (60%), Gaps = 4/310 (1%)

Query: 5   LTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPA 64
             F GQG+Q +GMG++LYD+  E + VF + D  L  ++S++ + GS+EEL  T N QPA
Sbjct: 6   FIFSGQGAQYVGMGKELYDNMEECKEVFLKADKALGFSISNICFEGSKEELDRTENTQPA 65

Query: 65  LTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQ 124
           +   S+A ++ ++K+G  +K D+  VAG SLGEY+AL  +  F+  D +R+V+ RGK MQ
Sbjct: 66  ILTTSIAALKALDKSG--IKADV--VAGLSLGEYSALVCSGVFNFEDAVRVVKKRGKFMQ 121

Query: 125 EAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAADT 184
           E VP G+G+M AIIGLD   V   C +    GI E+AN N   Q+VI+G  +AV  A ++
Sbjct: 122 EEVPEGVGTMAAIIGLDREKVSKACEECREYGIVEVANYNCSSQIVIAGEINAVDKACES 181

Query: 185 CLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSIDE 244
               GAKR + L VSAPFH+S++    + +   L  VT  D  VPI+ N   + ++ I++
Sbjct: 182 AKELGAKRVIKLSVSAPFHTSMLKGAGEKLYKELQDVTLNDIKVPIMTNVTGNYITDIND 241

Query: 245 ISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVED 304
           +  +L  QV   V W + ++   + GV +  E+G GK L+G  K+I++ +  +++  +  
Sbjct: 242 VKDILRRQVMSSVLWEDIVKNMISDGVDTFIEIGPGKALSGFVKKINRKVKVLNVEDLTS 301

Query: 305 IDLALRSIVG 314
           ++  +  + G
Sbjct: 302 LNKTIDELKG 311


>gi|27366282|ref|NP_761810.1| malonyl CoA-acyl carrier protein transacylase [Vibrio vulnificus
           CMCP6]
 gi|320156789|ref|YP_004189168.1| malonyl CoA-acyl carrier protein transacylase [Vibrio vulnificus
           MO6-24/O]
 gi|27362483|gb|AAO11337.1| malonyl CoA-acyl carrier protein transacylase [Vibrio vulnificus
           CMCP6]
 gi|319932101|gb|ADV86965.1| malonyl CoA-acyl carrier protein transacylase [Vibrio vulnificus
           MO6-24/O]
          Length = 307

 Score =  227 bits (578), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 125/302 (41%), Positives = 178/302 (58%), Gaps = 3/302 (0%)

Query: 5   LTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPA 64
           + FPGQGSQ +GM  DL + +   +  F +    L  +L  L+ NG  E+L  T   QPA
Sbjct: 6   IVFPGQGSQAVGMLADLGEQYEIVKQTFAQASEALGYDLWALVQNGPAEDLNQTFRTQPA 65

Query: 65  LTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQ 124
           L A S+A  RV ++ GL    ++   AGHSLGEY+AL  A      + I+LV  RG+ MQ
Sbjct: 66  LLASSVAIWRVWQELGLAQPENL---AGHSLGEYSALVCAGVIDFQEAIKLVELRGQLMQ 122

Query: 125 EAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAADT 184
           EAVP G G+M AIIGLDD  +   C +A++  +    N N  GQVVI+G +DAV+ A   
Sbjct: 123 EAVPAGTGAMYAIIGLDDEAIAKACEEAAQGEVVSPVNFNSPGQVVIAGSKDAVERAGAL 182

Query: 185 CLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSIDE 244
           C   GAKRA+ LPVS P H +LM P ++ +   L+S+  + P +P++ N      +   +
Sbjct: 183 CKEAGAKRALPLPVSVPSHCALMKPAAEKLAVALESIEFKAPQLPVINNVDVVAETDPAK 242

Query: 245 ISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVED 304
           I   LV Q+   VRW E+++  ++ GV+ + E+G GKVLTGL KRI KSL A +++ V  
Sbjct: 243 IKDALVRQLYSPVRWTESVELMSSQGVEKLLEMGPGKVLTGLTKRIVKSLEAAAVNDVAS 302

Query: 305 ID 306
           +D
Sbjct: 303 LD 304


>gi|225180929|ref|ZP_03734377.1| malonyl CoA-acyl carrier protein transacylase [Dethiobacter
           alkaliphilus AHT 1]
 gi|225168410|gb|EEG77213.1| malonyl CoA-acyl carrier protein transacylase [Dethiobacter
           alkaliphilus AHT 1]
          Length = 311

 Score =  227 bits (578), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 124/310 (40%), Positives = 188/310 (60%), Gaps = 4/310 (1%)

Query: 5   LTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPA 64
             FPGQG+Q +GMG+++ ++F  AR VFE+ D  L  NLS+ ++NGS +EL  T   QPA
Sbjct: 6   FIFPGQGAQHVGMGQEMAENFSAARQVFEQADDILGMNLSEKVFNGSDDELRLTEITQPA 65

Query: 65  LTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQ 124
           + A S+A + V+ ++G+        VAG SLGEY+AL AA+A S +D + +V+ RG+ MQ
Sbjct: 66  IVATSIACLEVLRQHGV----QAHGVAGLSLGEYSALVAAEAMSFADALPVVQKRGRYMQ 121

Query: 125 EAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAADT 184
           EAVPPG+G M AI+GL    V   C QAS +G+ E AN N   Q+VI+G   A++ A + 
Sbjct: 122 EAVPPGVGGMSAILGLAREKVHEACRQASAIGVIEPANYNTPDQIVIAGEIAAMRKACEV 181

Query: 185 CLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSIDE 244
               GAKR V LPVS  FH SL+  V  ++   L  +      +P++ N  A  V+S++E
Sbjct: 182 AKELGAKRIVELPVSVSFHCSLLKNVEPLLAGELAQIELSPAKIPVMANISADYVNSVEE 241

Query: 245 ISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVED 304
           +   LV QV+  + W+++I+     G  +  EVG GK LTG+ K+I++ + A  +  V+ 
Sbjct: 242 MRDSLVRQVSNAILWQDSIEKMIADGYDTFVEVGPGKSLTGMMKKINRDVWAHQVENVKT 301

Query: 305 IDLALRSIVG 314
           ++  + +I G
Sbjct: 302 LEKVVEAING 311


>gi|255659794|ref|ZP_05405203.1| malonyl CoA-acyl carrier protein transacylase [Mitsuokella
           multacida DSM 20544]
 gi|260847865|gb|EEX67872.1| malonyl CoA-acyl carrier protein transacylase [Mitsuokella
           multacida DSM 20544]
          Length = 314

 Score =  226 bits (577), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 119/306 (38%), Positives = 176/306 (57%), Gaps = 5/306 (1%)

Query: 5   LTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPA 64
             FPGQG+Q +GMG+DL++ +  A+ +F E D  L  ++ D+ + G  ++L  T N QPA
Sbjct: 6   FVFPGQGAQAVGMGKDLFEQYDVAKRLFAEADEALGYSIKDMCFEGPADDLKLTANTQPA 65

Query: 65  LTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQ 124
           +  VS+    +++++G  V+ D++   GHSLGEY+AL AA   S  D + LV  RG+ MQ
Sbjct: 66  ILTVSVIVNEILKEHG--VQPDVA--GGHSLGEYSALVAAGVLSFKDAVALVHKRGQYMQ 121

Query: 125 EAVPPGLGSMVAIIGLDDCVVDSICAQASR-VGICEIANDNGGGQVVISGLQDAVKCAAD 183
           EAVP G G M AIIGLDD  + + C +A++  G  +  N N  GQ VI+G    V+ A +
Sbjct: 122 EAVPVGEGGMAAIIGLDDEAIAAACEKATKEAGEVQPVNFNCPGQTVIAGTTHGVEKAVE 181

Query: 184 TCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSID 243
                GAK+AV LPVSAPFHS+LM P ++ +   LD V   D   P++ NF     +  +
Sbjct: 182 ELKAAGAKKAVVLPVSAPFHSTLMKPAAEKLAAELDKVAIHDAAFPVVSNFTGELETKAE 241

Query: 244 EISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVE 303
           EI   LV Q    VRW   ++     G  +  E G GK L G  +RID+S+ ++++  +E
Sbjct: 242 EIKANLVAQADHPVRWIACVKTMQAFGADTFVEAGPGKTLCGFNRRIDRSIKSLNVENLE 301

Query: 304 DIDLAL 309
            +   L
Sbjct: 302 SLQKTL 307


>gi|167825172|ref|ZP_02456643.1| malonyl CoA-acyl carrier protein transacylase [Burkholderia
           pseudomallei 9]
 gi|167911891|ref|ZP_02498982.1| malonyl CoA-acyl carrier protein transacylase [Burkholderia
           pseudomallei 112]
 gi|226199988|ref|ZP_03795538.1| malonyl CoA-acyl carrier protein transacylase [Burkholderia
           pseudomallei Pakistan 9]
 gi|254191233|ref|ZP_04897737.1| malonyl CoA-acyl carrier protein transacylase [Burkholderia
           pseudomallei Pasteur 52237]
 gi|157938905|gb|EDO94575.1| malonyl CoA-acyl carrier protein transacylase [Burkholderia
           pseudomallei Pasteur 52237]
 gi|225928044|gb|EEH24081.1| malonyl CoA-acyl carrier protein transacylase [Burkholderia
           pseudomallei Pakistan 9]
          Length = 310

 Score =  226 bits (577), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 132/313 (42%), Positives = 176/313 (56%), Gaps = 10/313 (3%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHT---LNQNLSDLMWNGSQEELTA 57
           M     FPGQGSQ +GM     ++F +  +V E +D     L Q++  L+ +G  +EL  
Sbjct: 1   MKFAFVFPGQGSQSVGM----LNAFADVAVVRETLDEASDALGQDIGKLIADGPADELNL 56

Query: 58  TCNAQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVR 117
           T N QP +   + A  R  ++ G       S VAGHSLGEYTAL AA A +  D + LVR
Sbjct: 57  TTNTQPVMLTAAYACYRAWQQAG---GAQPSIVAGHSLGEYTALVAAGAIAFRDALPLVR 113

Query: 118 ARGKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDA 177
            R ++MQ AVP G+G M AI+GLDD  V ++CA+AS  G+ E  N N   QVVI+G +  
Sbjct: 114 FRAQAMQTAVPVGVGGMAAILGLDDDTVRAVCAEASATGVVEAVNFNAPAQVVIAGTKAG 173

Query: 178 VKCAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCAS 237
           ++ A +    KGAKRA+ LPVSAPFHSSL+ P S  ++  L  V  + P + ++ N   +
Sbjct: 174 IEKACEIAKEKGAKRALPLPVSAPFHSSLLKPASDKLREYLAGVDVKAPKISVVNNIDVA 233

Query: 238 PVSSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAV 297
            VS    I   LV Q  G VRW E +Q  A  GV  V E G GKVL  L KRID +L   
Sbjct: 234 VVSDPAAIKDALVRQAAGPVRWVECVQHIAREGVTHVIECGPGKVLASLTKRIDGNLVGA 293

Query: 298 SISKVEDIDLALR 310
           S+     +D AL+
Sbjct: 294 SVFDPASLDEALK 306


>gi|284802254|ref|YP_003414119.1| acyl-carrier-protein S-malonyltransferase [Listeria monocytogenes
           08-5578]
 gi|284995396|ref|YP_003417164.1| acyl-carrier-protein S-malonyltransferase [Listeria monocytogenes
           08-5923]
 gi|284057816|gb|ADB68757.1| acyl-carrier-protein S-malonyltransferase [Listeria monocytogenes
           08-5578]
 gi|284060863|gb|ADB71802.1| acyl-carrier-protein S-malonyltransferase [Listeria monocytogenes
           08-5923]
          Length = 313

 Score =  226 bits (577), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 121/302 (40%), Positives = 182/302 (60%), Gaps = 5/302 (1%)

Query: 5   LTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPA 64
             FPGQG+Q IGMG+D+   +PEA+ ++++ D  L  ++++++  G  E LT + NAQPA
Sbjct: 6   FVFPGQGAQKIGMGQDVAAEYPEAKKIYDDADERLGFSITEIITEGPIELLTKSENAQPA 65

Query: 65  LTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQ 124
           L + S+A +R +E  G  VK D  YVAGHSLGEY+AL A      SD I LVR RG+ M+
Sbjct: 66  LVSTSVAILRALETYG--VKAD--YVAGHSLGEYSALVAGGFLEASDAIYLVRKRGELME 121

Query: 125 EAVPPGLGSMVAIIGLDDCVVDSICAQASRVG-ICEIANDNGGGQVVISGLQDAVKCAAD 183
            AVP G G+M A++G+D   + +I  + ++ G   ++AN N  GQ+VISG    V+ A +
Sbjct: 122 AAVPNGAGAMAAVLGVDRETLKTITEEVTKEGDAVQLANLNCPGQIVISGTTAGVEKAGE 181

Query: 184 TCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSID 243
                GAKR + L VS PFHSSLM P +   + +L  V   D  +P++ N  A   +   
Sbjct: 182 KAKESGAKRVLPLAVSGPFHSSLMEPAALAFREILAEVEISDGNIPVVNNVDAKQTTDKA 241

Query: 244 EISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVE 303
           EIS  L++Q+   V W + ++    +GV +  E+GSGKVL GL K+I++ ++ +S    E
Sbjct: 242 EISDKLIKQIYSPVLWEDIVEELIKNGVDTFVEIGSGKVLAGLIKKINRDVTVLSAGDAE 301

Query: 304 DI 305
            +
Sbjct: 302 SV 303


>gi|323142419|ref|ZP_08077245.1| [acyl-carrier-protein] S-malonyltransferase [Phascolarctobacterium
           sp. YIT 12067]
 gi|322413112|gb|EFY04005.1| [acyl-carrier-protein] S-malonyltransferase [Phascolarctobacterium
           sp. YIT 12067]
          Length = 313

 Score =  226 bits (577), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 127/310 (40%), Positives = 178/310 (57%), Gaps = 6/310 (1%)

Query: 5   LTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPA 64
             FPGQGSQ +GM +  YD +P  + +FEE D  L  ++S + + G  E+L  T N QPA
Sbjct: 6   FVFPGQGSQTVGMCKAFYDEYPVVKQIFEEADDALGYSISKMCFEGPAEDLKLTANTQPA 65

Query: 65  LTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQ 124
           +   S A   V++++G  V  DI+  AGHSLGEY+AL    A   +D +R+V  RG+ MQ
Sbjct: 66  ILTASTACAAVLKEHG--VSCDIA--AGHSLGEYSALVNTGALKFADAVRIVNKRGQFMQ 121

Query: 125 EAVPPGLGSMVAIIGLDDCVVDSIC--AQASRVGICEIANDNGGGQVVISGLQDAVKCAA 182
           EAVP G GSM AI+GLD   +  IC   +A      +  N N  GQVVI+G  + V  A 
Sbjct: 122 EAVPVGEGSMAAILGLDSDKIVEICRSVEAESGEAVQAVNFNCPGQVVIAGAVNPVNKAI 181

Query: 183 DTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSI 242
           +     GAKRAV LPVSAPFHS+LM P +  +  +L  +  +D  VP++ N  A  V+S 
Sbjct: 182 EALKAAGAKRAVLLPVSAPFHSTLMQPAADRLAEVLAPIEIKDITVPVVANVTAQEVTSG 241

Query: 243 DEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKV 302
           +EI +LLV+Q    V W  +++     GV    EVG GKVLTG  K+I K + A+++   
Sbjct: 242 EEIKKLLVKQAAMPVLWETSVRNMVAGGVDIFVEVGPGKVLTGFTKKIAKGMMALNVEDA 301

Query: 303 EDIDLALRSI 312
             ++  L  +
Sbjct: 302 ASLEKTLAEL 311


>gi|125973452|ref|YP_001037362.1| [Acyl-carrier-protein] S-malonyltransferase [Clostridium
           thermocellum ATCC 27405]
 gi|256005348|ref|ZP_05430313.1| malonyl CoA-acyl carrier protein transacylase [Clostridium
           thermocellum DSM 2360]
 gi|281417652|ref|ZP_06248672.1| malonyl CoA-acyl carrier protein transacylase [Clostridium
           thermocellum JW20]
 gi|125713677|gb|ABN52169.1| [Acyl-carrier-protein] S-malonyltransferase [Clostridium
           thermocellum ATCC 27405]
 gi|255990667|gb|EEU00784.1| malonyl CoA-acyl carrier protein transacylase [Clostridium
           thermocellum DSM 2360]
 gi|281409054|gb|EFB39312.1| malonyl CoA-acyl carrier protein transacylase [Clostridium
           thermocellum JW20]
 gi|316940311|gb|ADU74345.1| malonyl CoA-acyl carrier protein transacylase [Clostridium
           thermocellum DSM 1313]
          Length = 311

 Score =  226 bits (577), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 121/307 (39%), Positives = 182/307 (59%), Gaps = 6/307 (1%)

Query: 7   FPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPALT 66
           FPGQG+Q IGMG+ + D +  A  +F+E    L  ++  +++ G +E L  T N QPA+ 
Sbjct: 8   FPGQGAQYIGMGKQIADEYKSADAIFDEASEVLGFDMKKMIFEGDEETLKITENTQPAIL 67

Query: 67  AVSMAFIR-VMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQE 125
             S+A ++ V+EK    +K D+  VAG SLGEY+A  AA   +  D + LVR RGK MQE
Sbjct: 68  TTSVALLQPVLEKG---IKPDV--VAGLSLGEYSAHVAAGTMTFRDAVALVRKRGKFMQE 122

Query: 126 AVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAADTC 185
           AVP G+G+M AIIGLD   V   C +AS  GI E AN N  GQ+ ++G   AV+ A +  
Sbjct: 123 AVPVGVGTMAAIIGLDSEAVKECCKKASSEGIVEPANFNCPGQITVAGEVKAVEKALEIA 182

Query: 186 LNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSIDEI 245
              GAKRA+ L VSAPFH S++ P    +   L+ VT  D  +P++ N  A  +   D++
Sbjct: 183 KEMGAKRAMLLAVSAPFHCSMLKPAGDKLAAELERVTLGDMQIPVVTNVTAEYIIDKDKV 242

Query: 246 SRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVEDI 305
             LL+ QV+  V + ++I+     GV +  E+G GKVL+G  K+I+K +  +++  +E +
Sbjct: 243 KDLLIRQVSSSVLFEDSIRNMIEDGVDTFVEIGPGKVLSGFVKKINKEMKTLNVEDIESL 302

Query: 306 DLALRSI 312
           +  L+ +
Sbjct: 303 NKTLQEL 309


>gi|228954129|ref|ZP_04116157.1| Malonyl CoA-acyl carrier protein transacylase [Bacillus
           thuringiensis serovar kurstaki str. T03a001]
 gi|228805449|gb|EEM52040.1| Malonyl CoA-acyl carrier protein transacylase [Bacillus
           thuringiensis serovar kurstaki str. T03a001]
          Length = 314

 Score =  226 bits (576), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 123/311 (39%), Positives = 181/311 (58%), Gaps = 9/311 (2%)

Query: 7   FPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPALT 66
           FPGQGSQ +GMG+ L ++  E   VF + D  L  +LS++++ G QE+LT T NAQPAL 
Sbjct: 8   FPGQGSQAVGMGKQLAENNKEVAKVFAKADEVLQDSLSEVIFEGPQEKLTLTTNAQPALL 67

Query: 67  AVSMAFIRVMEKNGLCVKRDIS--YVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQ 124
             S A +  +++       DI+  +VAGHSLGEY+AL AA A +  D +  VR RG+ M+
Sbjct: 68  TTSFAILTALKE------YDITPDFVAGHSLGEYSALVAAGALTFEDAVYAVRKRGEYME 121

Query: 125 EAVPPGLGSMVAIIGLDDCVVDSICAQASRVGIC-EIANDNGGGQVVISGLQDAVKCAAD 183
           EAVP   G+M AI+G D  ++  +  + +  G   +IAN N   Q+VISG +  V+ A+ 
Sbjct: 122 EAVPGREGAMAAILGADPHMLKQVTEEVTSEGYAVQIANMNSTKQIVISGTKQGVEVASQ 181

Query: 184 TCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSID 243
                GAKRA+ L VS PFHSSLM P ++  + +L+ +T  D  +P++ N  A  ++   
Sbjct: 182 RAKENGAKRAIPLKVSGPFHSSLMKPAAEKFQSVLNEITIHDTNIPVIANVTADVITRGA 241

Query: 244 EISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVE 303
           +I   L+EQ+   V W  +I+     GV +  E+G GKVL GL K ID S  A +I   E
Sbjct: 242 DIQEKLIEQLYSPVLWYPSIECMVKQGVDTFIEIGPGKVLAGLMKSIDSSAKAYAIYDEE 301

Query: 304 DIDLALRSIVG 314
            +   + ++ G
Sbjct: 302 TLKDTISNLRG 312


>gi|309389511|gb|ADO77391.1| (Acyl-carrier-protein) S-malonyltransferase [Halanaerobium
           praevalens DSM 2228]
          Length = 309

 Score =  226 bits (576), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 123/309 (39%), Positives = 179/309 (57%), Gaps = 6/309 (1%)

Query: 4   VLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQP 63
           V  F GQGSQ +GMG++LY +F EA+ + ++ D  L+ +L ++++ G + +L  T N QP
Sbjct: 6   VFLFSGQGSQYVGMGKELYQNFEEAKNILDKADQILDFDLKEMIFAGPEAKLNNTKNTQP 65

Query: 64  ALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSM 123
           A+  VS     V++  GL      + VAGHSLGEY+AL AA   S    ++LVR RG+ M
Sbjct: 66  AIYTVSAMVKAVLKAKGLQA----AAVAGHSLGEYSALYAAGVLSFEAGLKLVRLRGQLM 121

Query: 124 QEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAAD 183
            +A P   G+M A+IGL+   V+ +  +    GI  +AN N   QVVISG   AVK A  
Sbjct: 122 DQADPENNGTMAAVIGLEAKKVEKVLREIE--GIITVANYNSPTQVVISGEVAAVKKAQA 179

Query: 184 TCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSID 243
               KGAKR + L VS  FHS LM P  + +K  ++ V  +D  +P++ N  A  V    
Sbjct: 180 LLTEKGAKRVINLSVSGAFHSPLMEPAKEELKKAIEEVEFKDAQIPLIANVEADYVKESS 239

Query: 244 EISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVE 303
           EI   L++Q+   VRW ETI+ F   G K+  EVG G+VL GL +RID+SL A ++   +
Sbjct: 240 EIKSALIKQLDNSVRWLETIEKFKTDGYKNYIEVGPGRVLKGLMRRIDRSLKAYNVEDQK 299

Query: 304 DIDLALRSI 312
            ++  L+ +
Sbjct: 300 SLEKTLKKL 308


>gi|16803848|ref|NP_465333.1| acyl-carrier-protein S-malonyltransferase [Listeria monocytogenes
           EGD-e]
 gi|224501390|ref|ZP_03669697.1| acyl-carrier-protein S-malonyltransferase [Listeria monocytogenes
           FSL R2-561]
 gi|16411262|emb|CAC99886.1| fabD [Listeria monocytogenes EGD-e]
          Length = 313

 Score =  226 bits (576), Expect = 4e-57,   Method: Compositional matrix adjust.
 Identities = 120/302 (39%), Positives = 182/302 (60%), Gaps = 5/302 (1%)

Query: 5   LTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPA 64
             FPGQG+Q +GMG+D+   +PEA+ ++++ D  L  ++++++  G  E LT + NAQPA
Sbjct: 6   FVFPGQGAQKVGMGQDVAAEYPEAKKIYDDADERLGFSITEIITEGPIELLTKSENAQPA 65

Query: 65  LTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQ 124
           L + S+A +R +E  G  VK D  YVAGHSLGEY+AL A      SD I LVR RG+ M+
Sbjct: 66  LVSTSVAILRALETYG--VKAD--YVAGHSLGEYSALVAGGFLEASDAIYLVRKRGELME 121

Query: 125 EAVPPGLGSMVAIIGLDDCVVDSICAQASRVG-ICEIANDNGGGQVVISGLQDAVKCAAD 183
            AVP G G+M A++G+D   + +I  + ++ G   ++AN N  GQ+VISG    V+ A +
Sbjct: 122 AAVPNGAGAMAAVLGVDRETLKTITEEVTKEGDAVQLANLNCPGQIVISGTTAGVEKAGE 181

Query: 184 TCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSID 243
                GAKR + L VS PFHSSLM P +   + +L  V   D  +P++ N  A   +   
Sbjct: 182 KAKESGAKRVLPLAVSGPFHSSLMEPAALAFRDVLAEVKISDGQIPVVNNVDAKETTDKS 241

Query: 244 EISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVE 303
           EIS  L++Q+   V W + ++    +GV +  E+GSGKVL GL K+I++ ++ +S    E
Sbjct: 242 EISDKLIKQIYSPVLWEDIVEELIKNGVDTFVEIGSGKVLAGLIKKINRDVTVLSAGDAE 301

Query: 304 DI 305
            +
Sbjct: 302 SV 303


>gi|224500039|ref|ZP_03668388.1| acyl-carrier-protein S-malonyltransferase [Listeria monocytogenes
           Finland 1988]
          Length = 313

 Score =  226 bits (575), Expect = 4e-57,   Method: Compositional matrix adjust.
 Identities = 120/302 (39%), Positives = 182/302 (60%), Gaps = 5/302 (1%)

Query: 5   LTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPA 64
             FPGQG+Q +GMG+D+   +PEA+ ++++ D  L  ++++++  G  E LT + NAQPA
Sbjct: 6   FVFPGQGAQKVGMGQDVAAEYPEAKKIYDDADERLGFSITEIITEGPIELLTKSENAQPA 65

Query: 65  LTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQ 124
           L + S+A +R +E  G  VK D  YVAGHSLGEY+AL A      SD I LVR RG+ M+
Sbjct: 66  LVSTSVAILRALETYG--VKAD--YVAGHSLGEYSALVAGGFLEASDAIYLVRKRGELME 121

Query: 125 EAVPPGLGSMVAIIGLDDCVVDSICAQASRVG-ICEIANDNGGGQVVISGLQDAVKCAAD 183
            AVP G G+M A++G+D   + +I  + ++ G   ++AN N  GQ+VISG    V+ A +
Sbjct: 122 AAVPNGAGAMAAVLGVDRETLKTITEEVTKEGDAVQLANLNCPGQIVISGTTAGVEKAGE 181

Query: 184 TCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSID 243
                GAKR + L VS PFHSSLM P +   + +L  V   D  +P++ N  A   +   
Sbjct: 182 KAKESGAKRVLPLAVSGPFHSSLMEPAALAFREILAEVEISDGNIPVVNNVDAKQTTDKA 241

Query: 244 EISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVE 303
           EIS  L++Q+   V W + ++    +GV +  E+GSGKVL GL K+I++ ++ +S    E
Sbjct: 242 EISDKLIKQIYSPVLWEDIVEELIKNGVDTFVEIGSGKVLAGLIKKINRDVTVLSAGDAE 301

Query: 304 DI 305
            +
Sbjct: 302 SV 303


>gi|254455961|ref|ZP_05069390.1| malonyl CoA-acyl carrier protein transacylase [Candidatus
           Pelagibacter sp. HTCC7211]
 gi|207082963|gb|EDZ60389.1| malonyl CoA-acyl carrier protein transacylase [Candidatus
           Pelagibacter sp. HTCC7211]
          Length = 308

 Score =  226 bits (575), Expect = 4e-57,   Method: Compositional matrix adjust.
 Identities = 117/301 (38%), Positives = 181/301 (60%), Gaps = 3/301 (0%)

Query: 7   FPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPALT 66
           FPGQGSQ++GMG++ YD F   + +F+E D +LN  LS ++ +G +EEL  T N QPA+ 
Sbjct: 6   FPGQGSQMVGMGKEFYDKFDLVKNLFKEADESLNYPLSKIILDGPKEELDLTANTQPAIF 65

Query: 67  AVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQEA 126
            +S A   V++K          Y AGHSLGEY+AL        S+T++++R RG +MQ +
Sbjct: 66  LISYAIFNVVKKEFNIDLSKAKYFAGHSLGEYSALSCGGYLPFSETLKILRIRGDAMQNS 125

Query: 127 VPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISG-LQDAVKCAADTC 185
           VP G G MVA++G    +++ +  +  +    +IANDN  GQ+V+SG ++D  K      
Sbjct: 126 VPKGEGGMVAVLGSTVEIIEKVLEENDQNFKAQIANDNSEGQIVLSGQIKDLDKLI--II 183

Query: 186 LNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSIDEI 245
           L + + + + LPVSAPFH SLM   ++VM   L+ +      + ++ N  A  + +IDE+
Sbjct: 184 LKEKSIKNIKLPVSAPFHCSLMNKATQVMSTELNKLNFLQSEIKLISNVTAEEIINIDEL 243

Query: 246 SRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVEDI 305
             LL++Q+  RVRWRE++    N+ V    E+G GKVL+GL KRI+K +   +I+   DI
Sbjct: 244 KELLIKQIENRVRWRESVINMINNNVNHFIEIGPGKVLSGLVKRINKEVKISTINNQNDI 303

Query: 306 D 306
           +
Sbjct: 304 E 304


>gi|254363102|ref|ZP_04979156.1| hypothetical protein
 gi|261493060|ref|ZP_05989600.1| acyl carrier protein S-malonyltransferase [Mannheimia haemolytica
           serotype A2 str. BOVINE]
 gi|261496348|ref|ZP_05992743.1| acyl carrier protein S-malonyltransferase [Mannheimia haemolytica
           serotype A2 str. OVINE]
 gi|153094989|gb|EDN75552.1| [acyl-carrier-protein] S-malonyltransferase [Mannheimia haemolytica
           PHL213]
 gi|261307992|gb|EEY09300.1| acyl carrier protein S-malonyltransferase [Mannheimia haemolytica
           serotype A2 str. OVINE]
 gi|261311280|gb|EEY12443.1| acyl carrier protein S-malonyltransferase [Mannheimia haemolytica
           serotype A2 str. BOVINE]
          Length = 311

 Score =  226 bits (575), Expect = 4e-57,   Method: Compositional matrix adjust.
 Identities = 127/304 (41%), Positives = 177/304 (58%), Gaps = 4/304 (1%)

Query: 5   LTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPA 64
           + FPGQGSQ +GM  DL   +P     F++    L  +L DL+ NG+ EEL  T   QPA
Sbjct: 6   MVFPGQGSQAVGMLADLAPQYPIVEETFKQASDVLGYDLWDLVQNGTAEELGQTHRTQPA 65

Query: 65  LTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQ 124
           L A S+A  R+ ++     ++  + +AGHSLGEY+AL  A      D I+LV  RG++MQ
Sbjct: 66  LLASSVALFRIWQQK--FPEQKPAVMAGHSLGEYSALVCAGVLDFQDAIKLVELRGRAMQ 123

Query: 125 EAVPPGLGSMVAIIGLDDCVVDSICAQA-SRVG-ICEIANDNGGGQVVISGLQDAVKCAA 182
           EAVP G G+M AIIGLD+  +   C QA S  G I    N N  GQVVI+G + A + A 
Sbjct: 124 EAVPAGSGAMFAIIGLDNESIIKACEQAASETGEIVSAVNFNSPGQVVIAGTKAAAEKAG 183

Query: 183 DTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSI 242
           + C   GAKRA+ L VS P H +LM P ++ +   L ++    P+VP++ N   +  +  
Sbjct: 184 ELCKAAGAKRALPLAVSVPSHCALMKPAAEKLAEALQNIELNQPLVPVINNVDVAVETDA 243

Query: 243 DEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKV 302
           D I   LV Q+   VRW ET++  A  G+ ++YE+G  KVLTGLA RI K LSA +++ V
Sbjct: 244 DTIRNALVRQLYSPVRWTETVEKMAQDGITTLYEIGPNKVLTGLAGRIVKELSAKAVNDV 303

Query: 303 EDID 306
              +
Sbjct: 304 ASFE 307


>gi|254519773|ref|ZP_05131829.1| malonyl CoA-acyl carrier protein transacylase [Clostridium sp.
           7_2_43FAA]
 gi|226913522|gb|EEH98723.1| malonyl CoA-acyl carrier protein transacylase [Clostridium sp.
           7_2_43FAA]
          Length = 317

 Score =  226 bits (575), Expect = 4e-57,   Method: Compositional matrix adjust.
 Identities = 124/315 (39%), Positives = 183/315 (58%), Gaps = 5/315 (1%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M T   F GQGSQ IGMG+DLY+     + +F++ +  L+ ++ +L++NG++E+L  T N
Sbjct: 1   MKTAFVFAGQGSQYIGMGKDLYEHILRCKEIFDKANDILSFDIKELIFNGNKEDLDITEN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
            QPA+   S+A    +E+ G  +K D+  VAG SLGEY+AL  A A S  + + LV+ RG
Sbjct: 61  TQPAILITSIAAKEALEERG--IKADV--VAGLSLGEYSALVCANALSFEEAVALVKKRG 116

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           + MQEAVP G+GSM AIIGL    +      +   GI EIAN N   Q+VI G ++AV+ 
Sbjct: 117 RYMQEAVPIGVGSMAAIIGLPIEKIKIAIENSRDKGIVEIANYNTNNQIVIGGEKEAVEK 176

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A + CL  GAKRA+ L VS PFH+SL+   S  +K  L ++    P   I+ N  A  + 
Sbjct: 177 AKELCLEYGAKRAIELKVSGPFHTSLLEKASIKLKEELKNIEFNKPSTKIISNVTAEFID 236

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLS-AVSI 299
           +  +I  LL  Q+   V+W ++I+   N GV +  E G G+VL+   K I +     V+I
Sbjct: 237 NKSDIEELLFSQIKSSVKWSKSIEKMLNMGVDTFIEFGPGRVLSSFIKEISREKGLKVNI 296

Query: 300 SKVEDIDLALRSIVG 314
             VED+    +++ G
Sbjct: 297 YNVEDMKSLNKTLEG 311


>gi|195953115|ref|YP_002121405.1| malonyl CoA-acyl carrier protein transacylase [Hydrogenobaculum sp.
           Y04AAS1]
 gi|195932727|gb|ACG57427.1| malonyl CoA-acyl carrier protein transacylase [Hydrogenobaculum sp.
           Y04AAS1]
          Length = 307

 Score =  226 bits (575), Expect = 4e-57,   Method: Compositional matrix adjust.
 Identities = 119/306 (38%), Positives = 177/306 (57%), Gaps = 4/306 (1%)

Query: 7   FPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPALT 66
           FPGQGSQ +GMG D Y  F EA  VF  V+  L +N++D+++ G++EEL+ T N QP+L 
Sbjct: 6   FPGQGSQYVGMGYDFYKEFSEASNVFHSVEEALRKNITDIVFRGTEEELSKTINTQPSLL 65

Query: 67  AVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQEA 126
           A S A    ++K GL   +D  +VAGHSLGEYTAL  AK   L +  +L   RGK MQEA
Sbjct: 66  ACSYAIYASLKKMGL---KDPDFVAGHSLGEYTALLVAKGIDLYEAAKLTYLRGKYMQEA 122

Query: 127 VPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAADTCL 186
           VP G G+M AI+ L    V+  C QA  +G+ E AN N   Q VISG ++AV+   +   
Sbjct: 123 VPEGKGAMAAILKLPPEKVEEACQQAKDLGVVEPANYNSKEQTVISGEKEAVEKTIEIAK 182

Query: 187 NKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSIDEIS 246
           + G K A+ L VS P H SLM P +   +  L     Q+  +P++ N  A   +   EI 
Sbjct: 183 SMGGK-AIMLKVSVPSHCSLMKPAADAFRLKLAQTPIQNITIPLVSNVDAKAHTMAHEIR 241

Query: 247 RLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVEDID 306
             L +Q+   V+W +++++  + GV +  E+G   VL+ L  +ID  +   ++ K++D +
Sbjct: 242 DNLHKQIYSSVKWYQSVEYMISQGVDTFVEIGPKNVLSKLISQIDSRVRVFNVDKLQDAE 301

Query: 307 LALRSI 312
             L+++
Sbjct: 302 NVLKAL 307


>gi|163847961|ref|YP_001636005.1| malonyl CoA-acyl carrier protein transacylase [Chloroflexus
           aurantiacus J-10-fl]
 gi|222525841|ref|YP_002570312.1| malonyl CoA-acyl carrier protein transacylase [Chloroflexus sp.
           Y-400-fl]
 gi|163669250|gb|ABY35616.1| malonyl CoA-acyl carrier protein transacylase [Chloroflexus
           aurantiacus J-10-fl]
 gi|222449720|gb|ACM53986.1| malonyl CoA-acyl carrier protein transacylase [Chloroflexus sp.
           Y-400-fl]
          Length = 318

 Score =  226 bits (575), Expect = 5e-57,   Method: Compositional matrix adjust.
 Identities = 132/313 (42%), Positives = 185/313 (59%), Gaps = 12/313 (3%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           MS    FPGQGSQV+GMGRDL  + P AR +F   D TL+ NLS+L + G + +LTAT N
Sbjct: 1   MSIAWVFPGQGSQVVGMGRDLIAASPAARQIFATADETLDFNLSELCFCGPEADLTATAN 60

Query: 61  AQPALTAVSMAFIRVM-EKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRAR 119
           AQPAL   SMA +  M E  G  +++ I+ VAGHSLGEY+AL A  A      ++LVR R
Sbjct: 61  AQPALLTTSMALLAAMTELLGDRLEQPIA-VAGHSLGEYSALVAGGALDFKTALQLVRRR 119

Query: 120 GKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRV-------GICEIANDNGGGQVVIS 172
           G+ M  A     GSM A+IGLD  +++ IC + S         G   IAN N   Q+VIS
Sbjct: 120 GELMAAAHE---GSMAAVIGLDAAILEQICQEVSAALQNDHSHGTVVIANYNAPDQLVIS 176

Query: 173 GLQDAVKCAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILP 232
           G   AV+ A+    ++GAKR + L VSA FHS LM   ++ M   +   T ++  +P++ 
Sbjct: 177 GSVVAVEHASMLAKSRGAKRVIPLKVSAAFHSPLMIEAAEGMAQAIAHATVRNLSIPLIA 236

Query: 233 NFCASPVSSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDK 292
           N  A P+   D++ R +V QV   VRW  ++Q   + GV++  E+G GKVLTGL +RI  
Sbjct: 237 NVTAEPLYDADDVRREIVAQVVAPVRWIASVQRMVDLGVETFIEIGPGKVLTGLIRRIAP 296

Query: 293 SLSAVSISKVEDI 305
           +   ++++  ED+
Sbjct: 297 TARLINVATFEDV 309


>gi|322433878|ref|YP_004216090.1| malonyl CoA-acyl carrier protein transacylase [Acidobacterium sp.
           MP5ACTX9]
 gi|321161605|gb|ADW67310.1| malonyl CoA-acyl carrier protein transacylase [Acidobacterium sp.
           MP5ACTX9]
          Length = 340

 Score =  226 bits (575), Expect = 5e-57,   Method: Compositional matrix adjust.
 Identities = 127/307 (41%), Positives = 174/307 (56%), Gaps = 26/307 (8%)

Query: 7   FPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPALT 66
           FPGQGSQ +GMGR+LYD+FP A+ VF+E D  L  +LS L++ G  E L  T + QPA+ 
Sbjct: 8   FPGQGSQTVGMGRELYDNFPSAKAVFKEADEVLGFHLSHLIFEGPAETLQLTEHTQPAIL 67

Query: 67  AVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQEA 126
            VS+A +RV+ ++   ++      AGHSLGEY+A  AA + + +D +R VRARG+ MQ+A
Sbjct: 68  TVSVAALRVLTES---LQITPIAAAGHSLGEYSAQVAAGSITFADAVRTVRARGRFMQQA 124

Query: 127 VPPGLGSMVAIIGLDDCVVDSICAQASR-----------------------VGICEIAND 163
           VPPG GSM AI+GL    V+ +CAQAS                          I   AN 
Sbjct: 125 VPPGAGSMAAILGLSAEQVNDLCAQASEDASAPSPIDTTPSESATPRAEAARSIVSPANL 184

Query: 164 NGGGQVVISGLQDAVKCAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTK 223
           N   Q+VISG   AV+ A +     GAK+ V L VSAPFH  LM P    +  +L+++  
Sbjct: 185 NSPEQIVISGATAAVERAVELAKTAGAKKTVILKVSAPFHCGLMQPAQDQLASVLEAIDF 244

Query: 224 QDPVVPILPNFCASPVSSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVL 283
            DP  P+  N  A  ++   ++   L+ QVTG VRW E +Q         + E+G GKVL
Sbjct: 245 ADPAFPVACNVDARLLTRRADVRDCLIRQVTGSVRWVECLQLLVAQEPTHLIEIGPGKVL 304

Query: 284 TGLAKRI 290
           TGL ++I
Sbjct: 305 TGLTRQI 311


>gi|302389620|ref|YP_003825441.1| (Acyl-carrier-protein) S-malonyltransferase [Thermosediminibacter
           oceani DSM 16646]
 gi|302200248|gb|ADL07818.1| (Acyl-carrier-protein) S-malonyltransferase [Thermosediminibacter
           oceani DSM 16646]
          Length = 313

 Score =  226 bits (575), Expect = 5e-57,   Method: Compositional matrix adjust.
 Identities = 122/299 (40%), Positives = 178/299 (59%), Gaps = 4/299 (1%)

Query: 7   FPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPALT 66
           F GQG+Q +GMG++L D+F  AR +F+  D  L   +S++ +NG +E L  T N QPA+ 
Sbjct: 8   FAGQGAQYVGMGKELIDNFETARKIFDMADEVLGYKISEICFNGPEERLKETANTQPAIL 67

Query: 67  AVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQEA 126
             S+A   ++++ G+      + VAG SLGEY+AL AA++    + + LVR RG  MQEA
Sbjct: 68  THSVACYFLLKEEGIVP----NVVAGLSLGEYSALVAAESIDFEEAVPLVRKRGIYMQEA 123

Query: 127 VPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAADTCL 186
           VP G G+M A+IGL+   V  +C  AS  GI E AN N   Q+VISG   AV+ A +   
Sbjct: 124 VPLGRGAMAAVIGLEKQEVLRVCELASEAGIVEAANFNCPDQIVISGEVRAVEKAVEIAK 183

Query: 187 NKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSIDEIS 246
            KGA++AV L VSAPFH SL+ P  + +   L  V  +   +P++ N  A PVS    I 
Sbjct: 184 GKGARKAVMLHVSAPFHCSLLKPAGEKLAVELGKVHIKSAKIPLISNVTADPVSDGATIK 243

Query: 247 RLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVEDI 305
            LLV+QV+  V W +++      GV +  E+G G+ L+G  K+ID+SL  +++  VE +
Sbjct: 244 ELLVKQVSSPVLWEDSVNKMKEMGVDTFVELGPGRALSGFVKKIDRSLVTLNVEDVESL 302


>gi|313896313|ref|ZP_07829866.1| [acyl-carrier-protein] S-malonyltransferase [Selenomonas sp. oral
           taxon 137 str. F0430]
 gi|312975112|gb|EFR40574.1| [acyl-carrier-protein] S-malonyltransferase [Selenomonas sp. oral
           taxon 137 str. F0430]
          Length = 311

 Score =  225 bits (574), Expect = 6e-57,   Method: Compositional matrix adjust.
 Identities = 121/308 (39%), Positives = 173/308 (56%), Gaps = 4/308 (1%)

Query: 5   LTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPA 64
             FPGQG+QV+GMG+DL+D +  A+  F E D  L  ++S L + G  E+L  T + QPA
Sbjct: 6   FIFPGQGAQVVGMGKDLFDRYDLAKQRFAEADAALGYSISTLCFEGPAEKLQLTEHTQPA 65

Query: 65  LTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQ 124
           +  V +    ++ + G+  +       GHSLGEY AL  A   S  D + LV  RG  MQ
Sbjct: 66  ILTVEVIAAELLREAGVAPE----VAGGHSLGEYGALVLAGVMSFQDAVLLVHKRGAYMQ 121

Query: 125 EAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAADT 184
           EAVP G G+M A+IGLDD  + ++CA+AS  G  +  N N  GQ VI+G    V+ A + 
Sbjct: 122 EAVPVGEGAMAAVIGLDDERIVAVCAEASSAGAVQAVNFNCPGQTVIAGTVRGVERAVEL 181

Query: 185 CLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSIDE 244
              +GAK+AV LPVSAPFHS+LM P ++ +   LD V  +D   P++ N+      S  E
Sbjct: 182 LKEQGAKKAVILPVSAPFHSTLMAPAAQKLAAELDKVEIRDAAFPVVSNYTGKLQQSAAE 241

Query: 245 ISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVED 304
           I + L+ Q    VRW   ++     G  +  E G GK L G  KRIDKSL ++++  V+ 
Sbjct: 242 IKKNLIAQADHPVRWIACVETMKEFGADTYVECGPGKTLAGFNKRIDKSLVSMNVENVDS 301

Query: 305 IDLALRSI 312
           +   L ++
Sbjct: 302 LQKTLDTL 309


>gi|37679458|ref|NP_934067.1| acyl carrier protein S-malonyltransferase [Vibrio vulnificus YJ016]
 gi|37198202|dbj|BAC94038.1| S-malonyltransferase [Vibrio vulnificus YJ016]
          Length = 307

 Score =  225 bits (574), Expect = 6e-57,   Method: Compositional matrix adjust.
 Identities = 125/302 (41%), Positives = 176/302 (58%), Gaps = 3/302 (0%)

Query: 5   LTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPA 64
           + FPGQGSQ +GM  DL + +   +  F +    L  +L  L+ NG  E+L  T   QPA
Sbjct: 6   IVFPGQGSQAVGMLADLGEQYEIVKQTFAQASEALGYDLWALVQNGPAEDLNQTFRTQPA 65

Query: 65  LTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQ 124
           L A S+A  RV ++ GL    ++   AGHSLGEY+AL  A      + I+LV  RG+ MQ
Sbjct: 66  LLASSVAIWRVWQELGLAQPENL---AGHSLGEYSALVCAGVIDFQEAIKLVELRGQLMQ 122

Query: 125 EAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAADT 184
           EAVP G G+M AIIGLDD  +   C +A++  +    N N  GQVVI+G +DAV+ A   
Sbjct: 123 EAVPAGTGAMYAIIGLDDEAIAKACEEAAQGEVVSPVNFNSPGQVVIAGSKDAVERAGAL 182

Query: 185 CLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSIDE 244
           C   GAKRA+ LPVS P H +LM P ++ +   L+S+  + P +P++ N      +    
Sbjct: 183 CKEAGAKRALPLPVSVPSHCALMKPAAEKLAVALESIEFKAPQLPVINNVDVVAETDPAR 242

Query: 245 ISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVED 304
           I   LV Q+   VRW E+++  ++ GV+ + E+G GKVLTGL KRI KSL A  ++ V  
Sbjct: 243 IKDALVRQLYSPVRWTESVELMSSQGVEKLLEMGPGKVLTGLTKRIVKSLEAAVVNDVAS 302

Query: 305 ID 306
           +D
Sbjct: 303 LD 304


>gi|229541123|ref|ZP_04430183.1| malonyl CoA-acyl carrier protein transacylase [Bacillus coagulans
           36D1]
 gi|229325543|gb|EEN91218.1| malonyl CoA-acyl carrier protein transacylase [Bacillus coagulans
           36D1]
          Length = 312

 Score =  225 bits (574), Expect = 6e-57,   Method: Compositional matrix adjust.
 Identities = 120/309 (38%), Positives = 184/309 (59%), Gaps = 5/309 (1%)

Query: 5   LTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPA 64
             FPGQGSQ +GMG+ +  +  +A  VF++ D  L  +LS L+ NG  ++LT T NAQPA
Sbjct: 6   FVFPGQGSQTVGMGQSVAGANEKAAAVFQKSDEKLGMDLSGLIQNGPLDKLTRTENAQPA 65

Query: 65  LTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQ 124
           L  VS A ++V+++ G+       + AGHSLGEY+AL AA A S  D +  VR RG+ M 
Sbjct: 66  LLTVSTAILQVLQEAGIHA----DFTAGHSLGEYSALVAAGALSFEDAVYAVRKRGEYMD 121

Query: 125 EAVPPGLGSMVAIIGLDDCVVDSICAQASRVG-ICEIANDNGGGQVVISGLQDAVKCAAD 183
           EA P G G+M A++GLD  V++ +  + S  G   ++AN N  GQ+VISG    ++ A  
Sbjct: 122 EAFPNGAGAMSAVLGLDRGVLEEVADEVSSEGETVQLANLNCPGQIVISGTAAGIEKAGA 181

Query: 184 TCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSID 243
               +GAKR + L VS PFHS LM P ++  K +LD +  QD  VP++ N  A   +   
Sbjct: 182 LAKERGAKRVLPLQVSGPFHSKLMEPAAEKFKTVLDEIAIQDATVPVIANVDAEVETGAQ 241

Query: 244 EISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVE 303
           +I    + Q+   V W ++++   + GV +  EVG GKVL+GL ++ID+S+   ++  +E
Sbjct: 242 DIKENCIRQLYSPVLWEDSVKKMISLGVDTFIEVGPGKVLSGLIRKIDRSVKTYAVQDME 301

Query: 304 DIDLALRSI 312
            ++ A+ ++
Sbjct: 302 TLEAAVGAL 310


>gi|47097392|ref|ZP_00234943.1| malonyl CoA-acyl carrier protein transacylase [Listeria
           monocytogenes str. 1/2a F6854]
 gi|254829197|ref|ZP_05233884.1| malonyl CoA-acyl carrier protein transacylase [Listeria
           monocytogenes FSL N3-165]
 gi|254899495|ref|ZP_05259419.1| malonyl CoA-acyl carrier protein transacylase [Listeria
           monocytogenes J0161]
 gi|254912366|ref|ZP_05262378.1| malonyl CoA-acyl carrier protein transacylase [Listeria
           monocytogenes J2818]
 gi|254936693|ref|ZP_05268390.1| malonyl CoA-acyl carrier protein transacylase [Listeria
           monocytogenes F6900]
 gi|47014240|gb|EAL05222.1| malonyl CoA-acyl carrier protein transacylase [Listeria
           monocytogenes str. 1/2a F6854]
 gi|258601607|gb|EEW14932.1| malonyl CoA-acyl carrier protein transacylase [Listeria
           monocytogenes FSL N3-165]
 gi|258609290|gb|EEW21898.1| malonyl CoA-acyl carrier protein transacylase [Listeria
           monocytogenes F6900]
 gi|293590348|gb|EFF98682.1| malonyl CoA-acyl carrier protein transacylase [Listeria
           monocytogenes J2818]
          Length = 313

 Score =  225 bits (574), Expect = 6e-57,   Method: Compositional matrix adjust.
 Identities = 121/302 (40%), Positives = 181/302 (59%), Gaps = 5/302 (1%)

Query: 5   LTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPA 64
             FPGQG+Q IGMG+D+   +PEA+ ++++ D  L  ++++++  G  E LT + NAQPA
Sbjct: 6   FVFPGQGAQKIGMGQDVAAEYPEAKKIYDDADERLGFSITEIITEGPIELLTKSENAQPA 65

Query: 65  LTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQ 124
           L + S+A +R +E  G  VK D  YVAGHSLGEY+AL A      SD I LVR RG+ M+
Sbjct: 66  LVSTSVAILRALETYG--VKAD--YVAGHSLGEYSALVAGGFLEASDAIYLVRKRGELME 121

Query: 125 EAVPPGLGSMVAIIGLDDCVVDSICAQASRVG-ICEIANDNGGGQVVISGLQDAVKCAAD 183
            AVP G G+M A++G+D   + +I  + ++ G   ++AN N  GQ+VISG    V+ A +
Sbjct: 122 AAVPNGAGAMAAVLGVDRETLKTITEEVTKEGDEVQLANLNCPGQIVISGTTAGVEKAGE 181

Query: 184 TCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSID 243
                GAKR + L VS PFHSSLM P +     +L  V   D  +P++ N  A   +   
Sbjct: 182 KAKESGAKRVLPLAVSGPFHSSLMEPAALAFHDVLAEVKISDGQIPVVNNVDAKETTDKS 241

Query: 244 EISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVE 303
           EIS  L++Q+   V W + ++    +GV +  E+GSGKVL GL K+I++ ++ +S    E
Sbjct: 242 EISDKLIKQIYSPVLWEDIVEELIKNGVDTFVEIGSGKVLAGLIKKINRDVTVLSAGDAE 301

Query: 304 DI 305
            +
Sbjct: 302 SV 303


>gi|320529293|ref|ZP_08030383.1| malonyl CoA-acyl carrier protein transacylase [Selenomonas
           artemidis F0399]
 gi|320138467|gb|EFW30359.1| malonyl CoA-acyl carrier protein transacylase [Selenomonas
           artemidis F0399]
          Length = 326

 Score =  225 bits (574), Expect = 6e-57,   Method: Compositional matrix adjust.
 Identities = 121/308 (39%), Positives = 173/308 (56%), Gaps = 4/308 (1%)

Query: 5   LTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPA 64
             FPGQG+QV+GMG+DL+D +  A+  F E D  L  ++S L + G  E+L  T + QPA
Sbjct: 21  FIFPGQGAQVVGMGKDLFDRYDLAKQRFAEADAALGYSISTLCFEGPAEKLQLTEHTQPA 80

Query: 65  LTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQ 124
           +  V +    ++ + G+  +       GHSLGEY AL  A   S  D + LV  RG  MQ
Sbjct: 81  ILTVEVIAAELLREAGVAPE----VAGGHSLGEYGALVLAGVMSFQDAVLLVHKRGAYMQ 136

Query: 125 EAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAADT 184
           EAVP G G+M A+IGLDD  + ++CA+AS  G  +  N N  GQ VI+G    V+ A + 
Sbjct: 137 EAVPVGEGAMAAVIGLDDERIVAVCAEASSAGAVQAVNFNCPGQTVIAGTVRGVERAVEL 196

Query: 185 CLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSIDE 244
              +GAK+AV LPVSAPFHS+LM P ++ +   LD V  +D   P++ N+      S  E
Sbjct: 197 LKEQGAKKAVILPVSAPFHSTLMAPAAQKLAAELDKVEIRDAAFPVVSNYTGKLQQSAAE 256

Query: 245 ISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVED 304
           I + L+ Q    VRW   ++     G  +  E G GK L G  KRIDKSL ++++  V+ 
Sbjct: 257 IKKNLIAQADHPVRWIACVETMKEFGADTYVECGPGKTLAGFNKRIDKSLVSMNVENVDS 316

Query: 305 IDLALRSI 312
           +   L ++
Sbjct: 317 LQKTLDTL 324


>gi|83589797|ref|YP_429806.1| [Acyl-carrier-protein] S-malonyltransferase [Moorella thermoacetica
           ATCC 39073]
 gi|83572711|gb|ABC19263.1| [Acyl-carrier-protein] S-malonyltransferase [Moorella thermoacetica
           ATCC 39073]
          Length = 312

 Score =  225 bits (574), Expect = 6e-57,   Method: Compositional matrix adjust.
 Identities = 126/303 (41%), Positives = 176/303 (58%), Gaps = 8/303 (2%)

Query: 4   VLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQP 63
           V  FPGQGSQ +GMG++L   +PEA  VF E    L   +  L++NG  EEL  T N QP
Sbjct: 5   VFLFPGQGSQYVGMGQELAQHYPEAAAVFTEASEELGWPVDKLVFNGPAEELVRTENTQP 64

Query: 64  ALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSM 123
           A+   S+A  RV+E  G+  +     VAGHSLGEY+AL AA + S  D +R+V  R + M
Sbjct: 65  AVLTTSIACYRVLEARGIKPR----AVAGHSLGEYSALVAAGSLSFKDALRVVVQRARLM 120

Query: 124 QEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAAD 183
             AVP G G MVA++GL    V ++C Q  + G+ E AN N  GQVV++G +  ++    
Sbjct: 121 ANAVPCGQGGMVAVLGLPAERVVALC-QEVKEGVAEAANFNSPGQVVVAGDRAGLEAITA 179

Query: 184 TCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSID 243
                GAK+ + L VS PFHSSLM PV++ +  +L+ V   DPVVP++ N  A    +  
Sbjct: 180 LAREAGAKKVIPLQVSGPFHSSLMEPVARELATVLNRVPLSDPVVPVVANVTADYTVTAA 239

Query: 244 EISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVE 303
            +   L+ QV   VRW E+++     G ++  EVG G VL+GL KR+D+    V I +VE
Sbjct: 240 AVRENLLRQVASPVRWEESMRRLLADGYRTFVEVGPGNVLSGLIKRLDRQ---VRIGQVE 296

Query: 304 DID 306
           +I 
Sbjct: 297 NIQ 299


>gi|312795529|ref|YP_004028451.1| Malonyl-CoA-[acyl-carrier-protein] transacylase [Burkholderia
           rhizoxinica HKI 454]
 gi|312167304|emb|CBW74307.1| Malonyl-CoA-[acyl-carrier-protein] transacylase (EC 2.3.1.39)
           [Burkholderia rhizoxinica HKI 454]
          Length = 310

 Score =  225 bits (574), Expect = 6e-57,   Method: Compositional matrix adjust.
 Identities = 130/314 (41%), Positives = 174/314 (55%), Gaps = 4/314 (1%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M     FPGQGSQ IGM  D +   P  +   EE    L+Q++  L+  G  +EL  T +
Sbjct: 1   MKFAFVFPGQGSQSIGM-LDAFGDHPVVKATLEEASDVLSQDIGRLIAQGPADELNLTTH 59

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
            QP +   + A  RV ++ G       + VAGHSLGEYTAL A+ A +  D + LVR R 
Sbjct: 60  TQPVMLTAAYAIYRVWQQAGGVAP---AVVAGHSLGEYTALVASGAITFRDALPLVRFRA 116

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           ++MQ+AVP G G M A++GLDD  V + C++A   GI E  N N   QVVI+G + AV  
Sbjct: 117 QAMQQAVPVGAGGMAAVLGLDDDAVRAACSEAGSAGIVEAVNFNAPAQVVIAGHKTAVDK 176

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A +    KGAKRAV LPVSAPFHSSL+ P S+ ++  L  V    P +P++ N   + VS
Sbjct: 177 ACEIAKAKGAKRAVLLPVSAPFHSSLLKPASERLREYLADVDVCAPQIPVVNNIDVAMVS 236

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
               I   LV Q  G VRW E ++  A   +  V E G GKVL GL +RID +L   +I 
Sbjct: 237 DPAGIKDALVRQAAGPVRWVECVRAIAAQQITHVIECGPGKVLAGLTRRIDANLVGGAIV 296

Query: 301 KVEDIDLALRSIVG 314
               +D  L+ + G
Sbjct: 297 DPASLDDTLKLLQG 310


>gi|30249611|ref|NP_841681.1| fabD; malonyl CoA-acyl carrier protein transacylase [Nitrosomonas
           europaea ATCC 19718]
 gi|30138974|emb|CAD85558.1| fabD; malonyl CoA-acyl carrier protein transacylase [Nitrosomonas
           europaea ATCC 19718]
          Length = 312

 Score =  225 bits (573), Expect = 7e-57,   Method: Compositional matrix adjust.
 Identities = 129/303 (42%), Positives = 169/303 (55%), Gaps = 7/303 (2%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M     FPGQGSQ +GM  + Y   P  R  F E    L Q+L  L+ NG ++ L  T N
Sbjct: 1   MKAAFVFPGQGSQSVGM-MNSYSELPSVRGTFNEASDILQQDLWSLVSNGPEDSLNLTTN 59

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
            QP + A  ++  R  ++ G     +  Y+AGHSLGEY AL AA+  + +D ++LVR R 
Sbjct: 60  TQPVMLAADVSIYRAWQQAGGI---EPHYLAGHSLGEYAALVAAEVLTFTDALKLVRYRA 116

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQ---ASRVGICEIANDNGGGQVVISGLQDA 177
           K MQE VP G G M AI+GLDD +V S+C +   A      E AN N  GQVVI+G   A
Sbjct: 117 KVMQETVPEGTGGMAAIVGLDDDIVSSVCTEVINAMPDTSLEPANFNAPGQVVIAGHSQA 176

Query: 178 VKCAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCAS 237
           V  A     +KGAK AV LP+S P H SLM   ++    +L+ +  Q P +PIL N    
Sbjct: 177 VARAVVLAKSKGAKLAVILPMSIPSHCSLMQSAAEKFALLLEEIALQPPRIPILHNADVQ 236

Query: 238 PVSSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAV 297
             S    I  +LV Q+   VRW ETIQ  A   VK V E G GKVL+GL +RIDK+L  +
Sbjct: 237 QHSETASIREILVRQLYRPVRWTETIQAIAAQNVKYVVECGPGKVLSGLNRRIDKNLENI 296

Query: 298 SIS 300
           +++
Sbjct: 297 ALT 299


>gi|313623263|gb|EFR93507.1| malonyl CoA-acyl carrier protein transacylase [Listeria innocua FSL
           J1-023]
          Length = 313

 Score =  225 bits (573), Expect = 7e-57,   Method: Compositional matrix adjust.
 Identities = 121/302 (40%), Positives = 179/302 (59%), Gaps = 5/302 (1%)

Query: 5   LTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPA 64
             FPGQG+Q IGMG+D+   +PEA+ ++++ D  L  +++D++  G  E LT + NAQPA
Sbjct: 6   FVFPGQGAQKIGMGQDVAAEYPEAKKIYDDADERLGFSITDIITEGPIELLTKSENAQPA 65

Query: 65  LTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQ 124
           L + S+A +R +E  G  VK D  YVAGHSLGEY+AL A      SD I LVR RG+ M+
Sbjct: 66  LVSTSVAILRALETYG--VKAD--YVAGHSLGEYSALVAGGFLEASDAIYLVRKRGELME 121

Query: 125 EAVPPGLGSMVAIIGLDDCVVDSICAQASRVG-ICEIANDNGGGQVVISGLQDAVKCAAD 183
            AVP G G+M A++G+D   +  +  + +  G   ++AN N  GQ+VISG    V+ A +
Sbjct: 122 AAVPNGAGAMAAVLGVDRETLKKVTEEVTAEGDAVQLANLNCPGQIVISGTTAGVEKAGE 181

Query: 184 TCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSID 243
                GAKR + L VS PFHSSLM P +   + +L  V   D  +P+  N  A   +   
Sbjct: 182 KAKENGAKRVLPLAVSGPFHSSLMEPAALAFRDILADVKISDGQIPVFNNVDAKGTTDKS 241

Query: 244 EISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVE 303
           EIS  L++Q+   V W + ++    +GV +  E+GSGKVL GL K+I++ ++ +S    E
Sbjct: 242 EISDKLIKQIYSPVLWEDIVEELIKNGVDTFVEIGSGKVLAGLIKKINRDVTVLSAGDAE 301

Query: 304 DI 305
            +
Sbjct: 302 SV 303


>gi|254826150|ref|ZP_05231151.1| malonyl CoA-acyl carrier protein transacylase [Listeria
           monocytogenes FSL J1-194]
 gi|255522490|ref|ZP_05389727.1| malonyl CoA-acyl carrier protein transacylase [Listeria
           monocytogenes FSL J1-175]
 gi|293595390|gb|EFG03151.1| malonyl CoA-acyl carrier protein transacylase [Listeria
           monocytogenes FSL J1-194]
          Length = 313

 Score =  225 bits (573), Expect = 7e-57,   Method: Compositional matrix adjust.
 Identities = 120/302 (39%), Positives = 182/302 (60%), Gaps = 5/302 (1%)

Query: 5   LTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPA 64
             FPGQG+Q IGMG+D+   +PEA+ ++++ D  L  ++++++  G  E LT + NAQPA
Sbjct: 6   FVFPGQGAQKIGMGQDVAAEYPEAKKIYDDADERLGFSITEIITEGPIELLTKSENAQPA 65

Query: 65  LTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQ 124
           L + S+A +R +E  G  VK D  YVAGHSLGEY+AL A      SD I LVR RG+ M+
Sbjct: 66  LVSTSVAILRALETYG--VKAD--YVAGHSLGEYSALVAGGFLEASDAIYLVRKRGELME 121

Query: 125 EAVPPGLGSMVAIIGLDDCVVDSICAQASRVG-ICEIANDNGGGQVVISGLQDAVKCAAD 183
            AVP G G+M A++G+D   + +I  + ++ G   ++AN N  GQ+VISG    V+ A +
Sbjct: 122 AAVPNGAGAMAAVLGVDRETLKTITEEVTKEGDAVQLANLNCPGQIVISGTTAGVEKAGE 181

Query: 184 TCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSID 243
                GAKR + L VS PFHSSLM P +   + +L  V   D  +P++ N  A   +   
Sbjct: 182 KAKESGAKRVLPLAVSGPFHSSLMEPAALAFRDVLAEVKISDGQIPVVNNVDAKETTDKS 241

Query: 244 EISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVE 303
           +IS  L++Q+   V W + ++    +GV +  E+GSGKVL GL K+I++ ++ +S    E
Sbjct: 242 KISDKLIKQIYSPVLWEDIVEELIKNGVDTFVEIGSGKVLAGLIKKINRDVTVLSAGDAE 301

Query: 304 DI 305
            +
Sbjct: 302 SV 303


>gi|256822411|ref|YP_003146374.1| malonyl CoA-acyl carrier protein transacylase [Kangiella koreensis
           DSM 16069]
 gi|256795950|gb|ACV26606.1| malonyl CoA-acyl carrier protein transacylase [Kangiella koreensis
           DSM 16069]
          Length = 309

 Score =  225 bits (573), Expect = 7e-57,   Method: Compositional matrix adjust.
 Identities = 125/309 (40%), Positives = 174/309 (56%), Gaps = 3/309 (0%)

Query: 3   TVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQ 62
           T   FPGQGSQ +GM  D+ D +P     F E    L  +L  L+    + +L  T   Q
Sbjct: 4   TAFIFPGQGSQAVGMLADIADKYPVIEHTFAEASEALGYDLWQLVQKDEEGKLNQTEFTQ 63

Query: 63  PALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKS 122
           PAL   S+A  R+ ++ G       +++AGHSLGEY+AL AA    L+D ++LV ARG+ 
Sbjct: 64  PALLTASVALWRLWQQEG---GTKPAFLAGHSLGEYSALVAAGVIELADAVKLVEARGQF 120

Query: 123 MQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAA 182
           MQ AVP G G M AIIGLDD  V   CA A++  + E  N N  GQVVI+G  DAV+ A 
Sbjct: 121 MQLAVPAGTGKMAAIIGLDDEKVRDACALAAQDEVVEAVNYNSPGQVVIAGSADAVERAM 180

Query: 183 DTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSI 242
           + C   GAKRA+ LPVS P H +LM P +  +  ML+S+    P +P++ N   +  +  
Sbjct: 181 EACKTAGAKRALPLPVSVPSHCALMRPAADKLAHMLESINISAPTIPVINNVDVAIETEP 240

Query: 243 DEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKV 302
             I   L+ Q+   VRW ET+Q        ++ E G G VL GLAKRID+ L+A  ++ +
Sbjct: 241 KAIKDALIRQLYNPVRWTETVQKLKAEDAINLLECGPGNVLCGLAKRIDRELNAAPLASL 300

Query: 303 EDIDLALRS 311
           +  + AL +
Sbjct: 301 DKFEAALSA 309


>gi|187928011|ref|YP_001898498.1| cyclic nucleotide-binding protein [Ralstonia pickettii 12J]
 gi|187724901|gb|ACD26066.1| cyclic nucleotide-binding protein [Ralstonia pickettii 12J]
          Length = 309

 Score =  225 bits (573), Expect = 7e-57,   Method: Compositional matrix adjust.
 Identities = 129/294 (43%), Positives = 164/294 (55%), Gaps = 4/294 (1%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M+    FPGQGSQ +GM  + +   P       E    L Q++  L+  G  EEL  T N
Sbjct: 1   MTFAFVFPGQGSQSVGM-LNAFADHPAVAATLVEASDALGQDIGKLIAEGPAEELNLTTN 59

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
            QP +   ++A  R  +  G       + VAGHSLGEY+AL AA A +  D + LVR R 
Sbjct: 60  TQPVMLTAAVAVYRAWQAAGGPTP---TVVAGHSLGEYSALVAAGAIAFQDAVPLVRFRA 116

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           K+MQEAVP G G M AI+GL D  V + CA+AS  G+ E  N N   QVVI+G + AV+ 
Sbjct: 117 KAMQEAVPVGEGGMAAILGLSDDDVRAACAEASVAGVVEAVNFNAPAQVVIAGAKAAVEK 176

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A +    KGAKRA+ LPVSAPFHSSL+ P S  ++  L +V    PV+P++ N   + VS
Sbjct: 177 ACEIAKAKGAKRALPLPVSAPFHSSLLKPASDRLREYLANVAVTTPVIPVINNVDVAVVS 236

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSL 294
               I   LV Q    VRW ETIQ     G+  V E G GKVL GL KRID  +
Sbjct: 237 DPAAIKDALVRQAASPVRWVETIQKMKGDGITRVVECGPGKVLAGLVKRIDGEI 290


>gi|46908040|ref|YP_014429.1| acyl-carrier-protein S-malonyltransferase [Listeria monocytogenes
           serotype 4b str. F2365]
 gi|47094534|ref|ZP_00232199.1| malonyl CoA-acyl carrier protein transacylase [Listeria
           monocytogenes str. 4b H7858]
 gi|46881310|gb|AAT04606.1| malonyl CoA-acyl carrier protein transacylase [Listeria
           monocytogenes serotype 4b str. F2365]
 gi|47017089|gb|EAL07957.1| malonyl CoA-acyl carrier protein transacylase [Listeria
           monocytogenes str. 4b H7858]
 gi|328466163|gb|EGF37320.1| malonyl CoA-acyl carrier protein transacylase [Listeria
           monocytogenes 1816]
          Length = 313

 Score =  225 bits (573), Expect = 7e-57,   Method: Compositional matrix adjust.
 Identities = 121/302 (40%), Positives = 181/302 (59%), Gaps = 5/302 (1%)

Query: 5   LTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPA 64
             FPGQG+Q IGMG+D+   +PEA+ ++++ D  L  ++++++  G  E LT + NAQPA
Sbjct: 6   FVFPGQGAQKIGMGQDVAAEYPEAKKIYDDADERLGFSITEIITEGPIELLTKSENAQPA 65

Query: 65  LTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQ 124
           L + S+A +R +E  G  VK D  YVAGHSLGEY+AL A      SD I LVR RG+ M+
Sbjct: 66  LVSTSVAILRALETYG--VKAD--YVAGHSLGEYSALVAGGFLEASDAIYLVRKRGELME 121

Query: 125 EAVPPGLGSMVAIIGLDDCVVDSICAQASRVG-ICEIANDNGGGQVVISGLQDAVKCAAD 183
            AVP G G+M A++G+D   + +I  + ++ G   ++AN N  GQ+VISG    V+ A  
Sbjct: 122 AAVPNGAGAMAAVLGVDRETLKTITEEVTKEGDAVQLANLNCPGQIVISGTTAGVEKAGG 181

Query: 184 TCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSID 243
                GAKR + L VS PFHSSLM P +   + +L  V   D  +P++ N  A   +   
Sbjct: 182 KAKESGAKRVLPLAVSGPFHSSLMEPAALAFRDVLAEVKISDGQIPVVNNVDAKETTDKS 241

Query: 244 EISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVE 303
           EIS  L++Q+   V W + ++    +GV +  E+GSGKVL GL K+I++ ++ +S    E
Sbjct: 242 EISDKLIKQIYSPVLWEDIVEELIKNGVDTFVEIGSGKVLVGLIKKINRDVTVLSAGDAE 301

Query: 304 DI 305
            +
Sbjct: 302 SV 303


>gi|307262496|ref|ZP_07544141.1| Malonyl CoA-acyl carrier protein transacylase [Actinobacillus
           pleuropneumoniae serovar 12 str. 1096]
 gi|306867873|gb|EFM99704.1| Malonyl CoA-acyl carrier protein transacylase [Actinobacillus
           pleuropneumoniae serovar 12 str. 1096]
          Length = 311

 Score =  225 bits (573), Expect = 8e-57,   Method: Compositional matrix adjust.
 Identities = 128/304 (42%), Positives = 178/304 (58%), Gaps = 4/304 (1%)

Query: 5   LTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPA 64
           + FPGQGSQ +GM  DL  ++P     F +    L  +L DL+ NG+ E+L  T   QPA
Sbjct: 6   MVFPGQGSQAVGMLADLAAAYPIVEETFRQASDVLGYDLWDLVQNGTAEDLGQTQRTQPA 65

Query: 65  LTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQ 124
           L A S+A  RV ++    +K   S +AGHSLGEY+AL  A      D I+LV  RG +MQ
Sbjct: 66  LLASSVAIYRVWQQKYPELKP--SVMAGHSLGEYSALVCAGVLDFQDAIKLVELRGNAMQ 123

Query: 125 EAVPPGLGSMVAIIGLDDCVVDSICAQA-SRVG-ICEIANDNGGGQVVISGLQDAVKCAA 182
           +AVP   G+M AIIGLD+  + + C QA + VG I    N N  GQVVI+G + A + A 
Sbjct: 124 QAVPASTGAMYAIIGLDNEAIINACEQAQAEVGEIVSAVNFNSPGQVVIAGTKAAAEKAG 183

Query: 183 DTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSI 242
           + C   GAKRA+ L VS P H +LM P +  +   L ++T   P+VP++ N   S  +  
Sbjct: 184 ELCKAAGAKRALPLAVSVPSHCALMKPAADKLAEALQNITLNAPIVPVINNVDVSVETDA 243

Query: 243 DEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKV 302
           + I   LV Q+   VRW ET++  AN GV ++YE+G GKVLTGL  RI K L A +++ +
Sbjct: 244 EAIRNELVRQLYSPVRWTETVEKMANEGVTTLYEIGPGKVLTGLTSRIVKELKAQAVNDL 303

Query: 303 EDID 306
             ++
Sbjct: 304 VSLE 307


>gi|255023998|ref|ZP_05295984.1| malonyl CoA-acyl carrier protein transacylase [Listeria
           monocytogenes FSL J1-208]
          Length = 306

 Score =  225 bits (573), Expect = 8e-57,   Method: Compositional matrix adjust.
 Identities = 121/300 (40%), Positives = 182/300 (60%), Gaps = 5/300 (1%)

Query: 7   FPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPALT 66
           FPGQG+Q IGMG+D+   +PEA+ ++++ D  L  ++++++  G  E LT + NAQPAL 
Sbjct: 1   FPGQGAQKIGMGQDVAAEYPEAKKIYDDADERLGFSITEIITEGPIELLTKSENAQPALV 60

Query: 67  AVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQEA 126
           + S+A +R +E  G  VK D  YVAGHSLGEY+AL A      SD I LVR RG+ M+ A
Sbjct: 61  STSVAILRALETYG--VKAD--YVAGHSLGEYSALVAGGFLEASDAIYLVRKRGELMEAA 116

Query: 127 VPPGLGSMVAIIGLDDCVVDSICAQASRVG-ICEIANDNGGGQVVISGLQDAVKCAADTC 185
           VP G G+M A++G+D   + +I  + ++ G   ++AN N  GQ+VISG    V+ A +  
Sbjct: 117 VPNGAGAMAAVLGVDRETLKAITEEVTKEGDAVQLANLNCPGQIVISGTTAGVEKAGEKA 176

Query: 186 LNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSIDEI 245
              GAKR + L VS PFHSSLM P +   + +L  V   D  +P++ N  A   +   EI
Sbjct: 177 KANGAKRVLPLAVSGPFHSSLMEPAALAFRDILAEVEISDGNIPVVNNVDAKQTTDKAEI 236

Query: 246 SRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVEDI 305
           S  L++Q+   V W + ++    +GV +  E+GSGKVL GL K+I++ ++ +S    E +
Sbjct: 237 SDKLIKQIYSPVLWEDIVEELIKNGVDTFVEIGSGKVLAGLIKKINRDVTVLSAGDAESV 296


>gi|159897274|ref|YP_001543521.1| malonyl CoA-acyl carrier protein transacylase [Herpetosiphon
           aurantiacus ATCC 23779]
 gi|159890313|gb|ABX03393.1| malonyl CoA-acyl carrier protein transacylase [Herpetosiphon
           aurantiacus ATCC 23779]
          Length = 310

 Score =  224 bits (572), Expect = 9e-57,   Method: Compositional matrix adjust.
 Identities = 131/305 (42%), Positives = 187/305 (61%), Gaps = 5/305 (1%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M+  L FPGQGSQ +GMGR++Y+  P AR +F E +  L  +L+ L ++G + +LTAT N
Sbjct: 1   MTIGLLFPGQGSQKVGMGREVYEQSPAARAIFAEANAVLGFDLAGLCFDGPEADLTATEN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
            QPAL  VS+A +  + + G  V    S VAGHSLGEY+AL AAKA   +  +RLVR RG
Sbjct: 61  TQPALLTVSVALLAAIAEAG--VDLHPSIVAGHSLGEYSALVAAKALDFATALRLVRQRG 118

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           + M +A     G+M A+IGLD   +++ICA  S++G C +AN N  GQ+VISG   AV  
Sbjct: 119 ELMAQASE---GAMAAVIGLDLGPLEAICANVSKLGACVVANQNAHGQLVISGASAAVAA 175

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A++     GAK+ + L VSA FHS LM   +  +   + +       VP++ N  A P+ 
Sbjct: 176 ASEQAKAAGAKKIMPLNVSAAFHSPLMAATAAGLAPAIAAAAMSAAHVPLIANSTAQPIQ 235

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
             +++   L+ Q+T  VRW  TI+  A  GV+ V E+G+G VLTGL KRID +L  ++I+
Sbjct: 236 RAEDLRAELIAQITAPVRWIATIEQAAAMGVQIVIEIGAGSVLTGLVKRIDPNLQRLNIA 295

Query: 301 KVEDI 305
             +DI
Sbjct: 296 NFDDI 300


>gi|192359314|ref|YP_001982154.1| malonyl CoA-acyl carrier protein transacylase [Cellvibrio japonicus
           Ueda107]
 gi|190685479|gb|ACE83157.1| malonyl CoA-acyl carrier protein transacylase [Cellvibrio japonicus
           Ueda107]
          Length = 312

 Score =  224 bits (572), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 123/308 (39%), Positives = 178/308 (57%), Gaps = 3/308 (0%)

Query: 5   LTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPA 64
             FPGQGSQ IGM  +L   +P  +  F E    L  +L  L+  GSQEE+  T   QP 
Sbjct: 8   FVFPGQGSQKIGMLAELAAEYPIVQSTFAEASEVLGYDLWALVQTGSQEEINLTERTQPL 67

Query: 65  LTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQ 124
           L   S+A  RV  + G       + VAGHSLGE++AL  A        +++V+ RG+ MQ
Sbjct: 68  LLTASVAVWRVWNQKG---GAQPALVAGHSLGEWSALVCAGVVDFKAAVKIVQLRGRYMQ 124

Query: 125 EAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAADT 184
           EAVP G+G+M AIIGLDD ++   C +A +  +    N N  GQVVI+G   AV+ A+  
Sbjct: 125 EAVPAGVGAMAAIIGLDDELIKDACKKAEQGDVVAAVNFNSPGQVVIAGTAAAVERASAL 184

Query: 185 CLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSIDE 244
           C   GAKRA+ LPVSAPFH+ LM P ++ +  ++ +     P +P++ N  A+  S+ ++
Sbjct: 185 CKEAGAKRALPLPVSAPFHTELMRPAAERLADLVSATVFSVPSIPVVHNVTAATESNPEK 244

Query: 245 ISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVED 304
           I  L++EQ+   VRW + +      G  +  E G GKVL+GL KRI   LSA+S+ K E+
Sbjct: 245 IKALMIEQIYSPVRWVDCVNTMVELGATTTIECGPGKVLSGLNKRIAAQLSALSVEKPEE 304

Query: 305 IDLALRSI 312
           +D+ L ++
Sbjct: 305 LDVVLAAV 312


>gi|309789632|ref|ZP_07684213.1| malonyl CoA-acyl carrier protein transacylase [Oscillochloris
           trichoides DG6]
 gi|308228368|gb|EFO82015.1| malonyl CoA-acyl carrier protein transacylase [Oscillochloris
           trichoides DG6]
          Length = 330

 Score =  224 bits (572), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 134/310 (43%), Positives = 174/310 (56%), Gaps = 8/310 (2%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M+    FPGQGSQ +GMG DLY   P AR +FE+ D  L   LS L + G +  LTAT N
Sbjct: 19  MNAAWVFPGQGSQTVGMGHDLYVHSPTARAIFEQADEVLGFALSHLCFEGPETALTATEN 78

Query: 61  AQPALTAVSMAFIRVMEK-NGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRAR 119
           AQPAL  VS+A +RV+E+  G  + R ++ VAGHSLGEY+AL A  A   +  +RLVR R
Sbjct: 79  AQPALLTVSIALVRVLEEIGGAALVRPLA-VAGHSLGEYSALVAGGALDFATALRLVRRR 137

Query: 120 GKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQAS---RVGICEIANDNGGGQVVISGLQD 176
           G+ M  A     GSM A+IGL    ++ IC Q +     G   IAN N   Q+VISG   
Sbjct: 138 GELMAAAHE---GSMAAVIGLAQPDLEQICEQVNSGDHGGTVVIANYNAPDQLVISGSAA 194

Query: 177 AVKCAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCA 236
           AV  A       GAKR + L VSA FHS LM   ++ M   +     +D  VP++ N  A
Sbjct: 195 AVAQAGQIAKEHGAKRVLGLKVSAAFHSPLMQAAAEGMAHEIAQAEVRDLEVPLIANVSA 254

Query: 237 SPVSSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSA 296
            P+ S DE+ R +V QVT  VRW  + +    HG  +  E+G GKVLTGL +RI      
Sbjct: 255 EPLRSADEVRREVVTQVTAPVRWIASTEAMLAHGCTTFVEIGPGKVLTGLVRRIAPQARL 314

Query: 297 VSISKVEDID 306
           V++S   D+ 
Sbjct: 315 VTLSSWADVQ 324


>gi|83748454|ref|ZP_00945476.1| Malonyl-CoA-[acyl-carrier-protein] transacylase [Ralstonia
           solanacearum UW551]
 gi|207743602|ref|YP_002259994.1| malonyl coa-[acyl-carrier-protein] transacylase [Ralstonia
           solanacearum IPO1609]
 gi|83724865|gb|EAP72021.1| Malonyl-CoA-[acyl-carrier-protein] transacylase [Ralstonia
           solanacearum UW551]
 gi|206595001|emb|CAQ61928.1| malonyl coa-[acyl-carrier-protein] transacylase [Ralstonia
           solanacearum IPO1609]
          Length = 309

 Score =  224 bits (572), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 129/291 (44%), Positives = 164/291 (56%), Gaps = 4/291 (1%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M+    FPGQGSQ +GM  + +   P       E    L Q++  L+  G  +EL  T N
Sbjct: 1   MTFAFVFPGQGSQSVGM-LNAFADHPAVAATLAEASDALGQDIGKLIAEGPADELNLTTN 59

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
            QP +   ++A  R  +  G  V    + VAGHSLGEY+AL AA A +  D + LVR R 
Sbjct: 60  TQPVMLTAAVAVYRAWQAAGGPVP---TVVAGHSLGEYSALVAAGAIAFKDAVPLVRFRA 116

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           K+MQEAVP G G M AI+GL D  V + CA+AS  G+ E  N N   QVVI+G + AV+ 
Sbjct: 117 KAMQEAVPVGEGGMAAILGLSDDDVRAACAEASIAGVVEAVNFNAPAQVVIAGAKAAVEK 176

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A +    KGAKRA+ LPVSAPFHSSL+ P S  ++  L SVT   P +P++ N   + VS
Sbjct: 177 ACEVAKAKGAKRALPLPVSAPFHSSLLKPASDRLRDYLASVTVSAPSIPVINNVDVAVVS 236

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRID 291
               I   LV Q    VRW ET+Q     G+  V E G GKVL GL KRID
Sbjct: 237 DPVTIKDALVRQAASPVRWVETVQKMKADGITRVVECGPGKVLAGLTKRID 287


>gi|207725227|ref|YP_002255623.1| malonyl coa-[acyl-carrier-protein] transacylase [Ralstonia
           solanacearum MolK2]
 gi|206590461|emb|CAQ37423.1| malonyl coa-[acyl-carrier-protein] transacylase [Ralstonia
           solanacearum MolK2]
          Length = 309

 Score =  224 bits (572), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 129/291 (44%), Positives = 164/291 (56%), Gaps = 4/291 (1%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M+    FPGQGSQ +GM  + +   P       E    L Q++  L+  G  +EL  T N
Sbjct: 1   MTFAFVFPGQGSQSVGM-LNAFADHPAVAATLAEASDALGQDIGKLIAEGPADELNLTTN 59

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
            QP +   ++A  R  +  G  V    + VAGHSLGEY+AL AA A +  D + LVR R 
Sbjct: 60  TQPVMLTAAVAVYRAWQAAGGPVP---TVVAGHSLGEYSALVAAGAIAFKDAVPLVRFRA 116

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           K+MQEAVP G G M AI+GL D  V + CA+AS  G+ E  N N   QVVI+G + AV+ 
Sbjct: 117 KAMQEAVPVGEGGMAAILGLSDDDVRAACAEASIAGVVEAVNFNAPAQVVIAGAKAAVEK 176

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A +    KGAKRA+ LPVSAPFHSSL+ P S  ++  L SVT   P +P++ N   + VS
Sbjct: 177 ACEVAKAKGAKRALPLPVSAPFHSSLLKPASDRLRDYLASVTVSAPSIPVINNVDVAVVS 236

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRID 291
               I   LV Q    VRW ET+Q     G+  V E G GKVL GL KRID
Sbjct: 237 DPVAIKDALVRQAASPVRWVETVQKMKADGITRVVECGPGKVLAGLTKRID 287


>gi|292487954|ref|YP_003530831.1| malonyl CoA-acyl carrier protein transacylase [Erwinia amylovora
           CFBP1430]
 gi|292899173|ref|YP_003538542.1| malonyl CoA-acyl carrier protein transacylase [Erwinia amylovora
           ATCC 49946]
 gi|291199021|emb|CBJ46132.1| malonyl CoA-acyl carrier protein transacylase [Erwinia amylovora
           ATCC 49946]
 gi|291553378|emb|CBA20423.1| malonyl CoA-acyl carrier protein transacylase [Erwinia amylovora
           CFBP1430]
 gi|312172079|emb|CBX80336.1| malonyl CoA-acyl carrier protein transacylase [Erwinia amylovora
           ATCC BAA-2158]
          Length = 309

 Score =  224 bits (571), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 126/306 (41%), Positives = 173/306 (56%), Gaps = 3/306 (0%)

Query: 5   LTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPA 64
           + FPGQGSQ  GM  DL  + P     F E    L  +L  L+  G  EEL  T   QPA
Sbjct: 6   MVFPGQGSQATGMLADLAAANPLVEKTFREASDALGYDLWQLVQQGPAEELNKTWQTQPA 65

Query: 65  LTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQ 124
           L A S+A  RV ++ G    +  + +AGHSLGEY+AL  A   + +D ++LV  RGK MQ
Sbjct: 66  LLAASVAIFRVWQEKG---GKAPAILAGHSLGEYSALVCAGVIAFADAVKLVELRGKLMQ 122

Query: 125 EAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAADT 184
           EAVP G G+M AIIGLDD  +   C ++++  +    N N  GQVVI+G ++AV+ A   
Sbjct: 123 EAVPAGTGAMQAIIGLDDASIAKACEESAQGQVVSPVNFNSPGQVVIAGHKEAVERAGTA 182

Query: 185 CLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSIDE 244
           C   GAKRA+ LPVS P H +LM P +  +   L  +T   PV P++ N      ++ + 
Sbjct: 183 CKAAGAKRALPLPVSVPSHCALMKPAADKLAVALQQLTFNAPVFPVVNNVDVKIETAPEA 242

Query: 245 ISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVED 304
           I   LV Q+   VRW E++++ A  GV S+ E G GKVLTGL KRI  +L+A  ++    
Sbjct: 243 IRSALVRQLYSPVRWTESVEFIARQGVISLLEAGPGKVLTGLTKRIVDTLTAAPVNDQAS 302

Query: 305 IDLALR 310
           +  AL 
Sbjct: 303 LSAALE 308


>gi|167563540|ref|ZP_02356456.1| malonyl CoA-acyl carrier protein transacylase [Burkholderia
           oklahomensis EO147]
 gi|167570700|ref|ZP_02363574.1| malonyl CoA-acyl carrier protein transacylase [Burkholderia
           oklahomensis C6786]
          Length = 310

 Score =  224 bits (571), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 131/313 (41%), Positives = 176/313 (56%), Gaps = 10/313 (3%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHT---LNQNLSDLMWNGSQEELTA 57
           M     FPGQGSQ +GM     ++F +  +V E +D     L Q++  L+ +G  +EL  
Sbjct: 1   MKFAFVFPGQGSQSVGM----LNAFADVAVVRETLDEASDVLGQDIGKLIADGPADELNL 56

Query: 58  TCNAQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVR 117
           T N QP +   + A  R  ++ G       S VAGHSLGEYTAL AA A +  D + LVR
Sbjct: 57  TTNTQPVMLTAAYACYRAWQQAG---GARPSIVAGHSLGEYTALVAAGAIAFRDALPLVR 113

Query: 118 ARGKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDA 177
            R ++MQ AVP G G M AI+GLDD  V ++CA+AS  G+ E  N N   QVVI+G +  
Sbjct: 114 FRAQAMQTAVPVGEGGMAAILGLDDDTVRAVCAEASAAGVVEAVNFNAPAQVVIAGTKAG 173

Query: 178 VKCAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCAS 237
           ++ A +    KGAKRA+ L VSAPFHSSL+ P S  ++  L +V  + P +P++ N   +
Sbjct: 174 IEKACEIAKAKGAKRALPLQVSAPFHSSLLKPASDKLREYLANVDVKAPQIPVVNNIDVA 233

Query: 238 PVSSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAV 297
             S    I   LV Q  G VRW E ++  A  GV  V E G GKVL GL KRID +L   
Sbjct: 234 VASDPAAIKDALVRQAAGPVRWVECVKHIAGQGVTHVIECGPGKVLAGLTKRIDTNLVGA 293

Query: 298 SISKVEDIDLALR 310
           S+     +D AL+
Sbjct: 294 SVFDPASLDEALK 306


>gi|221635852|ref|YP_002523728.1| malonyl CoA-acyl carrier protein transacylase [Thermomicrobium
           roseum DSM 5159]
 gi|221157353|gb|ACM06471.1| malonyl CoA-acyl carrier protein transacylase [Thermomicrobium
           roseum DSM 5159]
          Length = 316

 Score =  224 bits (571), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 124/309 (40%), Positives = 178/309 (57%), Gaps = 7/309 (2%)

Query: 5   LTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPA 64
           L FPGQGSQ +GMG+ ++     AR +F + +  L   L  L + G  EEL  T NAQPA
Sbjct: 13  LLFPGQGSQHVGMGQRVHQLSEAARRIFVQAEEILGLPLRRLCFEGPAEELADTANAQPA 72

Query: 65  LTAVSMAFIRVMEKN--GLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKS 122
           +  VS+A++  + +    L      S VAGHSLGE+TAL AA A    D +RLVR RG+ 
Sbjct: 73  ILTVSLAYLEALRERLRELGASLQPSMVAGHSLGEFTALVAANALRFEDALRLVRERGRL 132

Query: 123 MQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAA 182
           M+E      G M A+IGL+   ++ +C +AS +G+  +ANDN  GQ+VISG + A++ A 
Sbjct: 133 MREVSQERPGGMAAVIGLERDALEEVCREASELGLVVVANDNSPGQLVISGEEQALQRAM 192

Query: 183 DTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSI 242
           +    +GAKR V L V    HS LM  V+  +  ML  +  ++P +PI+ N     +S++
Sbjct: 193 ELAQRRGAKRVVRLGVMVASHSPLMERVAHALAEMLARIPLREPEIPIVANVTGRILSTV 252

Query: 243 DEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKV 302
           +EI R L  QV   V+W  +++   N GV +  EVG G+VLTGL K+I + + A S+   
Sbjct: 253 EEIRRELACQVAQPVQWTTSVREMTNRGVTTFLEVGPGQVLTGLVKKIQRDVEAYSMR-- 310

Query: 303 EDIDLALRS 311
              DL L S
Sbjct: 311 ---DLGLES 316


>gi|284920917|emb|CBG33980.1| malonyl CoA-acyl carrier protein transacylase [Escherichia coli
           042]
          Length = 309

 Score =  224 bits (570), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 126/306 (41%), Positives = 173/306 (56%), Gaps = 3/306 (0%)

Query: 5   LTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPA 64
             FPGQGSQ +GM  D+  S+P     F E    L  +L  L   G  EEL  T   QPA
Sbjct: 6   FVFPGQGSQTVGMLADMAASYPIVEETFAEASAALGYDLWALTQQGPAEELNKTWQTQPA 65

Query: 65  LTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQ 124
           L   S+A  RV ++ G    +  + +AGHSLGEY+AL  A     +D +RLV  RGK MQ
Sbjct: 66  LLTASVALYRVWQQQG---GKAPAMMAGHSLGEYSALVCAGVIDFADAVRLVEMRGKFMQ 122

Query: 125 EAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAADT 184
           EAVP G G+M AIIGLDD  +   C +A+   +    N N  GQVVI+G ++AV+ A   
Sbjct: 123 EAVPEGTGAMAAIIGLDDASIAKACEEAAEGQVVSPVNFNSPGQVVIAGHKEAVERAGVA 182

Query: 185 CLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSIDE 244
           C   GAKRA+ LPVS P H +LM P +  +   L  +T     VP++ N      ++ D 
Sbjct: 183 CKAAGAKRALPLPVSVPSHCALMKPAADKLAVELAKITFNASTVPVVNNVDVKCETNGDA 242

Query: 245 ISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVED 304
           I   LV Q+   V+W +++++ A  GV+ +YEVG GKVLTGL KRI  +L+A ++++   
Sbjct: 243 IRDALVRQLYNPVQWTKSVEYMAAQGVEHLYEVGPGKVLTGLTKRIVDTLTASALNEPSA 302

Query: 305 IDLALR 310
           +  AL 
Sbjct: 303 MAAALE 308


>gi|240950198|ref|ZP_04754485.1| malonyl CoA-acyl carrier protein transacylase (MCT) [Actinobacillus
           minor NM305]
 gi|240295285|gb|EER46071.1| malonyl CoA-acyl carrier protein transacylase (MCT) [Actinobacillus
           minor NM305]
          Length = 311

 Score =  224 bits (570), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 125/304 (41%), Positives = 178/304 (58%), Gaps = 4/304 (1%)

Query: 5   LTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPA 64
           + FPGQGSQ +GM  DL   +P     F++    L  +L DL+ NG+ E+L  T   QPA
Sbjct: 6   MVFPGQGSQAVGMLADLAPVYPVVEQTFKQASDVLGYDLWDLVQNGTAEDLGKTERTQPA 65

Query: 65  LTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQ 124
           L A S+A  R+ ++     ++  + +AGHSLGEY+AL  A      D I+LV  RG++MQ
Sbjct: 66  LLAASVALYRIWQEK--FPEQKPAVMAGHSLGEYSALVCAGVLDFQDAIKLVELRGQAMQ 123

Query: 125 EAVPPGLGSMVAIIGLDDCVVDSICAQA-SRVG-ICEIANDNGGGQVVISGLQDAVKCAA 182
            AVP G G+M AIIGLD+  +   C QA S VG +    N N  GQVVI+G + A + A 
Sbjct: 124 SAVPAGTGAMFAIIGLDNEAIIKACEQAASEVGEVVSAVNFNSPGQVVIAGTKAAAERAG 183

Query: 183 DTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSI 242
           + C   GAKRA+ L VS P H +LM P ++ +   L +++   P+VP++ N   +  +  
Sbjct: 184 ELCKEAGAKRALPLAVSVPSHCALMKPAAEKLAAALQNISLNAPLVPVINNVDVAVETDA 243

Query: 243 DEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKV 302
           D+I   LV Q+   VRW ET++  A  GV ++YE+G  KVLTGL  RI K LSA +++ V
Sbjct: 244 DKIRDALVRQLYSPVRWTETVEKMAQEGVTTLYEIGPNKVLTGLTSRIVKELSAKAVNDV 303

Query: 303 EDID 306
              +
Sbjct: 304 ASFE 307


>gi|319779252|ref|YP_004130165.1| Malonyl CoA-acyl carrier protein transacylase [Taylorella
           equigenitalis MCE9]
 gi|317109276|gb|ADU92022.1| Malonyl CoA-acyl carrier protein transacylase [Taylorella
           equigenitalis MCE9]
          Length = 311

 Score =  224 bits (570), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 131/315 (41%), Positives = 180/315 (57%), Gaps = 7/315 (2%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M   + FPGQGSQ IGM     DS P  + V ++    L Q+++ L+  G + +L  T N
Sbjct: 1   MKIAIVFPGQGSQTIGMLDSWVDS-PVVQNVLKKATEALGQDIATLIHEGPEHDLNLTTN 59

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
            QP + A S A  +  E+ GL      S +AGHSLGEYTAL A+  F L D +++VR R 
Sbjct: 60  TQPVMLASSYALYKAYEEAGL---PQASVMAGHSLGEYTALTASGVFQLEDVVKIVRVRA 116

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVG--ICEIANDNGGGQVVISGLQDAV 178
            SMQ+ VP G G M AIIGL D  V   C + S     + E  N N   QVVI+G + AV
Sbjct: 117 NSMQDVVPVGSGGMAAIIGLSDEKVIETCRRVSEQSGEVVEAVNFNAPSQVVIAGHKAAV 176

Query: 179 KCAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASP 238
             A + C  +GAKRA+ LPVSAPFHSSL+ P ++V++  L     Q PV+P++ N     
Sbjct: 177 VTACEVCKQEGAKRALVLPVSAPFHSSLLEPAARVLESELSKYELQKPVIPVINNVDVEI 236

Query: 239 VSSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVS 298
             S +EI   LV Q    VRW ET+Q  ++ G+  V E G GKVL+ LAKRI   +  ++
Sbjct: 237 KDSPEEIVDALVRQAWHPVRWVETMQKLSDLGITHVIECGPGKVLSNLAKRILPEIEVLT 296

Query: 299 ISKVEDIDLALRSIV 313
           I+   D++  L+S++
Sbjct: 297 INNPCDLE-NLKSVL 310


>gi|88705142|ref|ZP_01102854.1| malonyl CoA-acyl carrier protein transacylase [Congregibacter
           litoralis KT71]
 gi|88700837|gb|EAQ97944.1| malonyl CoA-acyl carrier protein transacylase [Congregibacter
           litoralis KT71]
          Length = 315

 Score =  224 bits (570), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 133/310 (42%), Positives = 175/310 (56%), Gaps = 5/310 (1%)

Query: 5   LTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPA 64
             FPGQGSQ +GM  +    FPEA  VFEE    L  +L  L+  G  E+L  T   QPA
Sbjct: 7   FMFPGQGSQRVGMLGEAIAEFPEAATVFEECSDALGFDLKALVTEGDPEQLNLTEFTQPA 66

Query: 65  LTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQ 124
           L A S+A  RV    G         +AGHSLGE++ALC A A SL D + LVR RG+ MQ
Sbjct: 67  LLAASVAIWRVWSAAG---GVRPGAMAGHSLGEFSALCCAGALSLKDAVTLVRERGRFMQ 123

Query: 125 EAVPPGLGSMVAIIGLDDCVVDSICAQ--ASRVGICEIANDNGGGQVVISGLQDAVKCAA 182
            AVP G+G+M AI+GLDD VV + C +  A    I +  N N  GQVVI+G   AV+ A 
Sbjct: 124 TAVPVGVGAMAAILGLDDDVVTACCDELSAGAQEIVQAVNFNAPGQVVIAGHSAAVEKAI 183

Query: 183 DTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSI 242
                 GAKRA+ LPVSAPFH+SLM P  + +  +LD +    P +P++ N  A+  +  
Sbjct: 184 AVLKESGAKRAMPLPVSAPFHTSLMRPAGEKLAEVLDGIAIASPEIPVVHNVNAATETDP 243

Query: 243 DEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKV 302
           + I +LLVEQ+   V W   +    + G     E G+GKVL GL +RIDKSL  V +   
Sbjct: 244 ETIRQLLVEQIAAPVLWTSCVSSLQSMGATQFAECGAGKVLGGLLRRIDKSLGCVYLENP 303

Query: 303 EDIDLALRSI 312
           +D+  A  ++
Sbjct: 304 DDLRAAATAL 313


>gi|315303709|ref|ZP_07874223.1| malonyl CoA-acyl carrier protein transacylase [Listeria ivanovii
           FSL F6-596]
 gi|313627922|gb|EFR96541.1| malonyl CoA-acyl carrier protein transacylase [Listeria ivanovii
           FSL F6-596]
          Length = 313

 Score =  223 bits (569), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 124/305 (40%), Positives = 183/305 (60%), Gaps = 11/305 (3%)

Query: 5   LTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPA 64
             FPGQG+Q IGMG+D+   +PEA+ VF++ D  L  ++++++  G  E LT + NAQPA
Sbjct: 6   FVFPGQGAQKIGMGQDVAAEYPEAKKVFDDADARLGFSITEIITEGPIELLTKSENAQPA 65

Query: 65  LTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQ 124
           L + S+A +R +E  G  VK D  +VAGHSLGEY+AL A      SD I LVR RG+ M+
Sbjct: 66  LVSTSVAILRALETYG--VKAD--FVAGHSLGEYSALVAGGFLDASDAIYLVRKRGELME 121

Query: 125 EAVPPGLGSMVAIIGLD----DCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
            AVP G G+M A++GLD      + D + A    V   ++AN N  GQ+VISG  + V+ 
Sbjct: 122 AAVPNGKGAMAAVLGLDRDTLTAITDEVTATFDAV---QLANLNCPGQIVISGTAEGVEK 178

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A +    +GAKR + L VS PFHSSLM P ++  + +L  V   D  +P++ N  A    
Sbjct: 179 AGEKAKEQGAKRVLPLAVSGPFHSSLMEPAAQNFREVLAEVEISDGKIPVVNNVDAKQTM 238

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
               IS  L++Q+   V W +T++    +GV +  E+GSGKV TGL K+I++ ++ +S  
Sbjct: 239 DKAAISDKLIKQIYSPVLWEDTVEELIKNGVDTFIEIGSGKVXTGLIKKINRDVTVLSAG 298

Query: 301 KVEDI 305
            +E +
Sbjct: 299 DLESV 303


>gi|300704620|ref|YP_003746223.1| malonyl CoA-acyl carrier protein transacylase [Ralstonia
           solanacearum CFBP2957]
 gi|299072284|emb|CBJ43617.1| Malonyl CoA-acyl carrier protein transacylase [Ralstonia
           solanacearum CFBP2957]
          Length = 309

 Score =  223 bits (569), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 128/291 (43%), Positives = 164/291 (56%), Gaps = 4/291 (1%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M+    FPGQGSQ +GM  + +   P       E    L Q++  L+  G  +EL  T N
Sbjct: 1   MTFAFVFPGQGSQSVGM-LNAFADHPAVAATLAEASDALGQDIGKLIAEGPADELNLTTN 59

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
            QP +   ++A  R  +  G  V    + VAGHSLGEY+AL AA A +  D + LVR R 
Sbjct: 60  TQPVMLTAAVAVYRAWQAAGGPVP---TVVAGHSLGEYSALVAAGAIAFKDAVPLVRFRA 116

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           K+MQEAVP G G M AI+GL D  V + CA+AS  G+ E  N N   QVVI+G + AV+ 
Sbjct: 117 KAMQEAVPVGEGGMAAILGLSDDDVRAACAEASIAGVVEAVNFNAPAQVVIAGAKAAVEK 176

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A +    +GAKRA+ LPVSAPFHSSL+ P S  ++  L SVT   P +P++ N   + VS
Sbjct: 177 ACEVAKARGAKRALPLPVSAPFHSSLLKPASDRLRDYLASVTVSAPSIPVINNVDVAVVS 236

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRID 291
               I   LV Q    VRW ET+Q     G+  V E G GKVL GL KRID
Sbjct: 237 DPVAIKDALVRQAASPVRWVETVQKMKADGITRVVECGPGKVLAGLTKRID 287


>gi|329894951|ref|ZP_08270750.1| Malonyl CoA-acyl carrier protein transacylase [gamma
           proteobacterium IMCC3088]
 gi|328922680|gb|EGG30015.1| Malonyl CoA-acyl carrier protein transacylase [gamma
           proteobacterium IMCC3088]
          Length = 315

 Score =  223 bits (569), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 132/306 (43%), Positives = 179/306 (58%), Gaps = 5/306 (1%)

Query: 3   TVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQ 62
           T   FPGQGSQ   M  D Y      +  F E    L  +L DL+ +G QE L+ T N Q
Sbjct: 5   TAFVFPGQGSQAPQMLADYYQQSSIFKDTFVEASDALGFDLWDLIASGDQETLSLTANTQ 64

Query: 63  PALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKS 122
           P L A S+A  RV E   +C  +  + ++GHSLGE++AL AA + +L+D +RLVR RG+ 
Sbjct: 65  PVLLAASVAIYRVYES--MCGVKP-ALMSGHSLGEFSALTAAGSIALADAVRLVRRRGEL 121

Query: 123 MQEAVPPGLGSMVAIIGLDDCVVDSICAQ-ASRVG-ICEIANDNGGGQVVISGLQDAVKC 180
           MQ AVP G+G+M A+IGLDD V+   C Q AS  G + E  N N  GQVVI+G ++ V  
Sbjct: 122 MQAAVPAGVGAMGAVIGLDDHVIVETCQQVASDTGLVVEAVNFNAPGQVVIAGHKEGVAA 181

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A       GAKR + LPVSAPFH+SLM   ++ +   L ++    P V ++ N  A    
Sbjct: 182 AETALKGAGAKRIMPLPVSAPFHTSLMEAAAQALGESLAAIEIHSPAVGVVHNVSAETED 241

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
               I  LLV+Q+   VRW + +Q  A  GV+ + E G GKVL+GL KRIDK+L+ VS+S
Sbjct: 242 DPAVIRELLVKQLYSPVRWTQCVQSMATKGVQCLVECGPGKVLSGLGKRIDKNLACVSLS 301

Query: 301 KVEDID 306
             E ++
Sbjct: 302 SYEALE 307


>gi|303256993|ref|ZP_07343007.1| malonyl CoA-acyl carrier protein transacylase [Burkholderiales
           bacterium 1_1_47]
 gi|302860484|gb|EFL83561.1| malonyl CoA-acyl carrier protein transacylase [Burkholderiales
           bacterium 1_1_47]
          Length = 314

 Score =  223 bits (568), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 127/296 (42%), Positives = 167/296 (56%), Gaps = 4/296 (1%)

Query: 5   LTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPA 64
             FPGQGSQ +GM   L D  P  R   +E D  L   LS L+  G  EEL+ T N QPA
Sbjct: 8   FVFPGQGSQAVGMLSTLADE-PIVRETLKEADEALGFALSKLIAEGPAEELSLTVNTQPA 66

Query: 65  LTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQ 124
           L   S+A  R   + G    R    +AGHSLGEY+AL AA A   +D ++LVR R + MQ
Sbjct: 67  LVCASIAMYRFYLQEG---GRKPDLLAGHSLGEYSALVAAGALDFTDALQLVRYRAEQMQ 123

Query: 125 EAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAADT 184
            AVP G G+M AI+GL D  V ++C + +  G+ E  N N  GQVVI+G   AV+ A + 
Sbjct: 124 AAVPVGEGTMAAILGLSDDQVKTVCLECATNGVVEAVNFNTPGQVVIAGTVAAVQEAMEK 183

Query: 185 CLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSIDE 244
            L  GAKRA+ L VS PFHSSLM P +  M+  L +V  Q P +P+L N         D 
Sbjct: 184 SLAAGAKRAIKLNVSGPFHSSLMKPAALAMEEKLKTVDLQKPFLPVLHNVDVQIHEEPDV 243

Query: 245 ISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
           I  +L  QV   V W +T++     GV  +YEVG G  L+G+ KRI K ++A +++
Sbjct: 244 IRDVLAAQVASPVLWADTVRKMEEAGVMEIYEVGPGAALSGMVKRITKGITAKALN 299


>gi|37526724|ref|NP_930068.1| acyl carrier protein S-malonyltransferase [Photorhabdus luminescens
           subsp. laumondii TTO1]
 gi|36786156|emb|CAE15208.1| malonyl CoA-acyl carrier protein transacylase (MCT) [Photorhabdus
           luminescens subsp. laumondii TTO1]
          Length = 310

 Score =  223 bits (568), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 127/307 (41%), Positives = 172/307 (56%), Gaps = 3/307 (0%)

Query: 5   LTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPA 64
           + FPGQGSQ +GM  DL  +FP     F E    L  +L  L+  G +EEL  T   QPA
Sbjct: 6   MVFPGQGSQDLGMLADLATAFPVVEQTFAEASDVLGYDLWALVQQGPEEELNKTWQTQPA 65

Query: 65  LTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQ 124
           L A S+A  RV ++ G    +  S +AGHSLGEY+AL  A        IRLV  RGK MQ
Sbjct: 66  LLAASVAIWRVWQEKG---GKAPSLMAGHSLGEYSALVCAGVIDFKQAIRLVELRGKLMQ 122

Query: 125 EAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAADT 184
           EAVP G G+M  IIGLD+  +D  C + ++  I    N N  GQVVI+G ++AV+ A D 
Sbjct: 123 EAVPEGTGAMYVIIGLDNESIDRACKEVAQGQIVSPVNFNSPGQVVIAGEKEAVERAGDA 182

Query: 185 CLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSIDE 244
           C   GAKRA+ L VS P H +LM P +  +  +L+ +    P  P++ N       S + 
Sbjct: 183 CKAAGAKRALPLAVSVPSHCALMKPAADKLAVVLEGIEFGYPQFPVVNNVDVKIEQSAEA 242

Query: 245 ISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVED 304
           I   LV Q+   VRW ET+++    GV  + E+G G+VLTGL KRI  +LSA +++    
Sbjct: 243 IRHALVRQLYNPVRWTETVEFITEQGVGQLLEIGPGRVLTGLTKRIVNTLSAAAVNDTAS 302

Query: 305 IDLALRS 311
           +  AL +
Sbjct: 303 LITALEN 309


>gi|167856322|ref|ZP_02479052.1| Malonyl CoA-acyl carrier protein transacylase (MCT) [Haemophilus
           parasuis 29755]
 gi|167852552|gb|EDS23836.1| Malonyl CoA-acyl carrier protein transacylase (MCT) [Haemophilus
           parasuis 29755]
          Length = 311

 Score =  223 bits (568), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 125/300 (41%), Positives = 177/300 (59%), Gaps = 4/300 (1%)

Query: 5   LTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPA 64
           + FPGQGSQ +GM  DL   +P     F++    L  +L DL+ NG+ E+L  T   QPA
Sbjct: 6   MVFPGQGSQAVGMLADLAPVYPVVEQTFKQASDVLGYDLWDLVQNGTAEDLGKTERTQPA 65

Query: 65  LTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQ 124
           L A S+A  R+ ++     ++  + +AGHSLGEY+AL  A      D I+LV  RG++MQ
Sbjct: 66  LLAASVALYRIWQEK--FPEQKPAVMAGHSLGEYSALVCADVLDFQDAIKLVELRGQAMQ 123

Query: 125 EAVPPGLGSMVAIIGLDDCVVDSICAQA-SRVG-ICEIANDNGGGQVVISGLQDAVKCAA 182
            AVP G G+M AIIGLD+  +   C QA S +G +    N N  GQVVI+G + A + A 
Sbjct: 124 SAVPAGTGAMFAIIGLDNEAIIKACEQAASEIGEVVSAVNFNSPGQVVIAGTKAAAERAG 183

Query: 183 DTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSI 242
           + C   GAKRA+ L VS P H  LM P ++ +   L +++   P+VP++ N   +  +  
Sbjct: 184 ELCKEAGAKRALPLAVSVPSHCVLMKPAAEKLAAALQNISLNAPLVPVINNVDVAVETDA 243

Query: 243 DEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKV 302
           D+I   LV Q+   VRW ET++  A  GV ++YE+G  KVLTGLA RI K LSA +++ V
Sbjct: 244 DKIRDALVRQLYSPVRWTETVEKMAQDGVTTLYEIGPNKVLTGLAGRIVKELSAKAVNDV 303


>gi|269925135|ref|YP_003321758.1| malonyl CoA-acyl carrier protein transacylase [Thermobaculum
           terrenum ATCC BAA-798]
 gi|269788795|gb|ACZ40936.1| malonyl CoA-acyl carrier protein transacylase [Thermobaculum
           terrenum ATCC BAA-798]
          Length = 306

 Score =  223 bits (568), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 119/296 (40%), Positives = 176/296 (59%), Gaps = 2/296 (0%)

Query: 5   LTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPA 64
           L FPGQGSQ +GMG+ L+D+   AR VF+  D  L   LS L ++G +E+L  T NAQPA
Sbjct: 8   LVFPGQGSQYVGMGKALHDASEAAREVFKRADEILGFRLSHLCFSGPEEDLQDTINAQPA 67

Query: 65  LTAVSMAFIRVMEK--NGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKS 122
           +  VS+A +  +++  +   VK + S+VAGHSLGEYTAL AA      D +RLVR RG+ 
Sbjct: 68  IFTVSLATLAAIKEKLHEAGVKLNPSFVAGHSLGEYTALVAANVIDFEDGLRLVRERGRL 127

Query: 123 MQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAA 182
           M+E      G M A+IGLD+ V+   C +AS  GI  IAN N  GQ+VISG   A+  A 
Sbjct: 128 MKEEGEKIPGGMAAVIGLDEEVIQRACEEASSEGIVGIANSNSPGQIVISGELKALHRAM 187

Query: 183 DTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSI 242
           +    +GAK+ + LP+S   HS +M   +     ++  +  +DP +PI+ N     ++++
Sbjct: 188 ELLQQQGAKKVIKLPISIASHSPVMQRAAAQFAEIVSHMKLRDPQIPIVANVTGQILTNV 247

Query: 243 DEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVS 298
           ++I R L   +TG V+W ++I+   +HG     E+G  +VLTGL +RI   +  +S
Sbjct: 248 EDIRRELSHHITGPVQWTKSIREMLSHGTNGFIELGPKRVLTGLIQRISPGVDTIS 303


>gi|288817792|ref|YP_003432139.1| malonyl CoA-acyl carrier protein transacylase [Hydrogenobacter
           thermophilus TK-6]
 gi|288787191|dbj|BAI68938.1| malonyl CoA-acyl carrier protein transacylase [Hydrogenobacter
           thermophilus TK-6]
 gi|308751390|gb|ADO44873.1| malonyl CoA-acyl carrier protein transacylase [Hydrogenobacter
           thermophilus TK-6]
          Length = 310

 Score =  223 bits (568), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 123/306 (40%), Positives = 174/306 (56%), Gaps = 4/306 (1%)

Query: 7   FPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPALT 66
           FPGQGSQ +GMG D Y  F EA  VF   +  L  NL+D+++ G ++EL  T N QPAL 
Sbjct: 8   FPGQGSQYVGMGYDFYREFSEASDVFHSAEVALRYNLTDIIFKGPEDELNKTINTQPALL 67

Query: 67  AVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQEA 126
            VS+A   V++ NGL  K D  +VAGHSLGEYTAL       L + +RL   RGK MQEA
Sbjct: 68  TVSLAIYAVLKANGLP-KAD--FVAGHSLGEYTALAVVGGVELFEAVRLAYLRGKYMQEA 124

Query: 127 VPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAADTCL 186
           VP G+G+MVA++ L    V+  C  AS VG+ E AN N   QVVISG + AV+ A+    
Sbjct: 125 VPEGVGAMVAVLKLSPEKVEEACRLASDVGVVEPANYNSPEQVVISGERQAVEKASQIVK 184

Query: 187 NKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSIDEIS 246
             G K  + L VS P H SLM P +   +  L     ++  +P++ N+ A   +   EI 
Sbjct: 185 EMGGK-VISLKVSVPSHCSLMKPAADAFRLKLAQTPIKNIDLPLVQNYTAKAHTMAHEIR 243

Query: 247 RLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVEDID 306
             L  Q+   VRW +++Q+ A  GV +  E+G   VL+ L  +       +++ KVED++
Sbjct: 244 ENLYRQIFSSVRWYQSLQYMAEQGVDTFVEIGPKNVLSKLVVQTLPHARVMNVEKVEDVE 303

Query: 307 LALRSI 312
             ++++
Sbjct: 304 KVIKAL 309


>gi|262393768|ref|YP_003285622.1| malonyl CoA-acyl carrier protein transacylase [Vibrio sp. Ex25]
 gi|262337362|gb|ACY51157.1| malonyl CoA-acyl carrier protein transacylase [Vibrio sp. Ex25]
          Length = 307

 Score =  223 bits (567), Expect = 4e-56,   Method: Compositional matrix adjust.
 Identities = 126/304 (41%), Positives = 175/304 (57%), Gaps = 3/304 (0%)

Query: 5   LTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPA 64
           + FPGQGSQ +GM  +L + +   +  F E    L  +L  L+ NG  E+L  T   QPA
Sbjct: 6   IVFPGQGSQAVGMLAELGEQYDVVKQTFAEASDALGYDLWALVQNGPAEDLNETFRTQPA 65

Query: 65  LTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQ 124
           L A S+A  RV ++ GL      + +AGHSLGEY+AL  A      + I+LV  RGK MQ
Sbjct: 66  LLASSVAIWRVWQELGL---EQPANLAGHSLGEYSALVCAGVIDFKEAIKLVELRGKLMQ 122

Query: 125 EAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAADT 184
           EAVP G G+M AIIGL D  +   C  A++  +    N N  GQVVI+G +DAV+ A   
Sbjct: 123 EAVPAGTGAMYAIIGLADDAIAKACEDAAQGEVVSPVNFNSPGQVVIAGSKDAVERAGAL 182

Query: 185 CLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSIDE 244
           C   GAKRA+ LPVS P H +LM P ++ +   L+S+    P +P++ N      +   +
Sbjct: 183 CKEAGAKRALPLPVSVPSHCALMKPAAEKLAVALESIEFNSPQLPVINNVDVVAETDPAK 242

Query: 245 ISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVED 304
           I   LV Q+   VRW ET++     GV+ + E+G GKVLTGL KRI K+L+A +++ V  
Sbjct: 243 IKDALVRQLHSPVRWTETVELMHEQGVEQLLELGPGKVLTGLTKRIVKTLTAAAVNDVAS 302

Query: 305 IDLA 308
           +D A
Sbjct: 303 LDAA 306


>gi|33151881|ref|NP_873234.1| acyl carrier protein S-malonyltransferase [Haemophilus ducreyi
           35000HP]
 gi|33148102|gb|AAP95623.1| malonyl CoA-acyl carrier protein transacylase [Haemophilus ducreyi
           35000HP]
          Length = 311

 Score =  223 bits (567), Expect = 4e-56,   Method: Compositional matrix adjust.
 Identities = 126/303 (41%), Positives = 182/303 (60%), Gaps = 4/303 (1%)

Query: 5   LTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPA 64
           + FPGQGSQ +GM  +L   FP    VF E    L  +L  L+ +G+ EEL+ T   QPA
Sbjct: 6   MVFPGQGSQAVGMLAELATEFPIVEQVFAEASEVLGYDLWALVQHGTAEELSQTQRTQPA 65

Query: 65  LTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQ 124
           L A S+A  RV ++    +K   + +AGHSLGEY+AL  A   +  D I+LV  RG +MQ
Sbjct: 66  LLAASVAIYRVWQQKYPELKP--AMMAGHSLGEYSALVCAGVLNFQDAIKLVELRGNAMQ 123

Query: 125 EAVPPGLGSMVAIIGLDDCVVDSICAQAS-RVG-ICEIANDNGGGQVVISGLQDAVKCAA 182
           +AVP G G+M AIIGL++ ++ + C QA   +G +    N N  GQV I+G + AV+ AA
Sbjct: 124 QAVPAGSGAMYAIIGLENNLIINACQQAQLELGEVVSAVNFNSPGQVAIAGSKTAVEKAA 183

Query: 183 DTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSI 242
           + C   GAKRA+ L VS P H SLM P ++ +   L +++   P +P++ N   +  + +
Sbjct: 184 ELCKTAGAKRALPLAVSVPSHCSLMKPAAEELAAALQNISLNPPRIPVIHNVNVAVETDV 243

Query: 243 DEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKV 302
           D I   LVEQ+   VRW ETI+  A  G+ +++E+G  KVLTGLA RI K L+A +I+ +
Sbjct: 244 DAIRERLVEQLYSPVRWSETIEKMAEQGIDTLFEMGPNKVLTGLAGRIAKQLTAKAINDI 303

Query: 303 EDI 305
             +
Sbjct: 304 ASL 306


>gi|313632770|gb|EFR99736.1| malonyl CoA-acyl carrier protein transacylase [Listeria seeligeri
           FSL N1-067]
          Length = 313

 Score =  223 bits (567), Expect = 4e-56,   Method: Compositional matrix adjust.
 Identities = 122/302 (40%), Positives = 180/302 (59%), Gaps = 5/302 (1%)

Query: 5   LTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPA 64
             FPGQG+Q IGMG+D+   +PEA+ V+++ D  L  +++D++  G  E LT + NAQPA
Sbjct: 6   FVFPGQGAQKIGMGQDVAAEYPEAKKVYDDADARLGFSITDVIAEGPIELLTKSENAQPA 65

Query: 65  LTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQ 124
           L + S+A +R +E  G  VK D  +VAGHSLGEY+AL A      SD I LVR RG+ M+
Sbjct: 66  LVSTSVAILRALETYG--VKAD--FVAGHSLGEYSALVAGGFLEASDAIYLVRKRGELME 121

Query: 125 EAVPPGLGSMVAIIGLDDCVVDSICAQASRVG-ICEIANDNGGGQVVISGLQDAVKCAAD 183
            AVP G G+M A++G+D   + +I  + +  G   ++AN N  GQ+VISG    V  A +
Sbjct: 122 AAVPNGKGAMAAVLGVDRETLKAITDEVTAAGDAVQLANLNCPGQIVISGTTAGVLKAGE 181

Query: 184 TCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSID 243
                GAKR + L VS PFHSSLM P +   + +L  V   D  +P++ N  A   +   
Sbjct: 182 KAKENGAKRVLPLAVSGPFHSSLMEPAALAFREILAEVEIADGKIPVVNNVDAKQTTDKA 241

Query: 244 EISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVE 303
            IS  L++Q+   V W + ++    +GV +  E+GSGKVL GL K+I++ ++ +S   VE
Sbjct: 242 AISEKLIKQIYSPVLWEDIVEELIKNGVDTFVEIGSGKVLAGLIKKINRDVTVLSAGDVE 301

Query: 304 DI 305
            +
Sbjct: 302 SV 303


>gi|219871057|ref|YP_002475432.1| malonyl CoA-acyl carrier protein transacylase [Haemophilus parasuis
           SH0165]
 gi|219691261|gb|ACL32484.1| malonyl CoA-acyl carrier protein transacylase (MCT) [Haemophilus
           parasuis SH0165]
          Length = 311

 Score =  222 bits (566), Expect = 4e-56,   Method: Compositional matrix adjust.
 Identities = 124/300 (41%), Positives = 177/300 (59%), Gaps = 4/300 (1%)

Query: 5   LTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPA 64
           + FPGQGSQ +GM  DL   +P     F++    L  +L DL+ NG+ E+L  T   QPA
Sbjct: 6   MVFPGQGSQAVGMLADLAPVYPVVEQTFKQASDVLGYDLWDLVQNGTAEDLGKTERTQPA 65

Query: 65  LTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQ 124
           L A S+A  R+ ++     ++  + +AGHSLGEY+AL  A      D I+LV  RG++MQ
Sbjct: 66  LLAASVALYRIWQEK--FPEQKPAVMAGHSLGEYSALVCAGVLDFQDAIKLVELRGQAMQ 123

Query: 125 EAVPPGLGSMVAIIGLDDCVVDSICAQA-SRVG-ICEIANDNGGGQVVISGLQDAVKCAA 182
            AVP G G+M AIIGLD+  +   C QA S +G +    N N  GQVVI+G + A + A 
Sbjct: 124 SAVPAGTGAMFAIIGLDNEAIIKACEQAASEIGEVVSAVNFNSPGQVVIAGTKAAAERAG 183

Query: 183 DTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSI 242
           + C   GAKRA+ L VS P H  LM P ++ +   L +++   P+VP++ N   +  +  
Sbjct: 184 ELCKEAGAKRALPLAVSVPSHCVLMKPAAEKLAAALQNISLNAPLVPVINNVDVAVETDA 243

Query: 243 DEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKV 302
           D+I   LV Q+   VRW ET++  A  G+ ++YE+G  KVLTGLA RI K LSA +++ V
Sbjct: 244 DKIRDALVRQLYSPVRWTETVEKMAQDGITTLYEIGPNKVLTGLAGRIVKELSAKAVNDV 303


>gi|284007278|emb|CBA72599.1| malonyl CoA-acyl carrier protein transacylase [Arsenophonus
           nasoniae]
          Length = 310

 Score =  222 bits (566), Expect = 5e-56,   Method: Compositional matrix adjust.
 Identities = 125/305 (40%), Positives = 178/305 (58%), Gaps = 3/305 (0%)

Query: 5   LTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPA 64
           + FPGQGSQ +GM  DL   F      F E  + L  +L DL+ NGSQEEL  T   QPA
Sbjct: 6   MIFPGQGSQSLGMLADLAKEFAVVEKTFAESSNVLGYDLWDLVQNGSQEELNKTWKTQPA 65

Query: 65  LTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQ 124
           L + S+A  RV ++    + +    +AGHSLGEY+AL  A        ++LV  RG+ MQ
Sbjct: 66  LLSASVAIFRVWQEKKSKMPK---LMAGHSLGEYSALVCADVIDFKSAVKLVELRGQLMQ 122

Query: 125 EAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAADT 184
           E+VP G+G+M AIIGLD+  V + C QA++  +    N N  GQVVI+G + AV+ AA  
Sbjct: 123 ESVPAGMGAMYAIIGLDNESVLASCQQAAQGQVVSAVNFNSPGQVVIAGEKSAVERAAVL 182

Query: 185 CLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSIDE 244
           C   GAKR + L VS P H +LM P +K +   L++V    P + ++ N      +S++ 
Sbjct: 183 CKVAGAKRTLPLAVSVPSHCALMQPAAKKLAQALEAVVFNKPNITVVNNVDVKIENSVEG 242

Query: 245 ISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVED 304
           I   LV Q+   VRW ETI++ A  G+  + E+G GKVLTGL KRI  ++++ +I+    
Sbjct: 243 IRHALVRQLYNPVRWVETIEFMAEQGIVQLLEIGPGKVLTGLTKRIVSTINSAAINDTAS 302

Query: 305 IDLAL 309
           ++ AL
Sbjct: 303 LNAAL 307


>gi|119358259|ref|YP_912903.1| [Acyl-carrier-protein] S-malonyltransferase [Chlorobium
           phaeobacteroides DSM 266]
 gi|119355608|gb|ABL66479.1| [Acyl-carrier-protein] S-malonyltransferase [Chlorobium
           phaeobacteroides DSM 266]
          Length = 302

 Score =  222 bits (566), Expect = 5e-56,   Method: Compositional matrix adjust.
 Identities = 124/303 (40%), Positives = 177/303 (58%), Gaps = 6/303 (1%)

Query: 7   FPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPALT 66
           FPGQGSQ  GMG+D+++++P AR + E+ +  L  +++D+M++GS+E+L  T   QP++ 
Sbjct: 6   FPGQGSQYCGMGKDIFETYPAARSMMEKANELLGYSITDIMFSGSEEKLRQTQYTQPSI- 64

Query: 67  AVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQEA 126
                F+  +    L  ++D+   AGHSLGEYTALC A A S  DTIRLV  RG+ MQ+A
Sbjct: 65  -----FLHSIVAASLLGRKDVIMTAGHSLGEYTALCYAGALSFDDTIRLVAKRGELMQKA 119

Query: 127 VPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAADTCL 186
                G+M AIIG+ D  ++ +  +A   GI + AN N  GQ+VISG   AV+ A     
Sbjct: 120 GEIHPGTMAAIIGMPDSALEDLLLEAGTEGIVQAANFNSPGQIVISGDIAAVRKAIALAP 179

Query: 187 NKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSIDEIS 246
           +KG++ A  L VS  FHS LM P    +   LD V  +D  +P+  N  A+PV+   EI 
Sbjct: 180 SKGSRMAKELVVSGAFHSPLMKPAEVELAAALDLVEIRDAEIPVCMNAIAAPVTIAGEIR 239

Query: 247 RLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVEDID 306
           + L+ Q+T  V W ++IQ     GV    EVG  KVL GL KRIDKS+    I   +++ 
Sbjct: 240 KNLILQLTSSVLWTQSIQTMVGSGVTEFIEVGPQKVLQGLIKRIDKSVKTGGIDTAQELQ 299

Query: 307 LAL 309
             L
Sbjct: 300 QCL 302


>gi|261253411|ref|ZP_05945984.1| malonyl CoA-acyl carrier protein transacylase [Vibrio orientalis
           CIP 102891]
 gi|260936802|gb|EEX92791.1| malonyl CoA-acyl carrier protein transacylase [Vibrio orientalis
           CIP 102891]
          Length = 307

 Score =  222 bits (566), Expect = 5e-56,   Method: Compositional matrix adjust.
 Identities = 125/304 (41%), Positives = 177/304 (58%), Gaps = 3/304 (0%)

Query: 5   LTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPA 64
           + FPGQGSQV+GM  +L + +   +  F E    L  +L  L+ NG  E+L  T   QPA
Sbjct: 6   IVFPGQGSQVVGMLAELGEQYDVVKQTFAEASDALGYDLWALVQNGPAEDLNQTHRTQPA 65

Query: 65  LTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQ 124
           L A S+A  RV ++ GL      + +AGHSLGEY+AL  A      + I+LV+ RG+ MQ
Sbjct: 66  LLASSVAIWRVWQELGL---EQPANLAGHSLGEYSALVCAGVIDFKEAIKLVQLRGELMQ 122

Query: 125 EAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAADT 184
           EAVP G G+M AIIGLDD  +   C +A++  +    N N  GQVVI+G +DAV+ A   
Sbjct: 123 EAVPAGTGAMFAIIGLDDESIAKACEEAAQGEVVSPVNFNSPGQVVIAGSKDAVERAGAL 182

Query: 185 CLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSIDE 244
           C   GAKRA+ LPVS P H +LM P +  +   L+++    P +P++ N      +   +
Sbjct: 183 CKEAGAKRALPLPVSVPSHCALMKPAADKLAVALEALEFNAPQLPVINNVDVVAETDPAK 242

Query: 245 ISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVED 304
           I   LV Q+   VRW E++Q  +  GV+ + E+G GKVLTGL KRI K+LS  +++    
Sbjct: 243 IKDALVRQLYSPVRWTESVQLMSEQGVEKLLELGPGKVLTGLTKRIVKTLSGAAVNDTAS 302

Query: 305 IDLA 308
           +D A
Sbjct: 303 LDAA 306


>gi|289435151|ref|YP_003465023.1| malonyl CoA-acyl carrier protein transacylase [Listeria seeligeri
           serovar 1/2b str. SLCC3954]
 gi|289171395|emb|CBH27939.1| malonyl CoA-acyl carrier protein transacylase [Listeria seeligeri
           serovar 1/2b str. SLCC3954]
          Length = 313

 Score =  222 bits (565), Expect = 6e-56,   Method: Compositional matrix adjust.
 Identities = 122/302 (40%), Positives = 180/302 (59%), Gaps = 5/302 (1%)

Query: 5   LTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPA 64
             FPGQG+Q IGMG+D+   +PEA+ V+++ D  L  +++D++  G  E LT + NAQPA
Sbjct: 6   FVFPGQGAQKIGMGQDVAAEYPEAKKVYDDADARLGFSITDVITEGPIELLTKSENAQPA 65

Query: 65  LTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQ 124
           L + S+A +R +E  G  VK D  +VAGHSLGEY+AL A      SD I LVR RG+ M+
Sbjct: 66  LVSTSVAILRALETYG--VKAD--FVAGHSLGEYSALVAGGFLEASDAIYLVRKRGELME 121

Query: 125 EAVPPGLGSMVAIIGLDDCVVDSICAQASRVG-ICEIANDNGGGQVVISGLQDAVKCAAD 183
            AVP G G+M A++G+D   + +I  + +  G   ++AN N  GQ+VISG    V  A +
Sbjct: 122 AAVPNGKGAMAAVLGVDRETLKAITDEVTAAGDAVQLANLNCPGQIVISGTTAGVLKAGE 181

Query: 184 TCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSID 243
                GAKR + L VS PFHSSLM P +   + +L  V   D  +P++ N  A   +   
Sbjct: 182 KAKENGAKRVLPLAVSGPFHSSLMEPAALAFREILAEVEISDGKIPVVNNVDAKQTTDKT 241

Query: 244 EISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVE 303
            IS  L++Q+   V W + ++    +GV +  E+GSGKVL GL K+I++ ++ +S   VE
Sbjct: 242 AISDKLIKQIYSPVLWEDIVEELIKNGVDTFVEIGSGKVLAGLIKKINRDVTVLSAGDVE 301

Query: 304 DI 305
            +
Sbjct: 302 SV 303


>gi|269102262|ref|ZP_06154959.1| malonyl CoA-acyl carrier protein transacylase [Photobacterium
           damselae subsp. damselae CIP 102761]
 gi|268162160|gb|EEZ40656.1| malonyl CoA-acyl carrier protein transacylase [Photobacterium
           damselae subsp. damselae CIP 102761]
          Length = 309

 Score =  222 bits (565), Expect = 6e-56,   Method: Compositional matrix adjust.
 Identities = 124/305 (40%), Positives = 178/305 (58%), Gaps = 3/305 (0%)

Query: 5   LTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPA 64
           + FPGQGSQ +GM  +L + FP  +  F E    L  +L  L+ NG  E+L  T   QPA
Sbjct: 6   IVFPGQGSQAVGMLAELAEQFPIVQATFAEASEVLGYDLWALVQNGPAEDLNQTHRTQPA 65

Query: 65  LTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQ 124
           L   S+A  RV ++ G       + +AGHSLGEY+AL  A      + ++LV  RG+ MQ
Sbjct: 66  LLTASVAIWRVWQEKG---GEQPTVLAGHSLGEYSALVCAGVIDFKEAVKLVELRGQLMQ 122

Query: 125 EAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAADT 184
           EAVP G+G+M AIIGLD+  +   CA A+   +C   N N  GQVVI+G ++AV  A   
Sbjct: 123 EAVPAGVGAMSAIIGLDNDAIAKACADAAEDQVCSPVNFNSPGQVVIAGNKEAVDRANTL 182

Query: 185 CLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSIDE 244
           C   GAKRA+ LPVS P H  LM P +  +   L+++T   P +P++ N   +  +    
Sbjct: 183 CKEAGAKRALLLPVSVPSHCELMKPAADKLAVALENMTFNTPAIPVINNADVATETDPAA 242

Query: 245 ISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVED 304
           I   LV+Q+ G VRW E+++  A  G++ + E+G GKVLTGL KRI++SL   +++ +  
Sbjct: 243 IKLALVKQLYGPVRWTESVERMAAEGIEELLEMGPGKVLTGLTKRINRSLGGSAVNDIAS 302

Query: 305 IDLAL 309
           +D AL
Sbjct: 303 LDAAL 307


>gi|261346045|ref|ZP_05973689.1| malonyl CoA-acyl carrier protein transacylase [Providencia
           rustigianii DSM 4541]
 gi|282565932|gb|EFB71467.1| malonyl CoA-acyl carrier protein transacylase [Providencia
           rustigianii DSM 4541]
          Length = 310

 Score =  222 bits (565), Expect = 6e-56,   Method: Compositional matrix adjust.
 Identities = 129/309 (41%), Positives = 175/309 (56%), Gaps = 5/309 (1%)

Query: 5   LTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPA 64
           + FPGQGSQ +GM   L +        F E    L  +L  L+ NG +EEL  T   QPA
Sbjct: 6   MVFPGQGSQTLGMLAALAEQNQLIEQTFAEASDALGYDLWALVQNGPEEELNKTWQTQPA 65

Query: 65  LTAVSMAFIRV-MEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSM 123
           L A S+A  RV  EKNG    +  + +AGHSLGEY+AL  A        I+LV  RGK M
Sbjct: 66  LLAASVAIFRVWQEKNG----KMPAIMAGHSLGEYSALVCAGVIDFKQAIKLVELRGKLM 121

Query: 124 QEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAAD 183
           QEAVP G G+M AIIGLD+  ++  C +A++  +    N N  GQVVI+G + AV+ A  
Sbjct: 122 QEAVPAGTGAMYAIIGLDNESIEKACQEAAQGQVVSPVNFNSPGQVVIAGEKAAVERAGA 181

Query: 184 TCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSID 243
            C   GAKRA+ L VS P H +LM P +  +   L+ +   +P  P++ N       S  
Sbjct: 182 ACKEAGAKRALPLSVSVPSHCALMKPAADKLAEALEKIEFCEPAYPVINNVDVKIEKSAQ 241

Query: 244 EISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVE 303
            I   LV Q+   VRW ET++  AN G++ + E+G GKVLTGL KRI  +L+AV+++   
Sbjct: 242 NIRDALVRQLYNPVRWTETVELMANQGIEQLVEMGPGKVLTGLTKRIVSNLTAVAVNDPV 301

Query: 304 DIDLALRSI 312
            +D AL +I
Sbjct: 302 SLDSALETI 310


>gi|313637352|gb|EFS02835.1| malonyl CoA-acyl carrier protein transacylase [Listeria seeligeri
           FSL S4-171]
          Length = 313

 Score =  222 bits (565), Expect = 7e-56,   Method: Compositional matrix adjust.
 Identities = 122/302 (40%), Positives = 180/302 (59%), Gaps = 5/302 (1%)

Query: 5   LTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPA 64
             FPGQG+Q IGMG+D+   +PEA+ V+++ D  L  +++D++  G  E LT + NAQPA
Sbjct: 6   FVFPGQGAQKIGMGQDVAAEYPEAKKVYDDADARLGFSITDVIAEGPIELLTKSENAQPA 65

Query: 65  LTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQ 124
           L + S+A +R +E  G  VK D  +VAGHSLGEY+AL A      SD I LVR RG+ M+
Sbjct: 66  LVSTSVAILRALETYG--VKAD--FVAGHSLGEYSALVAGGFLEASDAIYLVRKRGELME 121

Query: 125 EAVPPGLGSMVAIIGLDDCVVDSICAQASRVG-ICEIANDNGGGQVVISGLQDAVKCAAD 183
            AVP G G+M A++G+D   + +I  + +  G   ++AN N  GQ+VISG    V  A +
Sbjct: 122 AAVPNGKGAMAAVLGVDRETLKAITDEVTAAGDAVQLANLNCPGQIVISGTTAGVLKAGE 181

Query: 184 TCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSID 243
                GAKR + L VS PFHSSLM P +   + +L  V   D  +P++ N  A   +   
Sbjct: 182 KAKENGAKRVLPLAVSGPFHSSLMEPAALAFREILAEVEISDGKIPVVNNVDAKQTTDKA 241

Query: 244 EISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVE 303
            IS  L++Q+   V W + ++    +GV +  E+GSGKVL GL K+I++ ++ +S   VE
Sbjct: 242 AISDKLIKQIYSPVLWEDIVEELIKNGVDTFVEIGSGKVLAGLIKKINRDVTVLSAGDVE 301

Query: 304 DI 305
            +
Sbjct: 302 SV 303


>gi|293391072|ref|ZP_06635406.1| malonyl CoA-acyl carrier protein transacylase [Aggregatibacter
           actinomycetemcomitans D7S-1]
 gi|290951606|gb|EFE01725.1| malonyl CoA-acyl carrier protein transacylase [Aggregatibacter
           actinomycetemcomitans D7S-1]
          Length = 312

 Score =  222 bits (565), Expect = 7e-56,   Method: Compositional matrix adjust.
 Identities = 129/302 (42%), Positives = 177/302 (58%), Gaps = 2/302 (0%)

Query: 5   LTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPA 64
           + FPGQGSQ +GM  +L   +P  +  F++    L  +L  L+  G  EEL  T   QPA
Sbjct: 6   MVFPGQGSQAVGMLAELAVEYPVVQDTFKQASEALGYDLWQLVQQGPAEELNKTWQTQPA 65

Query: 65  LTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQ 124
           L A S+A  RV ++    +K ++  +AGHSLGEY+AL  A      D ++LV  RGK MQ
Sbjct: 66  LLAASVAIYRVWQEKYPQLKPEV--MAGHSLGEYSALVCAGVLDFQDAVKLVELRGKLMQ 123

Query: 125 EAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAADT 184
           +AVP G G+M AIIGLD+  + + C QA +  +    N N  GQVVI+G + AV+ AA  
Sbjct: 124 QAVPEGTGAMYAIIGLDNEAIINACKQAEQGEVVSAVNFNSPGQVVIAGAKAAVERAAAL 183

Query: 185 CLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSIDE 244
           C   GAKRA+ L VS P H +LM P +  +   L+S+T + P V +L N      S  + 
Sbjct: 184 CKEAGAKRALPLAVSVPSHCALMKPAADQLSVSLESITLKAPSVAVLNNVDVKGESEAEA 243

Query: 245 ISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVED 304
           I   LV Q+   VRW ET+Q  A +GV+ + E+G GKVL GL KRI  SL AVS++ V+ 
Sbjct: 244 IRHALVRQLYSPVRWTETVQKMAGNGVEVLVEIGPGKVLNGLTKRIVDSLQAVSVNDVKS 303

Query: 305 ID 306
           +D
Sbjct: 304 LD 305


>gi|183599492|ref|ZP_02960985.1| hypothetical protein PROSTU_02971 [Providencia stuartii ATCC 25827]
 gi|188021739|gb|EDU59779.1| hypothetical protein PROSTU_02971 [Providencia stuartii ATCC 25827]
          Length = 310

 Score =  222 bits (565), Expect = 7e-56,   Method: Compositional matrix adjust.
 Identities = 129/309 (41%), Positives = 173/309 (55%), Gaps = 5/309 (1%)

Query: 5   LTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPA 64
           + FPGQGSQ +GM   L    P     F E    L  +L  L+ NG +EEL  T   QPA
Sbjct: 6   MVFPGQGSQSLGMLSALAAESPLVEQTFAEASEALGYDLWALVQNGPEEELNKTWQTQPA 65

Query: 65  LTAVSMAFIRV-MEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSM 123
           L A S+A  RV  EK G       + +AGHSLGEY+AL  A        I+LV  RGK M
Sbjct: 66  LLAASVAIFRVWQEKKGAMP----TMMAGHSLGEYSALVCAGVLDFKAAIKLVELRGKLM 121

Query: 124 QEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAAD 183
           QEAVP G G+M AIIGLD+  ++  C  A++  +    N N  GQVVI+G + AV+ A  
Sbjct: 122 QEAVPEGTGAMYAIIGLDNESIEKACQDAAQGQVVSPVNFNSPGQVVIAGEKAAVERAGA 181

Query: 184 TCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSID 243
            C   GAKRA+ L VS P H +LM P ++ +   L  +T   P  P++ N       S +
Sbjct: 182 ACKEAGAKRALPLSVSVPSHCALMKPAAEKLAVALQEITFNQPNFPVINNVDVKIEQSAE 241

Query: 244 EISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVE 303
            I   LV Q+   VRW ET+++ AN G++ + EVG GKVLTGL KRI  +L+AV+++   
Sbjct: 242 NIRDALVRQLYNPVRWTETVEFMANQGIEHLVEVGPGKVLTGLTKRIVSNLTAVAVNDPV 301

Query: 304 DIDLALRSI 312
            +  AL ++
Sbjct: 302 SLGTALENL 310


>gi|221633598|ref|YP_002522824.1| malonyl CoA-acyl carrier protein transacylase [Thermomicrobium
           roseum DSM 5159]
 gi|221157222|gb|ACM06349.1| malonyl CoA-acyl carrier protein transacylase [Thermomicrobium
           roseum DSM 5159]
          Length = 327

 Score =  221 bits (564), Expect = 8e-56,   Method: Compositional matrix adjust.
 Identities = 131/311 (42%), Positives = 187/311 (60%), Gaps = 14/311 (4%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M     FPGQGSQ +GMGRDL      AR VFEE D  L   LS +++ G +EEL AT +
Sbjct: 16  MQDAWVFPGQGSQWVGMGRDLASEDALARAVFEEADAVLGFPLSRIVFEGPEEELAATRH 75

Query: 61  AQPALTAVSMAFIRVMEKNGLC-VKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRAR 119
            QPAL A S+A++RV+E  GL  V R    VAGHSLGEYTAL A  + +L+D +RLVR R
Sbjct: 76  QQPALLATSIAYLRVLEARGLLPVPR---VVAGHSLGEYTALVAVGSLTLADALRLVRRR 132

Query: 120 GKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVK 179
           G+ M+     G G M+A+IGLD    + + A AS  G+ E+AN+N   Q+ +SG  +A++
Sbjct: 133 GELMETY---GRGGMLAVIGLDR---ERLAAIASEAGV-ELANENAPNQLTLSGPDEALE 185

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            AA+     GA+R V LPV+A FHS  M PV+  +   L ++  + P VP++    A  +
Sbjct: 186 RAAELARGAGARRVVRLPVNAAFHSRWMRPVADALALELANIPIRTPSVPLIACSDARVL 245

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKS---LSA 296
           +  +++ R LVEQ+   VRW   +Q   + GV   +E+G G+VL+GL +RI  +    +A
Sbjct: 246 TDPEDLRRELVEQIASPVRWVAVVQRALDLGVAHFWEIGPGQVLSGLIRRIAPTAEITTA 305

Query: 297 VSISKVEDIDL 307
             + + ED+ L
Sbjct: 306 EQLLRAEDVSL 316


>gi|90579085|ref|ZP_01234895.1| acyl carrier protein S-malonyltransferase [Vibrio angustum S14]
 gi|90439918|gb|EAS65099.1| acyl carrier protein S-malonyltransferase [Vibrio angustum S14]
          Length = 309

 Score =  221 bits (564), Expect = 9e-56,   Method: Compositional matrix adjust.
 Identities = 120/305 (39%), Positives = 178/305 (58%), Gaps = 3/305 (0%)

Query: 5   LTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPA 64
           + FPGQGSQ +GM  +L + F   +  F E    L  +L  L+ NG  E+L  T   QPA
Sbjct: 6   IVFPGQGSQTVGMLAELAEQFDVVKETFSEASDALGYDLWALVQNGPAEDLNQTQRTQPA 65

Query: 65  LTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQ 124
           L   S+A  RV ++ G       + +AGHSLGEY+AL  A        ++LV  RG+ MQ
Sbjct: 66  LLTASVAIWRVWQQQG---GEQPTLLAGHSLGEYSALVCAGVIDFKAAVKLVELRGQLMQ 122

Query: 125 EAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAADT 184
           EAVP G+G+M AIIGLD+  +   C +A++  +C   N N  GQVVI+G ++AV+ A   
Sbjct: 123 EAVPAGVGAMSAIIGLDNDAIAKACEEAAQGEVCSPVNFNSPGQVVIAGNKEAVERANVL 182

Query: 185 CLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSIDE 244
           C   GAKRA+ LPVS P H +LM P +  +   L+++    P VP++ N   +  +    
Sbjct: 183 CKEAGAKRALPLPVSVPSHCALMKPAADKLAVALEAIEFNAPSVPVINNADVATETDPAA 242

Query: 245 ISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVED 304
           I   LV+Q+   VRW E+++  A  G++ + E+G GKVLTGL KRID++LS  +++ +  
Sbjct: 243 IKLALVKQLYSPVRWTESVERMAAEGIEELLEMGPGKVLTGLTKRIDRALSGAAVNDIAS 302

Query: 305 IDLAL 309
           ++ A+
Sbjct: 303 LEAAM 307


>gi|323491971|ref|ZP_08097140.1| malonyl CoA-acyl carrier protein transacylase [Vibrio brasiliensis
           LMG 20546]
 gi|323313829|gb|EGA66924.1| malonyl CoA-acyl carrier protein transacylase [Vibrio brasiliensis
           LMG 20546]
          Length = 307

 Score =  221 bits (564), Expect = 9e-56,   Method: Compositional matrix adjust.
 Identities = 124/304 (40%), Positives = 174/304 (57%), Gaps = 3/304 (0%)

Query: 5   LTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPA 64
           + FPGQGSQ +GM  +L + +   +  F E    L  +L  L+ NG  E+L  T   QPA
Sbjct: 6   IVFPGQGSQAVGMLAELGEQYDVVKQTFAEASDALGYDLWALVQNGPAEDLNQTHRTQPA 65

Query: 65  LTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQ 124
           L A S+A  RV ++ GL      + +AGHSLGEY+AL  A        I+LV+ RG+ MQ
Sbjct: 66  LLASSVAIWRVWQELGL---EQPANLAGHSLGEYSALVCAGVIDFKQAIKLVQLRGQLMQ 122

Query: 125 EAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAADT 184
           EAVP G G+M AIIGLDD  +   C +A++  +    N N  GQVVI+G +DAV+ A   
Sbjct: 123 EAVPAGTGAMYAIIGLDDDAIAKACEEAAQGEVVSPVNFNSPGQVVIAGSKDAVERAGAL 182

Query: 185 CLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSIDE 244
           C   GAKRA+ LPVS P H +LM P +  +   L+ +    P  P++ N   +  +   +
Sbjct: 183 CKEAGAKRALPLPVSVPSHCALMKPAADKLAVALEEIEFNAPQFPVINNVDVAAETDPAK 242

Query: 245 ISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVED 304
           I   LV Q+   VRW E++Q  +  GV+ + E+G GKVLTGL KRI K+LS  +++    
Sbjct: 243 IKDALVRQLYSPVRWTESVQLMSEQGVEKLLELGPGKVLTGLTKRIVKTLSGAAVNDAAS 302

Query: 305 IDLA 308
           +D A
Sbjct: 303 LDAA 306


>gi|317050769|ref|YP_004111885.1| malonyl CoA-acyl carrier protein transacylase [Desulfurispirillum
           indicum S5]
 gi|316945853|gb|ADU65329.1| malonyl CoA-acyl carrier protein transacylase [Desulfurispirillum
           indicum S5]
          Length = 320

 Score =  221 bits (564), Expect = 9e-56,   Method: Compositional matrix adjust.
 Identities = 123/302 (40%), Positives = 179/302 (59%), Gaps = 7/302 (2%)

Query: 7   FPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPALT 66
           +PGQGSQV+GMG+DL   +  AR +FE+    L  +L ++ +NG +EEL  T   QPAL 
Sbjct: 11  YPGQGSQVVGMGKDLCQQYHYARHLFEQAGDVLGFDLMNICFNGPEEELRLTSITQPALL 70

Query: 67  AVSMAFIRVMEKN-GLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQE 125
             S+   +V+ +  G+  K      AGHSLGEY+ALC A     +D ++LV  RGK MQE
Sbjct: 71  VTSVIAHQVLTRELGMTPKT----AAGHSLGEYSALCCAGGIDFADAVKLVHLRGKYMQE 126

Query: 126 AVPPGLGSMVAIIGLDDCVVDSICAQASR--VGICEIANDNGGGQVVISGLQDAVKCAAD 183
           AVP G G+M AI+ LD   +   C +A++    +  +AN N   Q+VI+G   AV+ A  
Sbjct: 127 AVPVGKGAMAAIMNLDIDSIREACRRAAQKEQEVVMVANYNLPSQIVIAGDTSAVELACT 186

Query: 184 TCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSID 243
            C   GAK+AV LPVSAPFH SLM P    ++  ++S+T  D    I+ N  A+ +   +
Sbjct: 187 YCKEMGAKKAVMLPVSAPFHCSLMQPAQDRLQKDMESITFNDLQYTIINNVDAAYMYRAE 246

Query: 244 EISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVE 303
           +I   L  QVTG VRW E+++     G+ S  E+GSGKVL+G+ ++I+K    +++   E
Sbjct: 247 DIPTSLTRQVTGTVRWYESMEILLGDGIHSFVELGSGKVLSGIMRKINKEARILNLESCE 306

Query: 304 DI 305
           D+
Sbjct: 307 DL 308


>gi|269967352|ref|ZP_06181413.1| acyl carrier protein S-malonyltransferase [Vibrio alginolyticus
           40B]
 gi|269828060|gb|EEZ82333.1| acyl carrier protein S-malonyltransferase [Vibrio alginolyticus
           40B]
          Length = 307

 Score =  221 bits (564), Expect = 9e-56,   Method: Compositional matrix adjust.
 Identities = 124/304 (40%), Positives = 176/304 (57%), Gaps = 3/304 (0%)

Query: 5   LTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPA 64
           + FPGQGSQ +GM  +L + +   +  F E    L  +L  L+ NG  E+L  T   QPA
Sbjct: 6   IVFPGQGSQAVGMLAELGEQYDVVKQTFAEASDALGYDLWALVQNGPAEDLNETFRTQPA 65

Query: 65  LTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQ 124
           L A S+A  RV ++ GL      + +AGHSLGEY+AL  A      + I+LV  RG+ MQ
Sbjct: 66  LLASSVAIWRVWQELGL---EQPANLAGHSLGEYSALVCAGVIDFKEAIKLVELRGQLMQ 122

Query: 125 EAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAADT 184
           EAVP G G+M AIIGL D  +   C  A++  +    N N  GQVVI+G +DAV+ A   
Sbjct: 123 EAVPAGTGAMYAIIGLADDAIAKACEDAAQGEVVSPVNFNSPGQVVIAGSKDAVERAGAL 182

Query: 185 CLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSIDE 244
           C   GAKRA+ LPVS P H +LM P ++ +   L+S+    P +P++ N      +   +
Sbjct: 183 CKEAGAKRALPLPVSVPSHCALMKPAAEKLAVALESIEFNSPQLPVINNVDVVAETDPAK 242

Query: 245 ISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVED 304
           I   LV Q+   VRW ET++     GV+++ E+G GKVLTGL KRI K+L+A +++ +  
Sbjct: 243 IKDALVRQLHSPVRWTETVELMHEQGVENLLELGPGKVLTGLTKRIVKTLTAAAVNDIAS 302

Query: 305 IDLA 308
           +D A
Sbjct: 303 LDAA 306


>gi|90413255|ref|ZP_01221250.1| acyl carrier protein S-malonyltransferase [Photobacterium profundum
           3TCK]
 gi|90325807|gb|EAS42265.1| acyl carrier protein S-malonyltransferase [Photobacterium profundum
           3TCK]
          Length = 307

 Score =  221 bits (563), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 122/304 (40%), Positives = 178/304 (58%), Gaps = 3/304 (0%)

Query: 5   LTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPA 64
           + FPGQGSQ +GM  +L + F   +  F E    L  +L  L+ NG  E+L  T   QPA
Sbjct: 6   IVFPGQGSQAVGMLAELAEKFDVVKYTFAEASEVLGYDLWALVQNGPAEDLNQTDRTQPA 65

Query: 65  LTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQ 124
           L A S+A  RV ++ G       + +AGHSLGEY+AL  A      + I+LV  RG+ MQ
Sbjct: 66  LLAASVAIWRVWQEQG---GEQPAVLAGHSLGEYSALVCAGVIDFKEAIKLVELRGQLMQ 122

Query: 125 EAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAADT 184
           EAVP G+G+M AIIGLD+  +   C +A++  I    N N  GQVVI+G ++AV+ A   
Sbjct: 123 EAVPAGVGAMSAIIGLDNDSIAKACEEAAQDQIVSPVNFNSPGQVVIAGNKEAVERANVL 182

Query: 185 CLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSIDE 244
           C   GAKRA+ LPVS P H +LM P +  +   L+++    P +P++ N      S    
Sbjct: 183 CKEAGAKRALPLPVSVPSHCALMKPAADKLAVALEAIEFNTPSIPVINNADVQTESDPAA 242

Query: 245 ISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVED 304
           I   LV+Q+ G VRW E+++  AN G++ + E+G GKVLTGL KRI+++L++  ++    
Sbjct: 243 IKLALVKQLYGPVRWTESVERMANEGIEQLLEMGPGKVLTGLTKRINRALTSAVVNDSAS 302

Query: 305 IDLA 308
           ++ A
Sbjct: 303 LEAA 306


>gi|226312781|ref|YP_002772675.1| malonyl-CoA transacylase [Brevibacillus brevis NBRC 100599]
 gi|226095729|dbj|BAH44171.1| putative malonyl-CoA transacylase [Brevibacillus brevis NBRC
           100599]
          Length = 422

 Score =  221 bits (563), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 127/303 (41%), Positives = 170/303 (56%), Gaps = 6/303 (1%)

Query: 5   LTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPA 64
           L FPGQGSQ +GMG+ L ++ P A   FEE    L  NL  L + G  +ELT T +AQPA
Sbjct: 6   LLFPGQGSQYVGMGQALCEAHPIAARTFEEASDALGFNLQTLCFAGDAQELTKTEHAQPA 65

Query: 65  LTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQ 124
           +   S+A  RV  +    +  +  +VAGHSLGE+TAL  A A   +D +RLV  RG+ MQ
Sbjct: 66  ILTASVAAFRVYSQE---MDIEPKWVAGHSLGEFTALTCAGAIQFADAVRLVYRRGQFMQ 122

Query: 125 EAVPPGLGSMVAIIGLDDCVVDSICAQASRVG-ICEIANDNGGGQVVISGLQDAVKCAAD 183
            A P G+G+M AI GLD  +V+ IC + SR G I  +AN N   Q+VISG   AV+   +
Sbjct: 123 AATPQGVGAMSAIFGLDAQLVEMICREHSRDGAIVVVANHNSADQIVISGHAHAVRQVEE 182

Query: 184 TCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSID 243
            C  +G+   V L VSAPFHS LM   ++ +   L   T  DP  P++ N  A P    D
Sbjct: 183 ACKQQGSTSVVTLKVSAPFHSPLMVQAAEQLNEELKRYTYCDPKWPVISNVTAQPYVHAD 242

Query: 244 EISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVE 303
           ++  LL  Q T  VRW+ T+ +    G  +V E+G   VLT LAK+    L A +  K  
Sbjct: 243 QLVDLLTAQTTSPVRWQATMDYLVKQGANTVIELGPKSVLTNLAKKY--PLRAFAFDKQG 300

Query: 304 DID 306
           +ID
Sbjct: 301 EID 303


>gi|257465196|ref|ZP_05629567.1| malonyl CoA-acyl carrier protein transacylase (MCT) [Actinobacillus
           minor 202]
 gi|257450856|gb|EEV24899.1| malonyl CoA-acyl carrier protein transacylase (MCT) [Actinobacillus
           minor 202]
          Length = 311

 Score =  221 bits (563), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 124/304 (40%), Positives = 178/304 (58%), Gaps = 4/304 (1%)

Query: 5   LTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPA 64
           + FPGQGSQ +GM  DL   +P     F++    L  +L DL+ NG+ E+L  T   QPA
Sbjct: 6   MVFPGQGSQAVGMLADLAPVYPVVEQTFKQASDVLGYDLWDLVQNGTAEDLGKTERTQPA 65

Query: 65  LTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQ 124
           L A S+A  R+ ++     ++  + +AGHSLGEY+AL  A      D I+LV  RG++MQ
Sbjct: 66  LLAASVALYRIWQEK--FPEQKPAVMAGHSLGEYSALVCAGVLDFQDAIKLVELRGQAMQ 123

Query: 125 EAVPPGLGSMVAIIGLDDCVVDSICAQA-SRVG-ICEIANDNGGGQVVISGLQDAVKCAA 182
            AVP G G+M AIIGLD+  +   C QA S +G +    N N  GQVVI+G + A + A 
Sbjct: 124 SAVPAGTGAMFAIIGLDNEAIIKACEQAASEIGEVVSAVNFNSPGQVVIAGTKAAAERAG 183

Query: 183 DTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSI 242
           + C   GAKRA+ L VS P H +LM P ++ +   L +++   P+V ++ N   +  +  
Sbjct: 184 ELCKEAGAKRALPLAVSVPSHCALMKPAAEKLAAALQNISLNAPLVSVINNVDVAVETDA 243

Query: 243 DEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKV 302
           D+I   LV Q+   VRW ET++  A  GV ++YE+G  KVLTGLA RI K LSA +++ V
Sbjct: 244 DKIRDALVRQLYNPVRWTETVEKMAQDGVTTLYEIGPNKVLTGLASRIVKELSAKAVNDV 303

Query: 303 EDID 306
              +
Sbjct: 304 ASFE 307


>gi|330999182|ref|ZP_08322901.1| [acyl-carrier-protein] S-malonyltransferase [Parasutterella
           excrementihominis YIT 11859]
 gi|329575382|gb|EGG56926.1| [acyl-carrier-protein] S-malonyltransferase [Parasutterella
           excrementihominis YIT 11859]
          Length = 314

 Score =  221 bits (563), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 126/296 (42%), Positives = 166/296 (56%), Gaps = 4/296 (1%)

Query: 5   LTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPA 64
             FPGQGSQ +GM   L D  P  R   +E D  L   L  L+  G  EEL+ T N QPA
Sbjct: 8   FVFPGQGSQAVGMLSTLADE-PIVRETLKEADEALGFALFKLIAEGPAEELSLTVNTQPA 66

Query: 65  LTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQ 124
           L   S+A  R   + G    R    +AGHSLGEY+AL AA A   +D ++LVR R + MQ
Sbjct: 67  LVCASIAMYRFYLQEG---GRKPDLLAGHSLGEYSALVAAGALDFTDALQLVRYRAEQMQ 123

Query: 125 EAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAADT 184
            AVP G G+M AI+GL D  V ++C + +  G+ E  N N  GQVVI+G   AV+ A + 
Sbjct: 124 AAVPVGEGTMAAILGLSDDQVKTVCLECATNGVVEAVNFNTPGQVVIAGTVAAVQEAMEK 183

Query: 185 CLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSIDE 244
            L  GAKRA+ L VS PFHSSLM P +  M+  L +V  Q P +P+L N         D 
Sbjct: 184 SLAAGAKRAIKLNVSGPFHSSLMKPAALAMEEKLKTVDLQKPFLPVLHNVDVQIHEEPDA 243

Query: 245 ISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
           I  +L  QV   V W +T++     GV  +YEVG G  L+G+ KRI K ++A +++
Sbjct: 244 IRDVLAAQVASPVLWADTVRKMEEAGVMEIYEVGPGAALSGMVKRITKGITAKALN 299


>gi|238791860|ref|ZP_04635497.1| Malonyl CoA-acyl carrier protein transacylase [Yersinia intermedia
           ATCC 29909]
 gi|238728964|gb|EEQ20481.1| Malonyl CoA-acyl carrier protein transacylase [Yersinia intermedia
           ATCC 29909]
          Length = 304

 Score =  221 bits (563), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 127/307 (41%), Positives = 173/307 (56%), Gaps = 3/307 (0%)

Query: 5   LTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPA 64
           + FPGQGSQ +GM  DL   FP     F E    L  +L  L+  G  EEL  T   QPA
Sbjct: 1   MVFPGQGSQSLGMLADLAAQFPIVEATFSEASSVLGYSLWQLVQQGPVEELNKTWQTQPA 60

Query: 65  LTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQ 124
           L A S+A  RV +  G    +  + +AGHSLGEY+AL  A        I LV  RGK MQ
Sbjct: 61  LLAASVAIWRVWQHQG---GKLPTMMAGHSLGEYSALVCAGVIDFKQAITLVELRGKLMQ 117

Query: 125 EAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAADT 184
           EAVP G G+M AIIGLD+  +   C ++++  +    N N  GQVVI+G ++AV+ A   
Sbjct: 118 EAVPAGTGAMYAIIGLDNESIAKACEESAQGQVVSPVNFNSPGQVVIAGNKEAVERAGVA 177

Query: 185 CLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSIDE 244
           C   GAKRA+ LPVS P H +LM P +  +   L+++  Q P+ P++ N       S D 
Sbjct: 178 CKAAGAKRALPLPVSVPSHCALMKPAADKLAEALENIEFQAPLFPVVNNVDVKTEVSPDA 237

Query: 245 ISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVED 304
           I   LV Q+   VRW E++++ A  G++ + EVG GKVLTGL KRI  +L+A  ++ V  
Sbjct: 238 IRSALVRQLYNPVRWTESVEFMAAEGIELLLEVGPGKVLTGLTKRIVDTLTAAPVNDVAT 297

Query: 305 IDLALRS 311
           +  AL +
Sbjct: 298 LTSALEN 304


>gi|328473537|gb|EGF44374.1| malonyl CoA-acyl carrier protein transacylase [Listeria
           monocytogenes 220]
          Length = 312

 Score =  221 bits (563), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 121/302 (40%), Positives = 181/302 (59%), Gaps = 6/302 (1%)

Query: 5   LTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPA 64
             FPGQG+Q IGMG+D+   +PEA+ ++++ D  L  ++++++  G  E LT + NAQPA
Sbjct: 6   FVFPGQGAQKIGMGQDVAAEYPEAKKIYDDADERLGFSITEIITEGPIELLTKSENAQPA 65

Query: 65  LTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQ 124
           L + S+A +R +E  G  VK D  YVAGHSLGEY+AL A      SD I LVR RG+ M+
Sbjct: 66  LVSTSVAILRALETYG--VKAD--YVAGHSLGEYSALVAGGFLEASDAIYLVRKRGELME 121

Query: 125 EAVPPGLGSMVAIIGLDDCVVDSICAQASRVG-ICEIANDNGGGQVVISGLQDAVKCAAD 183
            AVP G G+M A++G+D   + +I  + ++ G   ++AN N  GQ+VISG    V+ A +
Sbjct: 122 AAVPNGAGAMAAVLGVDRETLKTITEEVTKEGDAVQLANLNCPGQIVISGTTAGVEKAGE 181

Query: 184 TCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSID 243
                GAKR + L VS PFHSSLM P +   + +L  V   D  +P++ N  A   +   
Sbjct: 182 KAKESGAKRVLPLAVSGPFHSSLMEPAALAFRDVLAEVKISDGQIPVVNNVDAKETTDKS 241

Query: 244 EISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVE 303
           EIS  L++Q+   V W + ++    +GV +  E+GSGKVL GL K I++ ++ +S    E
Sbjct: 242 EISDKLIKQIYSPVLWEDIVEELIKNGVDTFVEIGSGKVLAGLIK-INRDVTVLSAGDAE 300

Query: 304 DI 305
            +
Sbjct: 301 SV 302


>gi|304436764|ref|ZP_07396732.1| malonyl-CoA-[acyl-carrier-protein] transacylase [Selenomonas sp.
           oral taxon 149 str. 67H29BP]
 gi|304370244|gb|EFM23901.1| malonyl-CoA-[acyl-carrier-protein] transacylase [Selenomonas sp.
           oral taxon 149 str. 67H29BP]
          Length = 311

 Score =  221 bits (563), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 123/293 (41%), Positives = 167/293 (56%), Gaps = 4/293 (1%)

Query: 7   FPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPALT 66
           FPGQG+QV+GMGRD YD++  A+  F E D  L  ++S L + G  ++L  T N QPA+ 
Sbjct: 8   FPGQGAQVVGMGRDFYDAYDLAKERFAEADEALGYSISKLCFEGPADQLQLTENTQPAIL 67

Query: 67  AVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQEA 126
            VS+   +++++ G+      +   GHSLGEY AL  A A S  D + LV  RG  MQEA
Sbjct: 68  TVSVIAAQLLQERGVSP----AIAGGHSLGEYAALVLAGALSFRDAVVLVHKRGAYMQEA 123

Query: 127 VPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAADTCL 186
           VP G G+M AIIGLDD  +   CA AS  G  +  N N  GQ VI+G +  V  A +   
Sbjct: 124 VPVGEGAMAAIIGLDDATIIDACAAASAQGAVQAVNFNCPGQTVIAGAEKGVSAAVELLK 183

Query: 187 NKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSIDEIS 246
            KGAK+AV LPVSAPFHS+LM P +K +   L+ V   D   P++ N+      +  EI 
Sbjct: 184 EKGAKKAVILPVSAPFHSTLMAPAAKKLAAELNKVALHDAAFPVVSNYTGGLQQTAAEIK 243

Query: 247 RLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
             LV Q    VRW   +    + G  +  E G GK L G  KRIDK+L+++++
Sbjct: 244 ENLVAQADHPVRWIACVATMRDFGADTYIECGPGKTLAGFNKRIDKTLTSMNV 296


>gi|17545770|ref|NP_519172.1| acyl-carrier-protein S-malonyltransferase [Ralstonia solanacearum
           GMI1000]
 gi|17428064|emb|CAD14753.1| probable malonyl coa-[acyl-carrier-protein] transacylase [Ralstonia
           solanacearum GMI1000]
          Length = 309

 Score =  221 bits (563), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 126/291 (43%), Positives = 161/291 (55%), Gaps = 4/291 (1%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M+    FPGQGSQ +GM  + +   P       E    L Q++  L+  G  +EL  T N
Sbjct: 1   MTFAFVFPGQGSQSVGM-LNAFADHPVVAATLAEASDALGQDIGKLIAEGPADELNLTTN 59

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
            QP +   ++A  R  +  G       + VAGHSLGEY+AL AA A +  D + LVR R 
Sbjct: 60  TQPVMLTAAVAVYRAWQAAGGPTP---AVVAGHSLGEYSALVAAGAIAFKDAVPLVRFRA 116

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           K+MQEAVP G G M AI+GL D  V + CA+AS  G+ E  N N   QVVI+G + AV+ 
Sbjct: 117 KAMQEAVPVGEGGMAAILGLSDDDVRAACAEASSAGVVEAVNFNAPAQVVIAGAKAAVEK 176

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A +    KGAKRA+ LPVSAPFHSSL+ P S  ++  L  V    P +P++ N   + VS
Sbjct: 177 ACEIAKAKGAKRALPLPVSAPFHSSLLKPASDRLREYLSGVAVGAPAIPVINNVDVALVS 236

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRID 291
               I   LV Q    VRW ET+Q     G+  V E G GKVL GL KRID
Sbjct: 237 DPAAIKDALVRQAASPVRWVETVQKMKADGIARVVECGPGKVLAGLTKRID 287


>gi|300114116|ref|YP_003760691.1| malonyl CoA-acyl carrier protein transacylase [Nitrosococcus
           watsonii C-113]
 gi|299540053|gb|ADJ28370.1| malonyl CoA-acyl carrier protein transacylase [Nitrosococcus
           watsonii C-113]
          Length = 315

 Score =  221 bits (562), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 131/312 (41%), Positives = 168/312 (53%), Gaps = 7/312 (2%)

Query: 5   LTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPA 64
             FPGQGSQ IGM  D Y+ +P+ R  F++    +  +L  L+  G +E+L  T   QPA
Sbjct: 6   FVFPGQGSQTIGMLADFYEPYPQVRETFDQASAAVRYDLWKLVQEGPEEKLNRTDYTQPA 65

Query: 65  LTAVSMAFIRVMEKNGLCVK--RDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKS 122
           + A  +A  R+      C    R   ++AGHSLGEYTAL  A A      I LV  RG+ 
Sbjct: 66  MLAAGVAVWRIW-----CAAEGRSPDFMAGHSLGEYTALVCAGALEFVSAIGLVADRGRY 120

Query: 123 MQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAA 182
           M EAV    G+M AI+GL D VV SIC Q+S   I E  N N  GQVVI+G  DA+  A 
Sbjct: 121 MLEAVSEPEGAMAAILGLPDDVVKSICEQSSEGQIVEAVNFNAPGQVVIAGHTDAIHRAV 180

Query: 183 DTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSI 242
                 GAKRAVFLPVS P H  LM P +K ++  L     + P +P++ N   +     
Sbjct: 181 SKAKEMGAKRAVFLPVSVPSHCQLMGPAAKQLRQRLSEYMIETPSIPVVNNVDVTVNEDP 240

Query: 243 DEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKV 302
             I   L  QV   VRW ETI W  + GV  + E G GKVLTGL +RIDKS++ + IS  
Sbjct: 241 HTICDALARQVNHPVRWVETITWLKSQGVDVLIECGPGKVLTGLIRRIDKSMTVLPISDP 300

Query: 303 EDIDLALRSIVG 314
             ++ AL    G
Sbjct: 301 AGLEKALNITAG 312


>gi|149921252|ref|ZP_01909708.1| Malonyl CoA-acyl carrier protein transacylase [Plesiocystis
           pacifica SIR-1]
 gi|149817912|gb|EDM77374.1| Malonyl CoA-acyl carrier protein transacylase [Plesiocystis
           pacifica SIR-1]
          Length = 322

 Score =  221 bits (562), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 130/305 (42%), Positives = 176/305 (57%), Gaps = 4/305 (1%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
           +T   FPGQGSQ +GMG+ LYD F EAR  F E D  L +N + L++ G +EEL  T N 
Sbjct: 11  TTAFMFPGQGSQAVGMGKALYDQFEEARQTFAEADAALGENFTKLVFEGPEEELAMTANT 70

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPA+   SMA +RV+      V  +     GHSLGE TAL +   F+  + +RL R RG+
Sbjct: 71  QPAVFTTSMAALRVLRAR---VDVEPRLCLGHSLGEITALVSVGNFNFRNGVRLARLRGQ 127

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVG-ICEIANDNGGGQVVISGLQDAVKC 180
           SMQ+AVP G+G M AI+G+D   VD++C +AS  G   + AN NG  QVV++G   AV+ 
Sbjct: 128 SMQKAVPAGIGGMAAIMGIDPEAVDAMCTKASIDGEAVQPANINGPSQVVVAGHAAAVER 187

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
            AD   +    RAV L VSAPFH  LM P ++ +  ML  +       P++ N  A    
Sbjct: 188 VADMAHDIEGGRAVTLKVSAPFHCQLMQPAAEALDEMLGILDFHAMSAPVISNVEADANF 247

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
             + +  LLV QVT RVRW  +++     G  +  E+G GKVL GL +RID+SL   S  
Sbjct: 248 DRERVRGLLVRQVTSRVRWDASVRKAIELGCTTAVELGHGKVLRGLCRRIDRSLKVHSCG 307

Query: 301 KVEDI 305
           + +DI
Sbjct: 308 EPKDI 312


>gi|251793203|ref|YP_003007931.1| malonyl CoA-acyl carrier protein transacylase [Aggregatibacter
           aphrophilus NJ8700]
 gi|247534598|gb|ACS97844.1| malonyl CoA-acyl carrier protein transacylase [Aggregatibacter
           aphrophilus NJ8700]
          Length = 312

 Score =  221 bits (562), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 127/302 (42%), Positives = 176/302 (58%), Gaps = 2/302 (0%)

Query: 5   LTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPA 64
           + FPGQGSQ +GM  +L   +P  +  F++   TL  +L  L+  GS EEL  T   QPA
Sbjct: 6   MVFPGQGSQTVGMLAELAGDYPIVQETFKQASETLGYDLWQLVQEGSAEELNKTWQTQPA 65

Query: 65  LTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQ 124
           L   S+A  RV ++    +K ++  +AGHSLGEY+AL  A      D ++LV  RGK MQ
Sbjct: 66  LLTASVAVYRVWQQKYPELKPEV--MAGHSLGEYSALVCAGVLDFQDAVKLVELRGKLMQ 123

Query: 125 EAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAADT 184
           +AVP G G+M AIIGLD+  + + C QA +  +    N N  GQVVI+G + AV+ AA  
Sbjct: 124 QAVPEGTGAMYAIIGLDNEAIINACKQAEQGEVVSAVNFNSPGQVVIAGAKAAVERAAAL 183

Query: 185 CLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSIDE 244
           C   GAKRA+ L VS P H +LM P +  +   L+S+T + P V +L N      S  D 
Sbjct: 184 CKEAGAKRALPLAVSVPSHCTLMKPAADQLSVSLESITLKAPTVSVLNNVDVKAESDADT 243

Query: 245 ISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVED 304
           I   LV Q+   VRW ET++  ++ GV+ + E+G GKVL GL KRI  SL   S++ V+ 
Sbjct: 244 IRNALVRQLYSPVRWTETVEKMSHSGVEVLVEIGPGKVLNGLTKRIVDSLQVTSVNDVKS 303

Query: 305 ID 306
           +D
Sbjct: 304 LD 305


>gi|197284745|ref|YP_002150617.1| malonyl CoA-acyl carrier protein transacylase [Proteus mirabilis
           HI4320]
 gi|194682232|emb|CAR41952.1| malonyl CoA-acyl carrier protein transacylase [Proteus mirabilis
           HI4320]
          Length = 310

 Score =  221 bits (562), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 124/306 (40%), Positives = 174/306 (56%), Gaps = 5/306 (1%)

Query: 5   LTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPA 64
           + FPGQGSQ IGM  +L + +P     F +    L  +L DL+ NG +EEL  T   QPA
Sbjct: 6   MVFPGQGSQAIGMLAELAEHYPIVTETFAQASDVLGYSLWDLVQNGPEEELNKTWKTQPA 65

Query: 65  LTAVSMAFIRV-MEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSM 123
           L A S+A  RV  EK G    +    +AGHSLGEY+AL  A     +  I+LV  RG+ M
Sbjct: 66  LLAASVAIWRVWQEKQG----KMPQMMAGHSLGEYSALVCAGVIDFAAAIKLVELRGQLM 121

Query: 124 QEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAAD 183
           QEAVP G G+M AIIGLD+  +   C  A++  +    N N  GQVVI+G ++AV+ A  
Sbjct: 122 QEAVPAGTGAMYAIIGLDNDAIAKACEDAAQGQVVSPVNFNSPGQVVIAGNKEAVERAGA 181

Query: 184 TCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSID 243
            C   GAKRA+ L VS P H +LM P +  +   L  +  + P + ++ N      +  +
Sbjct: 182 LCKEAGAKRALPLAVSVPSHCALMKPAADKLAVALQEIEFKQPEIQVVNNVDVKAQTDAN 241

Query: 244 EISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVE 303
            I   LV Q+   VRW ET+++ A  G+  + E+G GKVLTGL KRI K ++A +++ + 
Sbjct: 242 AIRDALVRQLYNPVRWTETVEFIAGKGITQLLEIGPGKVLTGLTKRISKEMNAAAVNDIA 301

Query: 304 DIDLAL 309
            +D AL
Sbjct: 302 SLDAAL 307


>gi|262276048|ref|ZP_06053857.1| malonyl CoA-acyl carrier protein transacylase [Grimontia hollisae
           CIP 101886]
 gi|262219856|gb|EEY71172.1| malonyl CoA-acyl carrier protein transacylase [Grimontia hollisae
           CIP 101886]
          Length = 307

 Score =  221 bits (562), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 125/304 (41%), Positives = 175/304 (57%), Gaps = 3/304 (0%)

Query: 5   LTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPA 64
           + FPGQGSQ +GM  +L + FP  +  F E    L  +L  L+ NG  E+L  T   QPA
Sbjct: 6   VVFPGQGSQAVGMLAELAEQFPVVQETFAEASEVLGYDLWALVQNGPAEDLNQTNRTQPA 65

Query: 65  LTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQ 124
           L   S+A  RV ++ G       S +AGHSLGEY+AL  A        ++LV  RG+ MQ
Sbjct: 66  LLTASVAIWRVWQQEG---GAQPSVMAGHSLGEYSALVCAGVIDFKQAVKLVELRGELMQ 122

Query: 125 EAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAADT 184
           EAVP G+G+M AIIGLD+  +   C +A++  +    N N  GQVVI+G ++AV+ A   
Sbjct: 123 EAVPAGVGAMSAIIGLDNDAIAKACEEAAQGQVVSPVNFNSPGQVVIAGNKEAVERANAL 182

Query: 185 CLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSIDE 244
           C   GAKRA+ LPVS P H +LM P +  +   L+ +    P +P++ N   +  +    
Sbjct: 183 CKAAGAKRALPLPVSVPSHCALMKPAADKLAVALEEIEFSAPSIPVINNADVAIETDPAA 242

Query: 245 ISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVED 304
           I   LV Q+ G VRW E  +  AN GV+ + E+G GKVLTGLAKRIDK L+A +++    
Sbjct: 243 IKDALVRQLYGPVRWTEGCEKMANDGVELLLEMGPGKVLTGLAKRIDKRLNAAAVNDPAS 302

Query: 305 IDLA 308
           ++ A
Sbjct: 303 LEAA 306


>gi|227357750|ref|ZP_03842099.1| malonyl CoA-acyl carrier protein transacylase [Proteus mirabilis
           ATCC 29906]
 gi|227162079|gb|EEI47093.1| malonyl CoA-acyl carrier protein transacylase [Proteus mirabilis
           ATCC 29906]
          Length = 310

 Score =  221 bits (562), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 124/306 (40%), Positives = 174/306 (56%), Gaps = 5/306 (1%)

Query: 5   LTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPA 64
           + FPGQGSQ IGM  +L + +P     F +    L  +L DL+ NG +EEL  T   QPA
Sbjct: 6   MVFPGQGSQAIGMLAELAEHYPIVTETFAQASDVLGYSLWDLVQNGPEEELNKTWKTQPA 65

Query: 65  LTAVSMAFIRV-MEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSM 123
           L A S+A  RV  EK G    +    +AGHSLGEY+AL  A     +  I+LV  RG+ M
Sbjct: 66  LLAASVAIWRVWQEKQG----KMPQMMAGHSLGEYSALVCAGVIDFAAAIKLVELRGQLM 121

Query: 124 QEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAAD 183
           QEAVP G G+M AIIGLD+  +   C  A++  +    N N  GQVVI+G ++AV+ A  
Sbjct: 122 QEAVPAGTGAMYAIIGLDNDAIAKACEDAAQGQVVSPVNFNSPGQVVIAGNKEAVERAGA 181

Query: 184 TCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSID 243
            C   GAKRA+ L VS P H +LM P +  +   L  +  + P + ++ N      +  +
Sbjct: 182 LCKEAGAKRALPLAVSVPSHCALMKPAADKLAVALQEIEFKQPEIQVVNNVDVKTQTDAN 241

Query: 244 EISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVE 303
            I   LV Q+   VRW ET+++ A  G+  + E+G GKVLTGL KRI K ++A +++ + 
Sbjct: 242 AIRDALVRQLYNPVRWTETVEFIAGKGITQLLEIGPGKVLTGLTKRISKEMNAAAVNDIA 301

Query: 304 DIDLAL 309
            +D AL
Sbjct: 302 SLDAAL 307


>gi|225873529|ref|YP_002754988.1| malonyl CoA-acyl carrier protein transacylase [Acidobacterium
           capsulatum ATCC 51196]
 gi|225792154|gb|ACO32244.1| malonyl CoA-acyl carrier protein transacylase [Acidobacterium
           capsulatum ATCC 51196]
          Length = 315

 Score =  220 bits (561), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 128/317 (40%), Positives = 186/317 (58%), Gaps = 9/317 (2%)

Query: 1   MST---VLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTA 57
           MST   V  FPGQ SQ +GMGRDLY+ FP AR  FEE D  L  ++S L + G +++L  
Sbjct: 1   MSTPTLVFLFPGQNSQSVGMGRDLYEQFPVARRTFEEADEALGFSVSKLCFEGPEDQLKL 60

Query: 58  TCNAQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVR 117
           T   QPA+  VS+A +RV+++ G+       +VAGHSLGEY A  AA + + +D +R VR
Sbjct: 61  TEFQQPAICTVSVAALRVLQERGI----QPGFVAGHSLGEYAANVAAGSLAFADAVRTVR 116

Query: 118 ARGKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQA--SRVGICEIANDNGGGQVVISGLQ 175
            RG  MQ+AVP G G+M AI+G+        CA A   +  I   AN N   Q VISG  
Sbjct: 117 HRGAYMQQAVPAGKGAMAAILGISSEAAAEACAAAALEKGSIVSAANFNSPEQTVISGEA 176

Query: 176 DAVKCAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFC 235
            AV+ A + C  +GAKR V L VSAPFH +LM P    +  +L  +T  D  +P++ N  
Sbjct: 177 AAVERACELCKERGAKRVVPLQVSAPFHCALMQPAQDQLAKLLHELTFADANMPVVVNVD 236

Query: 236 ASPVSSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLS 295
           A+ V++ + +   L+ QVTG VRW E+++   +       EVG G+VL+GL ++ID++ S
Sbjct: 237 AAMVTTANVLRDALIRQVTGTVRWVESVRNLIDKQPAHFVEVGPGRVLSGLMRQIDRAQS 296

Query: 296 AVSISKVEDIDLALRSI 312
            +++     ++  L ++
Sbjct: 297 CLNVEDKASLEKTLAAL 313


>gi|254482121|ref|ZP_05095363.1| malonyl CoA-acyl carrier protein transacylase [marine gamma
           proteobacterium HTCC2148]
 gi|214037811|gb|EEB78476.1| malonyl CoA-acyl carrier protein transacylase [marine gamma
           proteobacterium HTCC2148]
          Length = 311

 Score =  220 bits (561), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 127/313 (40%), Positives = 180/313 (57%), Gaps = 6/313 (1%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
           +    FPGQGSQ +GM    ++ F   R  + E    L  ++ DL+ NG Q+ L  T   
Sbjct: 5   ANAFVFPGQGSQKVGMLAAAHERFAGVRETYVEASDALGYDVWDLIQNGEQDALNLTETT 64

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QP L + S+A  R  ++ G         +AGHSLGE+TAL  A +   +D ++LVR+RG+
Sbjct: 65  QPVLLSSSVALWRAWQEQG---GAQPEVMAGHSLGEFTALVCAGSLGFADAVKLVRSRGQ 121

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCA 181
            MQ AVP G G+M AIIGLDD  +++IC  +   GI    N N  GQVVI+G   AV+ A
Sbjct: 122 FMQTAVPVGEGAMAAIIGLDDEAINNICGASE--GIVAAVNFNSPGQVVIAGHTAAVESA 179

Query: 182 ADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSS 241
                + GAKRA+ LPVSAPFH+ LM P  + +   +  +T   P VP++ N  A   S 
Sbjct: 180 ITELKDAGAKRALPLPVSAPFHTELMKPAGEQLAAAMADITIVPPQVPVIHNVHAQAESD 239

Query: 242 IDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISK 301
            ++I  LLV+Q+   V+W   +Q     GV +V E G GKVL+GL +RIDKSLS+ S+ +
Sbjct: 240 PEKIRALLVQQIYSPVQWTRCVQAIVAAGVTNVVECGPGKVLSGLNRRIDKSLSSFSLEE 299

Query: 302 VEDIDLALRSIVG 314
            + + +A R  +G
Sbjct: 300 PDSL-MAARQELG 311


>gi|262277393|ref|ZP_06055186.1| malonyl CoA-acyl carrier protein transacylase [alpha
           proteobacterium HIMB114]
 gi|262224496|gb|EEY74955.1| malonyl CoA-acyl carrier protein transacylase [alpha
           proteobacterium HIMB114]
          Length = 308

 Score =  220 bits (561), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 111/305 (36%), Positives = 186/305 (60%), Gaps = 1/305 (0%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M+  + FPGQGSQ +GMGR L ++F  ++ VFEE+D+ LNQNLS++++    ++L  T N
Sbjct: 1   MTKCIVFPGQGSQYLGMGRYLKENFDVSKRVFEEIDNALNQNLSEIIFGNDIKKLNLTEN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
            QPA+ AVS+A    ++K       + +  AGHSLGEY+AL A+++ +LSD  ++++ RG
Sbjct: 61  TQPAIMAVSIATFEALKKEKAINIDNFNLCAGHSLGEYSALVASESINLSDAAKILKKRG 120

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           ++MQ AVP G G M A++ +D   ++    + +   + EI+NDN  GQ VISG +  +  
Sbjct: 121 QAMQNAVPVGEGGMAAVLNMDIESLEKFIIEKNFQTV-EISNDNCPGQCVISGAKKEIDE 179

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
                  +  K+++ LPVSAPFH ++M P ++ +K  +     ++P +P++ N  A    
Sbjct: 180 IVILLKKELKKKSIPLPVSAPFHCNMMKPAAEELKDFMADFDFRNPKIPLVSNVSAKAEH 239

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
             DEI  LL++ +  RV+WR+T+ +F+++ +    E G GK LT + KR +  +  + + 
Sbjct: 240 LSDEIKNLLIKCIFSRVKWRDTVSFFSDNKILEAVECGPGKALTNMFKRFEFEIKCLKLD 299

Query: 301 KVEDI 305
            +EDI
Sbjct: 300 NLEDI 304


>gi|218290498|ref|ZP_03494618.1| malonyl CoA-acyl carrier protein transacylase [Alicyclobacillus
           acidocaldarius LAA1]
 gi|218239519|gb|EED06714.1| malonyl CoA-acyl carrier protein transacylase [Alicyclobacillus
           acidocaldarius LAA1]
          Length = 319

 Score =  220 bits (561), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 125/298 (41%), Positives = 175/298 (58%), Gaps = 9/298 (3%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M+    FPGQG+Q +GMGR ++D +P AR + EE D  L   LSD++++G +E L  T  
Sbjct: 1   MNVAFVFPGQGAQYVGMGRAIFDEYPVARALLEEADEALGMKLSDIIFHGPEETLRLTYY 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDIS--YVAGHSLGEYTALCAAKAFSLSDTIRLVRA 118
            QPAL  VS+A  R      L  + DI    VAGHSLGEY+AL AAK+ S +D ++LV  
Sbjct: 61  TQPALLTVSVAVWR-----ALVDRVDIQPLAVAGHSLGEYSALVAAKSISFADAVKLVYQ 115

Query: 119 RGKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVG--ICEIANDNGGGQVVISGLQD 176
           RGK M EA P G G+M A++GLD+  +  +C +AS     I E+AN N  GQ+VISG + 
Sbjct: 116 RGKLMDEAYPAGQGTMAAVLGLDEEPLREVCKRASEETGEIVELANVNCPGQIVISGAKA 175

Query: 177 AVKCAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCA 236
           AV+ A+      GA+R + L VS PFHSSLM P +  +  +LD +   D   P++ N   
Sbjct: 176 AVERASVLAKEAGARRVMPLNVSGPFHSSLMQPAADRLGALLDEIEFADAETPVVANVDG 235

Query: 237 SPVSSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSL 294
            P     ++   L +Q+   VR+ + +      GV  V E+G G VL+GL ++IDKSL
Sbjct: 236 HPRRMASDLRDALKKQLVMPVRFVDCVLSMKRLGVDCVVELGPGTVLSGLVRKIDKSL 293


>gi|160878674|ref|YP_001557642.1| malonyl CoA-acyl carrier protein transacylase [Clostridium
           phytofermentans ISDg]
 gi|160427340|gb|ABX40903.1| malonyl CoA-acyl carrier protein transacylase [Clostridium
           phytofermentans ISDg]
          Length = 305

 Score =  220 bits (561), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 118/304 (38%), Positives = 182/304 (59%), Gaps = 15/304 (4%)

Query: 7   FPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPAL- 65
           FPGQG+Q  GMG+D YD++ E++ VFE     L+ +++ L++    E L  T   Q A+ 
Sbjct: 8   FPGQGAQYTGMGKDFYDTYKESKEVFELASDILSLDMTKLIFE-EDERLHITEYTQVAMV 66

Query: 66  TAVSMAFIRVMEKN---GLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKS 122
           T ++   + V EKN    +C        AG SLGEY AL  +K  SL D I LVR RG  
Sbjct: 67  TTMTAMLMAVKEKNITPAVC--------AGLSLGEYVALYQSKVLSLKDVIYLVRKRGIY 118

Query: 123 MQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAA 182
           MQEAVP  +G+M A++GL++ +V+ ICA     GI  +AN N  GQ+VISG + +V+ A 
Sbjct: 119 MQEAVPVSVGTMAAVLGLNNELVEEICANTE--GIVTVANYNCPGQIVISGEKHSVEAAK 176

Query: 183 DTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSI 242
            +    GAKR + L VS PFHS ++ P  + ++  L+ +T  DPV+P + N  A  ++S 
Sbjct: 177 ISLEKAGAKRVLPLNVSGPFHSPMLLPAGEKLRKELEVITINDPVIPYVANTTAEYITSK 236

Query: 243 DEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKV 302
           + I   L  QV+  VRW+++++    +G+ +  E+G GK L+   K+ID+++  ++I K+
Sbjct: 237 EPIVDSLAAQVSSSVRWQQSVEKMIANGITTFVEIGPGKTLSSFVKKIDRTMQVINIEKI 296

Query: 303 EDID 306
           ED+D
Sbjct: 297 EDLD 300


>gi|330446416|ref|ZP_08310068.1| malonyl CoA-acyl carrier protein transacylase [Photobacterium
           leiognathi subsp. mandapamensis svers.1.1.]
 gi|328490607|dbj|GAA04565.1| malonyl CoA-acyl carrier protein transacylase [Photobacterium
           leiognathi subsp. mandapamensis svers.1.1.]
          Length = 309

 Score =  220 bits (561), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 121/305 (39%), Positives = 177/305 (58%), Gaps = 3/305 (0%)

Query: 5   LTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPA 64
           + FPGQGSQ +GM  +L + F   +  F E    L  +L  L+ NG  E+L  T   QPA
Sbjct: 6   IVFPGQGSQTVGMLAELAEQFDVVKETFSEASDALGYDLWALVQNGPVEDLNQTQRTQPA 65

Query: 65  LTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQ 124
           L   S+A  RV ++ G       + +AGHSLGEY+AL  A        ++LV  RG+ MQ
Sbjct: 66  LLTASVAIWRVWQQQG---GEQPTVLAGHSLGEYSALVCAGVIDFKAAVKLVELRGQLMQ 122

Query: 125 EAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAADT 184
           EAVP G+G+M AIIGLD+  +   C +A++  +C   N N  GQVVI+G ++AV+ A   
Sbjct: 123 EAVPAGVGAMSAIIGLDNDAIAKACEEAAQGEVCSPVNFNSPGQVVIAGNKEAVERANVL 182

Query: 185 CLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSIDE 244
           C   GAKRA+ LPVS P H +LM P +  +   L+S+    P VP++ N   +  +    
Sbjct: 183 CKEAGAKRALPLPVSVPSHCALMKPAADKLAVALESIEFNAPSVPVINNADVATETDPAA 242

Query: 245 ISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVED 304
           I   LV+Q+   VRW E+++  A  G++ + E+G GKVLTGL KRID++L   +++ V  
Sbjct: 243 IKLALVKQLYSPVRWTESVERMAAEGIEELLEMGPGKVLTGLTKRIDRALGGAAVNDVAS 302

Query: 305 IDLAL 309
           ++ A+
Sbjct: 303 LEAAI 307


>gi|152979803|ref|YP_001353047.1| [acyl-carrier-protein] S-malonyltransferase [Janthinobacterium sp.
           Marseille]
 gi|151279880|gb|ABR88290.1| [acyl-carrier-protein] S-malonyltransferase [Janthinobacterium sp.
           Marseille]
          Length = 310

 Score =  220 bits (561), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 127/306 (41%), Positives = 174/306 (56%), Gaps = 4/306 (1%)

Query: 5   LTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPA 64
             FPGQGSQ IGM     D+    + + E  D  L  +L+ L+  G +EEL  T N QP 
Sbjct: 6   FVFPGQGSQAIGMLNGFADNAVVQQTLAEASD-ALQFDLAKLISEGPKEELDLTTNTQPV 64

Query: 65  LTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQ 124
           +   ++A  R     G    +  + VAGHSLGEY+AL AA   +  D + LVR R K+MQ
Sbjct: 65  MLTAAVAMYRAWIAAG---GKTPALVAGHSLGEYSALVAAGVIAFKDAVPLVRFRAKAMQ 121

Query: 125 EAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAADT 184
           EAVP G G M AI+GL D  V ++CA+A++  + E  N N   QVVI+G + A++ A + 
Sbjct: 122 EAVPVGQGGMAAILGLSDADVLAVCAEAAQGDVVEAVNFNAPAQVVIAGHKAAIERACEV 181

Query: 185 CLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSIDE 244
              KGAKRA+ LPVSAPFHSSL+ P S  ++  + ++T   P +P++ N   + VS +D 
Sbjct: 182 AKAKGAKRALSLPVSAPFHSSLLKPASDRLREYMATLTFNAPQIPLINNVDVAIVSDVDG 241

Query: 245 ISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVED 304
           I   LV Q    VRW E++Q  A  G+  V E G GKVL GL KRI+  L+  +I     
Sbjct: 242 IKDALVRQAANPVRWVESVQKMAAEGITDVVECGPGKVLAGLTKRINGELTGHAIVDQAS 301

Query: 305 IDLALR 310
           +D  L 
Sbjct: 302 LDAVLE 307


>gi|110598666|ref|ZP_01386931.1| malonyl CoA-acyl carrier protein transacylase [Chlorobium
           ferrooxidans DSM 13031]
 gi|110339719|gb|EAT58229.1| malonyl CoA-acyl carrier protein transacylase [Chlorobium
           ferrooxidans DSM 13031]
          Length = 302

 Score =  220 bits (561), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 125/305 (40%), Positives = 176/305 (57%), Gaps = 6/305 (1%)

Query: 5   LTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPA 64
             FPGQGSQ  GMG+D+++++P AR + E+ D  L  +++D+M++GS+E+L  T   QPA
Sbjct: 4   FVFPGQGSQYCGMGKDIFETYPAARTLMEKADAILGFSITDIMFSGSEEDLRQTKYTQPA 63

Query: 65  LTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQ 124
           +      F+  +    L  ++DI   AGHSLGEY+ALC A A S  D IR+V  RG+ MQ
Sbjct: 64  I------FLHSVAVATLIGRKDIVMTAGHSLGEYSALCIAGALSFEDAIRIVAKRGELMQ 117

Query: 125 EAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAADT 184
            A     G+M AIIG+ D  +  + A+AS  GI + AN N  GQ+VISG   AVK A   
Sbjct: 118 NAGQQNPGTMAAIIGMPDAALPELLAEASSEGIVQAANYNSPGQIVISGDLAAVKKAVAL 177

Query: 185 CLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSIDE 244
             +KGA+ A  L VS  FHS LM P  + +   L+ +  +D  +P+  N  A  V+   E
Sbjct: 178 APSKGARMAKELVVSGAFHSPLMKPAEEELARALELIDIKDAEIPVCMNAVAHAVTGAAE 237

Query: 245 ISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVED 304
           I + L+ Q+T  V W ++I+     G+ +  EVG  KVL GL KRIDKS++   I    D
Sbjct: 238 IRKNLILQLTSSVLWSQSIEAMVKSGITAFVEVGPQKVLQGLIKRIDKSVTTTGIDTAAD 297

Query: 305 IDLAL 309
           I   L
Sbjct: 298 IQAVL 302


>gi|226330534|ref|ZP_03806052.1| hypothetical protein PROPEN_04452 [Proteus penneri ATCC 35198]
 gi|225201329|gb|EEG83683.1| hypothetical protein PROPEN_04452 [Proteus penneri ATCC 35198]
          Length = 310

 Score =  220 bits (561), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 123/306 (40%), Positives = 175/306 (57%), Gaps = 5/306 (1%)

Query: 5   LTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPA 64
           + FPGQGSQ +GM  +L + +P     F +    L  +L DL+ NG +EEL  T   QPA
Sbjct: 6   MVFPGQGSQSVGMLAELAEQYPIVTETFAQASDVLGYSLWDLVQNGPEEELNKTWKTQPA 65

Query: 65  LTAVSMAFIRV-MEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSM 123
           L A S+A  RV  EK G    +    +AGHSLGEY+AL  A     +  I+LV  RG+ M
Sbjct: 66  LLAASVAIWRVWQEKQG----KMPQMMAGHSLGEYSALVCAGVIDFAAAIKLVELRGQLM 121

Query: 124 QEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAAD 183
           QEAVP G G+M AIIGLD+  +   C +A++  +    N N  GQVVI+G ++AV+ A  
Sbjct: 122 QEAVPAGTGAMYAIIGLDNDAIAKACEEAAQGQVVSPVNFNSPGQVVIAGNKEAVERAGV 181

Query: 184 TCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSID 243
            C   GAKRA+ L VS P H +LM P +  +   L  +  + P + ++ N      +  +
Sbjct: 182 LCKEAGAKRALPLAVSVPSHCALMKPAADKLAVALQEIEFKQPEIQVVNNVDVKAQTDAN 241

Query: 244 EISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVE 303
            I   LV Q+   VRW ET+++ A  G+  + E+G GKVLTGL KRI K ++A +++ + 
Sbjct: 242 AIRDALVRQLYNPVRWTETVEFIAEKGITQLLEIGPGKVLTGLTKRISKEMNAAAVNDIA 301

Query: 304 DIDLAL 309
            +D AL
Sbjct: 302 SLDAAL 307


>gi|54308387|ref|YP_129407.1| acyl carrier protein S-malonyltransferase [Photobacterium profundum
           SS9]
 gi|46912815|emb|CAG19605.1| putative malonyl Coa-acyl carrier protein transacylase
           [Photobacterium profundum SS9]
          Length = 307

 Score =  220 bits (561), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 122/296 (41%), Positives = 173/296 (58%), Gaps = 3/296 (1%)

Query: 5   LTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPA 64
           + FPGQGSQ +GM  +L + F   +  F E    L  +L  L+ NG  E+L  T   QPA
Sbjct: 6   IIFPGQGSQAVGMLAELAEHFDVVKHTFAEASEVLGYDLWTLVQNGPAEDLNQTDRTQPA 65

Query: 65  LTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQ 124
           L   S+A  RV ++ G       + +AGHSLGEY+AL  A      + I+LV  RG+ MQ
Sbjct: 66  LLTASVAIWRVWQEQG---GEQPTVLAGHSLGEYSALVCAGVIDFKEAIKLVELRGQLMQ 122

Query: 125 EAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAADT 184
           EAVP G+G+M AIIGLD+  +   C  A++  I    N N  GQVVI+G +DAV+ A   
Sbjct: 123 EAVPAGVGAMSAIIGLDNDSIAKACEAAAQDQIVSPVNFNSPGQVVIAGNKDAVERANVL 182

Query: 185 CLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSIDE 244
           C   GAKRA+ LPVS P H +LM P +  +   L+++    P +P++ N      S    
Sbjct: 183 CKEAGAKRALPLPVSVPSHCALMKPAADKLAVALEAIEFNTPSIPVINNADVQTESDPAA 242

Query: 245 ISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
           I   LV+Q+ G VRW E+++  AN G++ + E+G GKVLTGL KRI+++LS+  ++
Sbjct: 243 IKLALVKQLYGPVRWTESVERMANEGIEQLLEMGPGKVLTGLTKRINRALSSAVVN 298


>gi|189345717|ref|YP_001942246.1| malonyl CoA-acyl carrier protein transacylase [Chlorobium limicola
           DSM 245]
 gi|189339864|gb|ACD89267.1| malonyl CoA-acyl carrier protein transacylase [Chlorobium limicola
           DSM 245]
          Length = 302

 Score =  220 bits (561), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 120/301 (39%), Positives = 173/301 (57%), Gaps = 6/301 (1%)

Query: 5   LTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPA 64
             FPGQGSQ  GMGRD++DSFP A  +  + D  L  +++D+M++GS+++L  T   QPA
Sbjct: 4   FVFPGQGSQYCGMGRDIFDSFPAAHEMMRKADEILGFSITDIMFSGSEDDLRQTRYTQPA 63

Query: 65  LTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQ 124
           +      F+  +    L     ++  AGHSLGEY+ALC A A S  D I +V  RG+ MQ
Sbjct: 64  V------FLHSIAAASLLGNEGVAMTAGHSLGEYSALCFAGAISFGDAIHIVAKRGELMQ 117

Query: 125 EAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAADT 184
            A     G+M A+IG+ D  V ++ A+A+  G+ + AN N  GQVVISG   A+K A + 
Sbjct: 118 HAGSQNPGTMAALIGMQDSAVANLLAEAASEGVVQAANFNSPGQVVISGEVGAIKKALEL 177

Query: 185 CLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSIDE 244
             + GA+ A  L VS  FHS LM P  + +   L+ V  +D  +P+  N  A PV++  E
Sbjct: 178 APSHGARMAKELVVSGAFHSPLMKPAEQELAAALELVEIRDARIPVCMNAVAEPVTAAAE 237

Query: 245 ISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVED 304
           I + L+ Q+T  V W ++I+    +G+    E+G  KVL GL +RIDKS+    I   ED
Sbjct: 238 IRKNLIMQLTSPVLWTQSIEAMIQNGITDFVEIGPQKVLQGLIRRIDKSVRISGIDTAED 297

Query: 305 I 305
           I
Sbjct: 298 I 298


>gi|219849849|ref|YP_002464282.1| malonyl CoA-acyl carrier protein transacylase [Chloroflexus
           aggregans DSM 9485]
 gi|219544108|gb|ACL25846.1| malonyl CoA-acyl carrier protein transacylase [Chloroflexus
           aggregans DSM 9485]
          Length = 319

 Score =  220 bits (560), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 131/314 (41%), Positives = 187/314 (59%), Gaps = 13/314 (4%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           MS    FPGQGSQV+GMGRDL  + P AR +F   D TL+  LS+L ++G + +LTAT N
Sbjct: 1   MSIAWVFPGQGSQVVGMGRDLITASPAARQIFAIADETLDFGLSELCFSGPETDLTATEN 60

Query: 61  AQPALTAVSMAFIRVM-EKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRAR 119
           AQPAL   S+A +  + E +G  ++  I+ VAGHSLGEY+AL A  +      +RLVR R
Sbjct: 61  AQPALLTTSIALLAALREVSGDRLEPPIA-VAGHSLGEYSALVAGGSLDFVTALRLVRRR 119

Query: 120 GKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRV----GICE----IANDNGGGQVVI 171
           G+ M  A     G M A+IGLD  V++ IC + S      G+ +    IAN N   Q+VI
Sbjct: 120 GELMAAAHE---GGMAAVIGLDADVLEQICDEVSATLQEHGVSQSTVVIANYNAPDQLVI 176

Query: 172 SGLQDAVKCAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPIL 231
           SG   AV+ A+    ++GAKR + L VSA FHS LM   ++ M   +  V+ +D  +P++
Sbjct: 177 SGTSVAVEHASLLAKSRGAKRVIPLKVSAAFHSPLMVDAAEGMAKAIAEVSIRDLDIPLI 236

Query: 232 PNFCASPVSSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRID 291
            N  A P+ S D++ R +V QV   VRW  ++++    GV++  E+G G+VLTGL +RI 
Sbjct: 237 ANVTAEPIRSTDDVRREIVAQVVAPVRWIASVRYMVAMGVETFIEIGPGRVLTGLIRRIA 296

Query: 292 KSLSAVSISKVEDI 305
                ++I+  EDI
Sbjct: 297 PEARLINIATFEDI 310


>gi|326335313|ref|ZP_08201508.1| malonyl-CoA-[acyl-carrier-protein] transacylase [Capnocytophaga sp.
           oral taxon 338 str. F0234]
 gi|325692584|gb|EGD34528.1| malonyl-CoA-[acyl-carrier-protein] transacylase [Capnocytophaga sp.
           oral taxon 338 str. F0234]
          Length = 292

 Score =  220 bits (560), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 119/298 (39%), Positives = 171/298 (57%), Gaps = 7/298 (2%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M     FPGQGSQ +GMG+DLY+S P A+ +FEE +H L   ++++M+ G +E L  TC 
Sbjct: 1   MKKAYIFPGQGSQFVGMGKDLYESHPLAKSLFEEANHILGFAITEVMFAGDEEALKQTCV 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
            QPA+   S     V+++  L        VAGHSLGE++AL ++   +    + LV  R 
Sbjct: 61  TQPAIFLHS-----VIQRQVLGDAFTPDMVAGHSLGEFSALVSSGVLTFEQGLHLVAKRA 115

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           ++MQ+A     G+M AI+GLDD VV+  C      GI   AN N  GQ+VISG  +AV+ 
Sbjct: 116 EAMQKACELQRGTMAAILGLDDAVVEQACKDTE--GIVTPANYNCPGQLVISGAYEAVEK 173

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A +T    GAKRA+ LPV   FHSSLM P  + +   +  +T Q P+ PI  N   + V+
Sbjct: 174 ACETLKAVGAKRALILPVGGAFHSSLMKPAEEELAAAIGEITFQKPLCPIYQNVTTTAVT 233

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVS 298
             D I + L+ Q+T  V+W +++Q     G    YE+  GKVL GL K+I+K ++  S
Sbjct: 234 DPDAIKQNLIAQLTAPVKWTQSVQQMIADGATEFYELAPGKVLQGLVKKINKDVAVFS 291


>gi|300857344|ref|YP_003782328.1| malonyl-CoA-acyl carrier protein transacylase [Clostridium
           ljungdahlii DSM 13528]
 gi|300437459|gb|ADK17226.1| malonyl-CoA-acyl carrier protein transacylase [Clostridium
           ljungdahlii DSM 13528]
          Length = 312

 Score =  219 bits (559), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 110/300 (36%), Positives = 182/300 (60%), Gaps = 4/300 (1%)

Query: 7   FPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPALT 66
           F GQG+Q +GMG+DL+++    + VF++ D  L+ ++S++ + G +E+L  T N QPA+ 
Sbjct: 8   FSGQGAQYVGMGKDLFENIDVCKNVFKDADEVLDFSISNMCFEGPEEDLNKTENTQPAIL 67

Query: 67  AVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQEA 126
             S+A +R +E  G  +K DI+  AG SLGEY+AL  +      + + LV+ RGK MQEA
Sbjct: 68  TTSIAALRALE--GFGIKPDIA--AGLSLGEYSALVCSGVMEFKEAVSLVKKRGKYMQEA 123

Query: 127 VPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAADTCL 186
           VP G+G+M AI+GLD   V+ ICA +S  GI E +N N  GQVVI G  +AVK A     
Sbjct: 124 VPEGIGTMAAILGLDYVKVEKICADSSSFGIVETSNMNCPGQVVIGGEIEAVKAACKLAK 183

Query: 187 NKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSIDEIS 246
            +GA+RA+ L VS PFH+S++ P ++ ++  L+ ++ ++  +P++ N     +  +D + 
Sbjct: 184 ERGARRAIELSVSGPFHTSMLKPAAEKLEGELNKLSLKEFSIPVVTNVTGEVIEKLDNVK 243

Query: 247 RLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVEDID 306
             L  QV   V + ++I      G  +  E+G GKVL+G  ++ID+    +++  ++ ++
Sbjct: 244 PYLKRQVMSTVLFEKSINTMIEAGADTFVEIGPGKVLSGFVRKIDRKALILNVQDIKSLN 303


>gi|148657572|ref|YP_001277777.1| malonyl CoA-acyl carrier protein transacylase [Roseiflexus sp.
           RS-1]
 gi|148569682|gb|ABQ91827.1| [Acyl-carrier-protein] S-malonyltransferase [Roseiflexus sp. RS-1]
          Length = 324

 Score =  219 bits (559), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 119/301 (39%), Positives = 174/301 (57%), Gaps = 2/301 (0%)

Query: 5   LTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPA 64
           L FPGQGSQ +GMG++LY++ P AR +FE+ D  L   LS L + G QEEL  T NAQPA
Sbjct: 7   LVFPGQGSQYVGMGKELYEASPAARRIFEQADQVLGFELSKLCFEGPQEELDDTVNAQPA 66

Query: 65  LTAVSMAFIRVM-EKNG-LCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKS 122
           +  VS+A +  + E+ G        S VAGHSLGE+TAL AA      D ++LVR RG+ 
Sbjct: 67  ILTVSIACLEALKERFGPFGYLGAPSLVAGHSLGEFTALVAAGVLDFEDALKLVRERGRL 126

Query: 123 MQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAA 182
           M+E+     G M A++GLDD  ++ +  +A   G+  +AN N  GQ V+SG   A++ A 
Sbjct: 127 MKESGEQRPGGMAAVVGLDDKTLEEVVQEAQAEGVVSVANANSPGQTVLSGEHRALQRAM 186

Query: 183 DTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSI 242
           +    +GAK    L VS   HS LM   S     +LD    + P VP++ N     ++++
Sbjct: 187 ELAKARGAKLVQRLQVSIAAHSPLMQSASARFNELLDRFQLRPPEVPLIANISGRALTTV 246

Query: 243 DEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKV 302
           +E+ + L +Q+T  V+W  ++Q   +HGV ++ EVG  +VL+GL KRI      V ++  
Sbjct: 247 EELRQELSQQLTRPVQWTRSVQEMVSHGVDTIVEVGPRQVLSGLIKRITPHARPVPLTDT 306

Query: 303 E 303
           E
Sbjct: 307 E 307


>gi|198283690|ref|YP_002220011.1| malonyl CoA-acyl carrier protein transacylase [Acidithiobacillus
           ferrooxidans ATCC 53993]
 gi|218666528|ref|YP_002426320.1| malonyl CoA-acyl carrier protein transacylase [Acidithiobacillus
           ferrooxidans ATCC 23270]
 gi|198248211|gb|ACH83804.1| malonyl CoA-acyl carrier protein transacylase [Acidithiobacillus
           ferrooxidans ATCC 53993]
 gi|218518741|gb|ACK79327.1| malonyl CoA-acyl carrier protein transacylase [Acidithiobacillus
           ferrooxidans ATCC 23270]
          Length = 311

 Score =  219 bits (559), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 127/311 (40%), Positives = 172/311 (55%), Gaps = 3/311 (0%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
           S    FPGQGSQ + M  DL +S P  + VFEE    L ++L  L   G  E+L+ T   
Sbjct: 4   SIAFVFPGQGSQSLNMLADLANSHPLVKEVFEEASAQLGEDLWRLTQEGPTEKLSQTRWT 63

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QP +     A  RV E+ G        +VAGHSLGEYTAL  A A    D +RLV  RG+
Sbjct: 64  QPVMLTAGYAVYRVWEEEGGIFP---DFVAGHSLGEYTALVVADAVDFVDAVRLVAERGR 120

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCA 181
            MQEAVP G+G+M AIIGL D  V  +CAQ +R  +   AN N  GQVV +G Q AV+  
Sbjct: 121 LMQEAVPEGVGAMAAIIGLGDDEVKQLCAQEARGEVLAAANFNAPGQVVAAGHQAAVERL 180

Query: 182 ADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSS 241
            ++    GAKR V LPVS P H SLM P ++  +  L++V  + P   ++ N      ++
Sbjct: 181 VESARAAGAKRVVLLPVSVPSHCSLMEPAAERFQSALEAVQFRSPRAMVVHNADVQSHNT 240

Query: 242 IDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISK 301
            D I  +L  Q+   VRW +TI+  A  G  +  E+G G+VL+GL KRI+ SL+ + +  
Sbjct: 241 PDSIRAVLARQLYSPVRWTDTIRHLARQGAMTFVEMGPGRVLSGLGKRIEPSLTMLHVED 300

Query: 302 VEDIDLALRSI 312
            + +  AL  I
Sbjct: 301 GKSLKAALEVI 311


>gi|315126337|ref|YP_004068340.1| malonyl-CoA-[acyl-carrier-protein] transacylase [Pseudoalteromonas
           sp. SM9913]
 gi|315014851|gb|ADT68189.1| malonyl-CoA-[acyl-carrier-protein] transacylase [Pseudoalteromonas
           sp. SM9913]
          Length = 308

 Score =  219 bits (559), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 130/305 (42%), Positives = 171/305 (56%), Gaps = 5/305 (1%)

Query: 5   LTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPA 64
           L FPGQGSQ +GM  +L +S    +  F E    L  +L+DL+ NG +E+L  T   QPA
Sbjct: 7   LLFPGQGSQTVGMLNELLESSDIVKATFAEASTALGYDLADLVLNGPEEKLNQTHRTQPA 66

Query: 65  LTAVSMAFIRVMEKNGLCVKRDISYV-AGHSLGEYTALCAAKAFSLSDTIRLVRARGKSM 123
           L   S+A  R    + L        V AGHSLGEY+AL  +   SLS+ ++LV  RG  M
Sbjct: 67  LLTASVAIYR----HWLAANPGADVVMAGHSLGEYSALVCSDVISLSEAVKLVENRGLYM 122

Query: 124 QEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAAD 183
           QEAVP G+GSM AIIGL D  + + C  +++  +    N N  GQVVI+G +DAV  A+ 
Sbjct: 123 QEAVPAGVGSMAAIIGLGDDEIKAACEASAQGEVVSPVNYNSPGQVVIAGHKDAVDRASV 182

Query: 184 TCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSID 243
            C   GAKRA+ L VS P H  LM P ++ +   L ++T   P   ++ N       S D
Sbjct: 183 ACKEAGAKRALPLSVSVPSHCELMKPAAEKLAADLAALTFNSPKCDVINNVDVKAECSAD 242

Query: 244 EISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVE 303
            I   LV Q+   VRW ET+Q     GV   YE G GKVLTGLAKRIDK++   S++ + 
Sbjct: 243 AIKEALVRQLYSPVRWTETVQALVAQGVTQSYEFGPGKVLTGLAKRIDKAMVCGSVNDLA 302

Query: 304 DIDLA 308
            ID A
Sbjct: 303 SIDTA 307


>gi|325981367|ref|YP_004293769.1| malonyl CoA-acyl carrier protein transacylase [Nitrosomonas sp.
           AL212]
 gi|325530886|gb|ADZ25607.1| malonyl CoA-acyl carrier protein transacylase [Nitrosomonas sp.
           AL212]
          Length = 314

 Score =  219 bits (559), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 124/315 (39%), Positives = 177/315 (56%), Gaps = 7/315 (2%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M     FPGQGSQ +GM  + Y   P  +  F+E    L Q+   +  +GS+EEL  T N
Sbjct: 1   MKFAFVFPGQGSQSVGM-MNGYKELPIIQETFQEASDILKQDFWSMANSGSEEELNLTLN 59

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
            QP +    +A  R     G    ++ + +AGHSLGEYTAL A++A   +D + LVR R 
Sbjct: 60  TQPLMLIAGVAVYRAWISLG---GKEPALLAGHSLGEYTALVASEALGFADALSLVRFRA 116

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVG---ICEIANDNGGGQVVISGLQDA 177
           ++MQ+AVP G+G M AI+GLDD  + +IC   +  G     E AN N  GQ+VI+G ++A
Sbjct: 117 QAMQKAVPEGVGGMAAILGLDDETIKTICRDITNQGNGESLEPANFNSPGQIVIAGHRNA 176

Query: 178 VKCAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCAS 237
           +    +   +KGAKRA+ LP+S P H SLM P ++ M+  L  V  Q P +PIL N    
Sbjct: 177 ILQGIELAKSKGAKRAIMLPMSIPSHCSLMKPAAESMRLQLQHVPLQSPKIPILHNTDVK 236

Query: 238 PVSSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAV 297
           P S    I   LV+Q+   + W +T++ F    +  V E G GKVL+GL KRID+ L  +
Sbjct: 237 PHSDPLIIKETLVQQLINPIHWVDTVRAFVTAEITHVVECGPGKVLSGLNKRIDQHLQQL 296

Query: 298 SISKVEDIDLALRSI 312
           S++    I LA+  +
Sbjct: 297 SLADSGAIKLAINDV 311


>gi|109898440|ref|YP_661695.1| malonyl CoA-acyl carrier protein transacylase [Pseudoalteromonas
           atlantica T6c]
 gi|109700721|gb|ABG40641.1| [Acyl-carrier-protein] S-malonyltransferase [Pseudoalteromonas
           atlantica T6c]
          Length = 309

 Score =  219 bits (559), Expect = 4e-55,   Method: Compositional matrix adjust.
 Identities = 123/301 (40%), Positives = 173/301 (57%), Gaps = 5/301 (1%)

Query: 7   FPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPALT 66
           FPGQGSQ +GM +DL    P     F      L  +L D++ N + + L  T   QPAL 
Sbjct: 8   FPGQGSQTVGMLKDLAAHHPLVEETFSRASKVLGYDLWDVVQNDNGQTLGQTQVTQPALL 67

Query: 67  AVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQEA 126
           A S A  +V++     +     Y+AGHSLGEY+AL  A   S  D ++LV ARG+ MQ+A
Sbjct: 68  AASFAIFQVLKAQSANLPH---YLAGHSLGEYSALVCAGVLSFEDGVKLVEARGQFMQQA 124

Query: 127 VPPGLGSMVAIIGLDDCVVDSICAQASR--VGICEIANDNGGGQVVISGLQDAVKCAADT 184
           VP G+G+M AIIGLDD  V   C QA      I    N N  GQVVI+G  +A + +A+ 
Sbjct: 125 VPEGVGAMYAIIGLDDAKVIQACEQAQNETQQIVSAVNFNSPGQVVIAGNAEAAEKSAEL 184

Query: 185 CLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSIDE 244
           C   GAKRA+ L VS P H +LM P +  +  + +++    P + ++ N   +  S++++
Sbjct: 185 CKEAGAKRALPLAVSVPSHCALMKPAADKLAELFETIEFTTPSIGVVNNVDVAIESNVED 244

Query: 245 ISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVED 304
           I   L+ Q+   VRW ETIQ  +  GV  ++E+G GKVLTGL KRIDKSLS  +++  E 
Sbjct: 245 IKSALLRQLYSPVRWTETIQKLSALGVSQIHEIGPGKVLTGLIKRIDKSLSCDAVNNAET 304

Query: 305 I 305
           +
Sbjct: 305 V 305


>gi|258645858|ref|ZP_05733327.1| malonyl CoA-acyl carrier protein transacylase [Dialister invisus
           DSM 15470]
 gi|260403231|gb|EEW96778.1| malonyl CoA-acyl carrier protein transacylase [Dialister invisus
           DSM 15470]
          Length = 312

 Score =  219 bits (559), Expect = 4e-55,   Method: Compositional matrix adjust.
 Identities = 126/315 (40%), Positives = 180/315 (57%), Gaps = 5/315 (1%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M T   FPGQGSQ +GM  DLY+ +   + +  E D TL  ++S +M+ G   EL  T  
Sbjct: 1   MKTAFFFPGQGSQKVGMVHDLYEKYDSVKKIIREADDTLGFSISKMMFEGPDTELMKTEF 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
            QPA+   S+   +V+++ G  V  D++  AGHSLGEY+AL AA + S SD +  V  RG
Sbjct: 61  TQPAILTASVCCWQVLKEEG--VTPDVA--AGHSLGEYSALVAAGSISFSDAVHTVNLRG 116

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQAS-RVGICEIANDNGGGQVVISGLQDAVK 179
           K MQEAVP G GSM A+IGLD   +  +CA  S      +  N N  GQ VI+G   AV+
Sbjct: 117 KFMQEAVPLGEGSMAAVIGLDPDRITEVCAGVSTESQPVQAVNFNCPGQTVIAGAAGAVE 176

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            A       GAKRA+ L VSAPFHSSLM P ++ +K +LD +  +D  +P++ N  A   
Sbjct: 177 KACAALKEAGAKRAIMLNVSAPFHSSLMEPAAQKLKKVLDKIEIKDAEIPVIANVNALAE 236

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
           +   +I   LVEQ    VRW E+++     G+ ++ E G G VL+G  ++IDKS+ +   
Sbjct: 237 TKAADIRTHLVEQAAHAVRWEESVRNLIAGGMDTMVECGPGTVLSGFMRKIDKSIVSYHA 296

Query: 300 SKVEDIDLALRSIVG 314
             +E I   ++++ G
Sbjct: 297 ENIETIIETVQALKG 311


>gi|78186022|ref|YP_374065.1| malonyl CoA-acyl carrier protein transacylase [Chlorobium luteolum
           DSM 273]
 gi|78165924|gb|ABB23022.1| [Acyl-carrier-protein] S-malonyltransferase [Chlorobium luteolum
           DSM 273]
          Length = 301

 Score =  219 bits (559), Expect = 4e-55,   Method: Compositional matrix adjust.
 Identities = 120/288 (41%), Positives = 167/288 (57%), Gaps = 6/288 (2%)

Query: 5   LTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPA 64
             FPGQGSQ  GMGRD+YD+FP A+ + E+ +  L   ++D+M+ GS+EEL  T + QPA
Sbjct: 4   FVFPGQGSQYCGMGRDIYDTFPAAKALMEQANDILGYRITDIMFLGSEEELRQTMHTQPA 63

Query: 65  LTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQ 124
           +   SMA    +   G      ++  AGHSLGEY+ALC A A S  D +++V  RG+ MQ
Sbjct: 64  IFLHSMAAASQLNAEG------VAMTAGHSLGEYSALCFAGAISFEDAVKIVAERGRLMQ 117

Query: 125 EAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAADT 184
           +A     G+M AIIG+ D  +D++ A+A   GI + AN N  GQ+VISG   AVK A + 
Sbjct: 118 QAGTEKPGTMAAIIGMQDSALDALLAEAGAEGIVQAANFNSPGQIVISGDIAAVKKAVEL 177

Query: 185 CLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSIDE 244
               GA+ A  L VS  FHS LM P  + +   L++V  ++  +P+  N  A  V+   E
Sbjct: 178 APAHGARMAKELVVSGAFHSPLMKPAEEKLAAALEAVDIKNATIPVCMNAVARTVTDAAE 237

Query: 245 ISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDK 292
           I + LV Q+T  V W ++I+     G+    EVG  KVL GL KRI K
Sbjct: 238 IRKNLVLQLTSSVLWTQSIEEMTTAGITRFVEVGPQKVLQGLIKRISK 285


>gi|310779305|ref|YP_003967638.1| (Acyl-carrier-protein) S-malonyltransferase [Ilyobacter polytropus
           DSM 2926]
 gi|309748628|gb|ADO83290.1| (Acyl-carrier-protein) S-malonyltransferase [Ilyobacter polytropus
           DSM 2926]
          Length = 301

 Score =  219 bits (558), Expect = 4e-55,   Method: Compositional matrix adjust.
 Identities = 116/306 (37%), Positives = 180/306 (58%), Gaps = 7/306 (2%)

Query: 1   MSTV-LTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATC 59
           MS +   FPGQG+Q +GMG+DLY++   A+  F+E+   +  +L  +M+ G +E+L  T 
Sbjct: 1   MSKIAFVFPGQGAQYVGMGKDLYENNEIAKKYFDEIFENMEIDLKRVMFEGPEEDLKQTK 60

Query: 60  NAQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRAR 119
             QPA+ A+S+   ++ME+ G  +K D  YVAGHS+GEY AL +    SL D ++L   R
Sbjct: 61  YTQPAIVAMSLVLAKLMEEKG--IKAD--YVAGHSVGEYAALGSGGYLSLEDAVKLTAFR 116

Query: 120 GKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVK 179
           G +M        G+M AIIG++   ++ + A     G+ E  N N  GQ VI+G   A++
Sbjct: 117 GDTMNTVSQEVNGTMAAIIGMEAAKIEEVLAGVD--GVVEAVNFNEPGQTVIAGSVAAIE 174

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            A +     GA+RA+ L VS PFHSSLM P  + +K  +++   +     ++ N  A   
Sbjct: 175 KACEALKAAGARRALILSVSGPFHSSLMKPAGEKLKAEVENYEFKTGTAKLVANTTAEVT 234

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
           +  +EI + L +Q  G VRW ET++   + GV+ +YE+G GKVL GL ++IDK+L   +I
Sbjct: 235 TDAEEIKKELYDQTFGPVRWVETVEKLKSEGVEKIYEIGPGKVLKGLIRKIDKTLVVENI 294

Query: 300 SKVEDI 305
            K+ED+
Sbjct: 295 EKLEDL 300


>gi|237808938|ref|YP_002893378.1| malonyl CoA-acyl carrier protein transacylase [Tolumonas auensis
           DSM 9187]
 gi|237501199|gb|ACQ93792.1| malonyl CoA-acyl carrier protein transacylase [Tolumonas auensis
           DSM 9187]
          Length = 311

 Score =  219 bits (558), Expect = 5e-55,   Method: Compositional matrix adjust.
 Identities = 123/308 (39%), Positives = 179/308 (58%), Gaps = 3/308 (0%)

Query: 5   LTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPA 64
           + FPGQGSQ +GM  +L +++P  +  F E    L  +L +L+  G  EEL  T   QPA
Sbjct: 6   IAFPGQGSQSVGMLAELAEAYPIIKETFAEASAVLGYDLFELVTQGPAEELNKTWKTQPA 65

Query: 65  LTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQ 124
           L   S+A  R+ +  G       + +AGHSLGEY+AL  A A + +D ++LV  RG++MQ
Sbjct: 66  LLTSSVALWRLWQAQGGATP---AVMAGHSLGEYSALVCAGALNFTDAVKLVELRGQAMQ 122

Query: 125 EAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAADT 184
            AVP G+G+M AIIGLD+  + + C +A+   +    N N  GQVVI+G ++AV+ A   
Sbjct: 123 RAVPEGVGAMAAIIGLDNDSIAANCEKAAEDQVVSPVNFNSPGQVVIAGHKEAVERANVL 182

Query: 185 CLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSIDE 244
               GAKRA+ LPVS P H +LM P +  +   LD++  + PV+P++ N   + V+    
Sbjct: 183 MKESGAKRALPLPVSVPSHCALMKPAADELAVALDALDVKAPVIPVINNADVATVTDPAA 242

Query: 245 ISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVED 304
           I   L+ Q+   VRW ET++  AN  V    E+G GKVLTGL KRIDK +   +I+ V  
Sbjct: 243 IKDALIRQLYSPVRWTETVERMANEDVTFEIEMGPGKVLTGLVKRIDKRVDGCAINDVAG 302

Query: 305 IDLALRSI 312
           +  AL  +
Sbjct: 303 LQDALSKV 310


>gi|253989183|ref|YP_003040539.1| malonyl coa-acyl carrier protein transacylase [Photorhabdus
           asymbiotica subsp. asymbiotica ATCC 43949]
 gi|253780633|emb|CAQ83795.1| malonyl coa-acyl carrier protein transacylase [Photorhabdus
           asymbiotica]
          Length = 310

 Score =  219 bits (557), Expect = 5e-55,   Method: Compositional matrix adjust.
 Identities = 126/307 (41%), Positives = 171/307 (55%), Gaps = 3/307 (0%)

Query: 5   LTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPA 64
           + FPGQGSQ +GM  DL   FP     F E    L  +L  L+  G  EEL  T   QPA
Sbjct: 6   MVFPGQGSQSLGMLADLAAEFPVVEHTFAEASDVLGYDLWTLVQQGPAEELNKTWQTQPA 65

Query: 65  LTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQ 124
           L A S+A  R+ ++ G    +  + +AGHSLGEY+AL  A        I+LV  RGK MQ
Sbjct: 66  LLAASVAIWRIWQEKG---GKAPALMAGHSLGEYSALVCAGVIDFKQAIKLVELRGKLMQ 122

Query: 125 EAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAADT 184
           EAVP G G+M AIIGLD+  +D  C +A++  I    N N  GQVVI+G ++AV+ A   
Sbjct: 123 EAVPEGTGAMYAIIGLDNESIDRACKEAAQGQIVSPVNFNSPGQVVIAGEKEAVERAGVA 182

Query: 185 CLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSIDE 244
           C   GAKR + L VSAP H +LM P +  +  +L+ +    P  P++ N       S + 
Sbjct: 183 CKAAGAKRVLPLAVSAPSHCALMKPAADKLAIVLNGIEFSHPQFPVVNNVDVKIEQSAEA 242

Query: 245 ISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVED 304
           I   LV Q+   VRW ET+++ A   V  + E+G GKVLTGL KRI  +LSA +++    
Sbjct: 243 IRDALVRQLYNPVRWTETVEFIAGQSVGQLLEIGPGKVLTGLTKRIVDTLSAAAVNDTIS 302

Query: 305 IDLALRS 311
           +  AL +
Sbjct: 303 LATALEN 309


>gi|260776334|ref|ZP_05885229.1| malonyl CoA-acyl carrier protein transacylase [Vibrio
           coralliilyticus ATCC BAA-450]
 gi|260607557|gb|EEX33822.1| malonyl CoA-acyl carrier protein transacylase [Vibrio
           coralliilyticus ATCC BAA-450]
          Length = 307

 Score =  219 bits (557), Expect = 5e-55,   Method: Compositional matrix adjust.
 Identities = 123/304 (40%), Positives = 173/304 (56%), Gaps = 3/304 (0%)

Query: 5   LTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPA 64
           + FPGQGSQ +GM  +L + +   +  F E    L  +L  L+ NG  E+L  T   QPA
Sbjct: 6   IVFPGQGSQAVGMLAELGEQYEVVKNTFSEASEALGYDLWALVQNGPAEDLNQTFRTQPA 65

Query: 65  LTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQ 124
           L A S+A  RV ++ GL      + +AGHSLGEY+AL  A      + I+LV  RG+ MQ
Sbjct: 66  LLASSVAIWRVWQELGL---EQPANLAGHSLGEYSALVCAGVIDFKEAIKLVELRGQLMQ 122

Query: 125 EAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAADT 184
           EAVP G G+M AIIGLDD  +   C  A++  +    N N  GQVVI+G +DAV+ A   
Sbjct: 123 EAVPAGSGAMFAIIGLDDESIAKACEDAAQGEVVSPVNYNSPGQVVIAGSKDAVERAGAL 182

Query: 185 CLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSIDE 244
           C   GAKRA+ LPVS P H +LM P +  +   L+ +    P +P++ N      +   +
Sbjct: 183 CKEAGAKRALPLPVSVPSHCALMKPAADKLAVALEEIEFNAPQLPVINNVDVVAETDPAK 242

Query: 245 ISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVED 304
           I   LV Q+   VRW E++Q  +  GV+ + E+G GKVLTGL KRI K+LS  +++    
Sbjct: 243 IKNALVRQLYSPVRWTESVQLMSEQGVEKLLELGPGKVLTGLTKRIVKTLSGAAVNDAAS 302

Query: 305 IDLA 308
           ++ A
Sbjct: 303 LEAA 306


>gi|23011511|ref|ZP_00051848.1| COG0331: (acyl-carrier-protein) S-malonyltransferase
           [Magnetospirillum magnetotacticum MS-1]
          Length = 245

 Score =  219 bits (557), Expect = 5e-55,   Method: Compositional matrix adjust.
 Identities = 115/240 (47%), Positives = 159/240 (66%), Gaps = 1/240 (0%)

Query: 67  AVSMAFIRVME-KNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQE 125
           A S+A +R +E + GL + RD ++VAGHSLGEY+AL AA  FS+SD  RL+R RG++MQ 
Sbjct: 2   AASLAVLRTLEAERGLDLARDAAFVAGHSLGEYSALAAAGTFSISDAARLLRIRGEAMQR 61

Query: 126 AVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAADTC 185
           AV PG+G+M A++G D     +I  +A++  +C++ANDNG GQVV+SG ++AV+ A    
Sbjct: 62  AVAPGIGAMAALLGPDLATAQAIAEEAAQGMVCDVANDNGAGQVVLSGHKEAVERAMVLA 121

Query: 186 LNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSIDEI 245
             +G +RAV L VSAPFH +LM P ++ M+  L  VT + PVVP+  N  A P++  D I
Sbjct: 122 QGRGVRRAVLLNVSAPFHCALMAPAAEAMRGALAEVTMRAPVVPVYANVTAGPLTDPDAI 181

Query: 246 SRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVEDI 305
              LV QVTG VRW E++   A  GV    E+G+GKVLTGL KRI  S SA  +   +D+
Sbjct: 182 RAALVTQVTGTVRWSESVAAMAEAGVGRFVELGAGKVLTGLVKRIAPSASASPVGTPDDV 241


>gi|238926910|ref|ZP_04658670.1| [acyl-carrier-protein] S-malonyltransferase [Selenomonas flueggei
           ATCC 43531]
 gi|238885144|gb|EEQ48782.1| [acyl-carrier-protein] S-malonyltransferase [Selenomonas flueggei
           ATCC 43531]
          Length = 311

 Score =  219 bits (557), Expect = 5e-55,   Method: Compositional matrix adjust.
 Identities = 123/293 (41%), Positives = 165/293 (56%), Gaps = 4/293 (1%)

Query: 7   FPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPALT 66
           FPGQG+Q++GMGRD YD++  A+  F E D  L  ++S L + G  ++L  T N QPA+ 
Sbjct: 8   FPGQGAQIVGMGRDFYDAYDLAKDRFAEADDALGYSISKLCFEGPADQLQLTENTQPAIL 67

Query: 67  AVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQEA 126
            VS+   ++++  G+      +   GHSLGEY AL  A A S  D + LV  RG  MQEA
Sbjct: 68  TVSVIAAQLLQARGVAP----AIAGGHSLGEYAALVLAGALSFRDAVVLVHKRGAYMQEA 123

Query: 127 VPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAADTCL 186
           VP G G+M AIIGLDD  +   CA AS  G  +  N N  GQ VI+G +  V  A +   
Sbjct: 124 VPVGEGAMAAIIGLDDATIIDACAAASAQGAVQAVNFNCPGQTVIAGAEKGVSTAVELLK 183

Query: 187 NKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSIDEIS 246
            KGAK+AV LPVSAPFHS+LM P +K +   LD V   D   P++ N+      +  EI 
Sbjct: 184 EKGAKKAVILPVSAPFHSTLMAPAAKKLAAELDKVALHDAAFPVVSNYTGGLQQTAAEIK 243

Query: 247 RLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
             LV Q    VRW   +    + G     E G GK L G  KRIDK+L+++++
Sbjct: 244 ANLVAQADHPVRWIACVSAMRDFGADIYIECGPGKTLAGFNKRIDKTLTSLNV 296


>gi|171463185|ref|YP_001797298.1| malonyl CoA-acyl carrier protein transacylase [Polynucleobacter
           necessarius subsp. necessarius STIR1]
 gi|171192723|gb|ACB43684.1| malonyl CoA-acyl carrier protein transacylase [Polynucleobacter
           necessarius subsp. necessarius STIR1]
          Length = 311

 Score =  219 bits (557), Expect = 5e-55,   Method: Compositional matrix adjust.
 Identities = 124/301 (41%), Positives = 168/301 (55%), Gaps = 6/301 (1%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M+    FPGQGSQ +GM   +    PE     +E    L ++++ L+  G  E L+ T N
Sbjct: 1   MTFAFVFPGQGSQSVGMLNSIAQR-PEVLTTLQEASDALGEDVAKLVAEGPAEALSLTTN 59

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
            QP +    +AF R     G    +    +AGHSLGEY+AL A+   S  D + LVR R 
Sbjct: 60  TQPVMLTAGVAFYRAWLAAGGPAPK---VMAGHSLGEYSALVASGVISFKDAVPLVRFRA 116

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRV--GICEIANDNGGGQVVISGLQDAV 178
           ++MQ AVP G G M AI+GLDD  V  +CA+AS    G+ E  N N  GQVVI+G  D V
Sbjct: 117 EAMQSAVPVGTGGMAAILGLDDVTVIKVCAEASVASGGVVEAVNFNAPGQVVIAGASDVV 176

Query: 179 KCAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASP 238
             A +     GAKRA+ LPVSAPFHSSL+ P S+ ++  L ++  + P +P++ N   + 
Sbjct: 177 TKACELLKAAGAKRALPLPVSAPFHSSLLQPASEKLQGYLANIEFKAPTIPVINNVDVAI 236

Query: 239 VSSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVS 298
           ++    I   LV Q    VRW+ETIQ  A  GV  V E G GKVL GL KRI+  ++ V 
Sbjct: 237 LNDPIAIKDALVRQAAKPVRWQETIQAMAGQGVTQVAECGPGKVLAGLTKRINDQVTGVP 296

Query: 299 I 299
           +
Sbjct: 297 V 297


>gi|323499358|ref|ZP_08104334.1| malonyl CoA-acyl carrier protein transacylase [Vibrio sinaloensis
           DSM 21326]
 gi|323315543|gb|EGA68578.1| malonyl CoA-acyl carrier protein transacylase [Vibrio sinaloensis
           DSM 21326]
          Length = 307

 Score =  219 bits (557), Expect = 5e-55,   Method: Compositional matrix adjust.
 Identities = 122/302 (40%), Positives = 175/302 (57%), Gaps = 3/302 (0%)

Query: 5   LTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPA 64
           + FPGQGSQ +GM  +L + +   +  F E    L  +L  L+ NG  E+L  T   QPA
Sbjct: 6   IVFPGQGSQAVGMLAELGEQYDVVKQTFAEASEALGYDLWALVQNGPAEDLNQTHRTQPA 65

Query: 65  LTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQ 124
           L A S+A  RV ++ GL        +AGHSLGEY+AL  A      + I+LV+ RG+ MQ
Sbjct: 66  LLASSVAIWRVWQELGL---EQPVNLAGHSLGEYSALVCAGVIDFKEAIKLVQLRGQLMQ 122

Query: 125 EAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAADT 184
           EAVP G G+M AIIGLDD  +   C +A++  +    N N  GQVVI+G +DAV+ A   
Sbjct: 123 EAVPAGTGAMYAIIGLDDESIAKACEEAAQGEVVSPVNFNSPGQVVIAGSKDAVERAGAL 182

Query: 185 CLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSIDE 244
           C   GAKRA+ LPVS P H +LM P +  +   L+++    P +P++ N   +  +   +
Sbjct: 183 CKEAGAKRALPLPVSVPSHCALMKPAADKLAVALEALEFNAPQLPVINNVDVAAETDPAK 242

Query: 245 ISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVED 304
           I   LV Q+   VRW E++Q  +  GV+ + E+G GKVLTGL KRI K+LS  +++    
Sbjct: 243 IKDALVRQLYSPVRWTESVQLMSEQGVEKLLELGPGKVLTGLTKRIVKTLSGAAVNDAAS 302

Query: 305 ID 306
           ++
Sbjct: 303 LE 304


>gi|212635826|ref|YP_002312351.1| malonyl CoA-acyl carrier protein transacylase [Shewanella
           piezotolerans WP3]
 gi|212557310|gb|ACJ29764.1| Malonyl CoA-acyl carrier protein transacylase [Shewanella
           piezotolerans WP3]
          Length = 308

 Score =  219 bits (557), Expect = 6e-55,   Method: Compositional matrix adjust.
 Identities = 127/300 (42%), Positives = 173/300 (57%), Gaps = 5/300 (1%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
           +T   FPGQGSQ +GM  +L +S P     F +    L  +L +L+  G  E L  T   
Sbjct: 3   NTAFVFPGQGSQALGMLAELAESQPVVAETFAQASQVLGYDLWELVQQGPVETLNETDKT 62

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPAL A S+A  R    +G  + +    +AGHSLGEY+AL  A        I+LV  RG+
Sbjct: 63  QPALLAASVAIYRAYIASGKTLPK---VMAGHSLGEYSALVCAGVIDFEAAIKLVELRGQ 119

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCA 181
            MQ+AVP G G+M AIIGLD+  +   C +AS+  +    N N  GQVVI+G + AV+ A
Sbjct: 120 LMQQAVPAGTGAMFAIIGLDNDAIAKACEEASQGDVVSPVNYNSPGQVVIAGEKAAVERA 179

Query: 182 ADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNF-CASPVS 240
           A  C   GAK AV LPVS P H  LM P +  +   L+ +    P V +L N   ASPV+
Sbjct: 180 AALCKENGAKMAVALPVSVPSHCQLMKPAADKLAIALNDIEFSAPSVTVLNNVDVASPVA 239

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
              EI   LV Q+   VRW ET++  A+ G+  ++E+G GKVLTGL+KRI++SL+A +I+
Sbjct: 240 E-QEIKDALVRQLYCPVRWSETVELMASQGITDLFEIGPGKVLTGLSKRINRSLTAKAIN 298


>gi|46143902|ref|ZP_00133899.2| COG0331: (acyl-carrier-protein) S-malonyltransferase
           [Actinobacillus pleuropneumoniae serovar 1 str. 4074]
 gi|126209447|ref|YP_001054672.1| malonyl CoA-acyl carrier protein transacylase (MCT) [Actinobacillus
           pleuropneumoniae L20]
 gi|307258098|ref|ZP_07539850.1| Malonyl CoA-acyl carrier protein transacylase [Actinobacillus
           pleuropneumoniae serovar 10 str. D13039]
 gi|126098239|gb|ABN75067.1| Malonyl CoA-acyl carrier protein transacylase (MCT) [Actinobacillus
           pleuropneumoniae serovar 5b str. L20]
 gi|306863461|gb|EFM95392.1| Malonyl CoA-acyl carrier protein transacylase [Actinobacillus
           pleuropneumoniae serovar 10 str. D13039]
          Length = 311

 Score =  219 bits (557), Expect = 6e-55,   Method: Compositional matrix adjust.
 Identities = 134/304 (44%), Positives = 183/304 (60%), Gaps = 4/304 (1%)

Query: 5   LTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPA 64
           + FPGQGSQ +GM  DL  ++P     F++    L  +L DL+ NGS E+L  T   QPA
Sbjct: 6   MVFPGQGSQAVGMLADLATAYPIVEETFKQASDVLGYDLWDLVQNGSAEDLGQTQRTQPA 65

Query: 65  LTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQ 124
           L A S+A  RV ++    +K   S +AGHSLGEY+AL  A      D I+LV  RG +MQ
Sbjct: 66  LLASSVAIYRVWQQKYPELKP--SVMAGHSLGEYSALVCAGVLDFQDAIKLVELRGNAMQ 123

Query: 125 EAVPPGLGSMVAIIGLDDCVVDSICAQA-SRVG-ICEIANDNGGGQVVISGLQDAVKCAA 182
           +AVP G G+M AIIGLD+  + + C QA + VG I    N N  GQVVI+G + A + A 
Sbjct: 124 QAVPAGTGAMYAIIGLDNEAIINACEQAQAEVGEIVSAVNFNSPGQVVIAGTKAAAEKAG 183

Query: 183 DTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSI 242
           + C   GAKRA+ L VS P H +LM P +  +   L ++T   PVVP++ N   S  +  
Sbjct: 184 ELCKAAGAKRALPLAVSVPSHCALMKPAADKLAEALQNITLNVPVVPVINNVDVSVETDA 243

Query: 243 DEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKV 302
           + I   LV Q+   VRW ET++  AN GV ++YE+GSGKVLTGLA RI K L+A +++ V
Sbjct: 244 EAIRNALVRQLYSPVRWTETVEKMANQGVTTLYEIGSGKVLTGLAGRIVKELNAKAVNDV 303

Query: 303 EDID 306
             ++
Sbjct: 304 ASLE 307


>gi|118444515|ref|YP_877021.1| malonyl CoA-acyl carrier protein transacylase [Clostridium novyi
           NT]
 gi|118134971|gb|ABK62015.1| malonyl CoA-acyl carrier protein transacylase [Clostridium novyi
           NT]
          Length = 314

 Score =  218 bits (556), Expect = 6e-55,   Method: Compositional matrix adjust.
 Identities = 120/307 (39%), Positives = 184/307 (59%), Gaps = 8/307 (2%)

Query: 7   FPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPALT 66
           F GQGSQ IGMG++LYD+F E+R VF + +  L  ++SDL + GS E+L  T N QPA+ 
Sbjct: 8   FSGQGSQYIGMGKELYDNFYESREVFNKANIALGFSISDLCFGGSLEDLNKTENTQPAIL 67

Query: 67  AVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQEA 126
             S+A ++ +EK+   +K D+  VAG SLGEY+AL  +      D +R+V+ RGK MQE 
Sbjct: 68  TTSIATLKALEKHE--IKPDM--VAGLSLGEYSALVCSGVLDFEDAVRVVKKRGKFMQEE 123

Query: 127 VPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAADTCL 186
           VP G+G+M A+IGL    +   C +AS+ GI ++AN N   Q+VI+G   AV  A +   
Sbjct: 124 VPFGVGTMAAVIGLAREKIKEACIRASKEGIVQVANYNCQSQIVIAGEIKAVDKALEIAK 183

Query: 187 NKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSIDEIS 246
             GAKR + L VSAPFH+S++    + +   L ++  ++  +P++ N   + ++ + +I 
Sbjct: 184 ELGAKRVIKLKVSAPFHTSMLKGAGEKLYSELQNIELKEIKIPVMTNVTGTYINDVHDIK 243

Query: 247 RLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVEDID 306
            +L EQV   V W + I+     GV +  E+G GK L G  K+I++    V +  VED++
Sbjct: 244 GILKEQVMSSVLWEDIIKNMIEEGVDTFIEIGPGKALCGFVKKINRK---VKVLNVEDLN 300

Query: 307 LALRSIV 313
            +LR  V
Sbjct: 301 -SLRKTV 306


>gi|313892761|ref|ZP_07826342.1| [acyl-carrier-protein] S-malonyltransferase [Veillonella sp. oral
           taxon 158 str. F0412]
 gi|313442692|gb|EFR61103.1| [acyl-carrier-protein] S-malonyltransferase [Veillonella sp. oral
           taxon 158 str. F0412]
          Length = 313

 Score =  218 bits (556), Expect = 7e-55,   Method: Compositional matrix adjust.
 Identities = 127/315 (40%), Positives = 177/315 (56%), Gaps = 5/315 (1%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M T   FPGQGSQ +GM +DLY+++P  +  FEE D  L  +++ L + G   EL  T N
Sbjct: 1   MKTAFVFPGQGSQKVGMLQDLYNAYPIVKQRFEEADDALGYSITKLCFEGPDTELVKTAN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
            QPA+   S+A   V+++ G     DI  V GHSLGEY+AL AA   +  D + +V  RG
Sbjct: 61  TQPAILTASVACYEVLKEQGFT--PDI--VGGHSLGEYSALVAAGVLNFKDAVYVVHKRG 116

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQAS-RVGICEIANDNGGGQVVISGLQDAVK 179
           + MQEAVP G G+M AI+ L    V  IC + S  VG  +  N N  GQ+VI+G   AV+
Sbjct: 117 QYMQEAVPLGKGAMAAILALPREQVVEICEEVSASVGSVQAVNFNCPGQIVIAGETAAVE 176

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            AA+     GAKRAV LPVSAPFHS LM P +  +K  LD +   D  +P++ N     +
Sbjct: 177 AAAEKMKEAGAKRAVMLPVSAPFHSRLMEPAALRLKEELDKIQVNDAQIPVVANVTGKIL 236

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
           ++ ++I   LV Q    V W + +    N GV    EVG GKVLTG  K+I+K +   ++
Sbjct: 237 TNANDIKESLVTQAANPVLWEDCVAEMVNFGVTCFVEVGPGKVLTGFTKKINKDMELANV 296

Query: 300 SKVEDIDLALRSIVG 314
             +  ++  L  + G
Sbjct: 297 EDIASLEKTLEFLKG 311


>gi|258511325|ref|YP_003184759.1| malonyl CoA-acyl carrier protein transacylase [Alicyclobacillus
           acidocaldarius subsp. acidocaldarius DSM 446]
 gi|257478051|gb|ACV58370.1| malonyl CoA-acyl carrier protein transacylase [Alicyclobacillus
           acidocaldarius subsp. acidocaldarius DSM 446]
          Length = 319

 Score =  218 bits (556), Expect = 7e-55,   Method: Compositional matrix adjust.
 Identities = 124/299 (41%), Positives = 174/299 (58%), Gaps = 9/299 (3%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M+    FPGQG+Q +GMGR ++D +P AR + EE D  L   LSD+++ G ++ L  T  
Sbjct: 1   MNVAFVFPGQGAQYVGMGRAIFDEYPVARALLEEADEALGMKLSDIIFEGPEDTLRLTYY 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDIS--YVAGHSLGEYTALCAAKAFSLSDTIRLVRA 118
            QPAL  VS+A  R      L  + DI    VAGHSLGEY+AL AAK+ S +D ++LV  
Sbjct: 61  TQPALLTVSVAVWR-----ALVDRVDIQPLAVAGHSLGEYSALVAAKSISFADAVKLVYQ 115

Query: 119 RGKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVG--ICEIANDNGGGQVVISGLQD 176
           RGK M EA P G G+M A++GLD+  +  +C +AS     I E+AN N  GQ+VISG + 
Sbjct: 116 RGKLMDEAYPAGQGTMAAVLGLDEEPLREVCKRASEETGEIVELANVNCPGQIVISGAKA 175

Query: 177 AVKCAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCA 236
           AV+ A+      GA+R + L VS PFHSSLM P +  +  +LD +   D   P++ N   
Sbjct: 176 AVERASLLAKEAGARRVMPLNVSGPFHSSLMQPAADRLGALLDEIEFADAETPVVANVDG 235

Query: 237 SPVSSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLS 295
            P     ++   L +Q+   VR+ + +      GV  V E+G G VL+GL ++IDKSL 
Sbjct: 236 HPRRMASDLRDALKKQLVMPVRFVDCVLSMKRLGVDCVVELGPGTVLSGLVRKIDKSLE 294


>gi|89073425|ref|ZP_01159949.1| acyl carrier protein S-malonyltransferase [Photobacterium sp.
           SKA34]
 gi|89050912|gb|EAR56386.1| acyl carrier protein S-malonyltransferase [Photobacterium sp.
           SKA34]
          Length = 309

 Score =  218 bits (556), Expect = 7e-55,   Method: Compositional matrix adjust.
 Identities = 119/305 (39%), Positives = 177/305 (58%), Gaps = 3/305 (0%)

Query: 5   LTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPA 64
           + FPGQGSQ +GM  +L + F   +  F E    L  +L  L+ NG  E+L  T   QPA
Sbjct: 6   IVFPGQGSQTVGMLAELAEQFDVVKETFSEASDALGYDLWALVQNGPVEDLNQTQRTQPA 65

Query: 65  LTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQ 124
           L   S+A  R  ++ G       + +AGHSLGEY+AL  A        ++LV  RG+ MQ
Sbjct: 66  LLTASVAIWRAWQQQG---GDQPTLLAGHSLGEYSALVCAGVIDFKVAVKLVELRGQLMQ 122

Query: 125 EAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAADT 184
           EAVP G+G+M AIIGLD+  +   C +A++  +C   N N  GQVVI+G ++AV+ A   
Sbjct: 123 EAVPAGVGAMSAIIGLDNDAIAKACEEAAQGEVCSPVNFNSPGQVVIAGNKEAVERANVL 182

Query: 185 CLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSIDE 244
           C   GAKRA+ LPVS P H +LM P +  +   L+++    P VP++ N   +  +    
Sbjct: 183 CKEAGAKRALPLPVSVPSHCALMKPAADKLAVALEAIEFNAPSVPVINNADVTTETDPAA 242

Query: 245 ISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVED 304
           I   LV+Q+   VRW E+++  A  G++ + E+G GKVLTGL KRID++LS  +++ +  
Sbjct: 243 IKLALVKQLYSPVRWTESVELMAAEGIEELLEMGPGKVLTGLTKRIDRALSGAAVNDIAS 302

Query: 305 IDLAL 309
           ++ A+
Sbjct: 303 LEAAM 307


>gi|262037506|ref|ZP_06010965.1| malonyl CoA-acyl carrier protein transacylase [Leptotrichia
           goodfellowii F0264]
 gi|261748436|gb|EEY35816.1| malonyl CoA-acyl carrier protein transacylase [Leptotrichia
           goodfellowii F0264]
          Length = 300

 Score =  218 bits (556), Expect = 7e-55,   Method: Compositional matrix adjust.
 Identities = 117/305 (38%), Positives = 186/305 (60%), Gaps = 10/305 (3%)

Query: 3   TVLTFPGQGSQVIGMGRDLYDSFPE--ARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           T   FPGQG+Q  GM + LYD   +   +L+ E  ++  ++N+  +++ GS+EEL  T  
Sbjct: 4   TAFVFPGQGTQYPGMIKKLYDESDDNTKKLIDEIFENIKDENVKKVLFEGSEEELKDTKY 63

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
           AQPA+  +S+ F +++++ G+    +  YVAGHSLGEY++L AA   +  +T++L+ ARG
Sbjct: 64  AQPAIALLSVIFTKLLKEKGI----NPDYVAGHSLGEYSSLYAAGVLNEKETLKLIAARG 119

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
             M  A   G  +M AI+GL    V+ IC++ +  G+ E  N N   Q VI+G ++ ++ 
Sbjct: 120 NIMSNAHVDG--TMAAILGLPASEVEKICSEIN--GVIEAVNYNEPKQTVIAGEKEVIEK 175

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
            ++    KGAKR + L VS PFHSSLM PV++ +K   +  + +D  VP++ N  A+ ++
Sbjct: 176 NSEIFKEKGAKRVIPLAVSGPFHSSLMKPVAEQLKEEFEKYSWKDLKVPVVANTTANILN 235

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
           S DEI   L  Q  G V+W +TI   + +GV  +YEVG GKVL GL K+I+K +  ++I 
Sbjct: 236 SSDEIKEELYRQTFGPVKWVDTINKLSENGVTKIYEVGPGKVLAGLIKKINKEIEVINIE 295

Query: 301 KVEDI 305
            +E+I
Sbjct: 296 NIENI 300


>gi|291617035|ref|YP_003519777.1| FabD [Pantoea ananatis LMG 20103]
 gi|291152065|gb|ADD76649.1| FabD [Pantoea ananatis LMG 20103]
          Length = 312

 Score =  218 bits (555), Expect = 9e-55,   Method: Compositional matrix adjust.
 Identities = 127/305 (41%), Positives = 174/305 (57%), Gaps = 3/305 (0%)

Query: 5   LTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPA 64
             FPGQGSQ +GM  DL  ++P     F E    L  +L  L+  G  EEL  T   QPA
Sbjct: 8   FVFPGQGSQTVGMLADLAAAYPAVEATFREASDVLGYDLWQLVSQGPAEELNKTWQTQPA 67

Query: 65  LTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQ 124
           L A S+A  RV ++ G    +  + +AGHSLGEY+AL  A   + +D I+LV  RGK MQ
Sbjct: 68  LLAASVAIYRVWQQQG---GQQPALMAGHSLGEYSALVCAGVLNFADAIKLVELRGKLMQ 124

Query: 125 EAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAADT 184
           EAVP G G+M AIIGLDD  +   C ++++  +    N N  GQVVI+G ++AV+ A   
Sbjct: 125 EAVPEGTGAMQAIIGLDDAAIAKACEESAQGQVVSPVNFNSPGQVVIAGNKEAVERAGAA 184

Query: 185 CLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSIDE 244
           C   GAKRA+ LPVS P H +LM P +  +   L+++T   P VP++ N      +  D 
Sbjct: 185 CKAAGAKRALPLPVSVPSHCALMKPAADKLALTLENITFNAPAVPVINNVDVKAETDADA 244

Query: 245 ISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVED 304
           I   L+ Q+   VRW E+++  A  GV  + E+G GKVLTGL KRI   LSA +++    
Sbjct: 245 IRHALIRQLYSPVRWTESVEAMAAQGVTQLIEMGPGKVLTGLTKRIVDGLSAAAVNDTAS 304

Query: 305 IDLAL 309
           +  AL
Sbjct: 305 LTAAL 309


>gi|78043865|ref|YP_360280.1| malonyl CoA-acyl carrier protein transacylase [Carboxydothermus
           hydrogenoformans Z-2901]
 gi|77995980|gb|ABB14879.1| malonyl CoA-acyl carrier protein transacylase [Carboxydothermus
           hydrogenoformans Z-2901]
          Length = 312

 Score =  218 bits (555), Expect = 9e-55,   Method: Compositional matrix adjust.
 Identities = 121/309 (39%), Positives = 174/309 (56%), Gaps = 7/309 (2%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
            T   FPGQGSQ +GMG+DLYD  P  R  F   +  L  +L+ +++ G +EEL  T N 
Sbjct: 3   KTAFVFPGQGSQYVGMGKDLYDELPVVRKYFNLANEILGYDLTKIIFEGPEEELNKTENT 62

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPA+  +S A    +E+ G+  K       GHSLGE+TAL AA   + +D +RLV  RGK
Sbjct: 63  QPAILTLSYALYVTLEEKGIKAK----IYGGHSLGEFTALTAAGVINFADAVRLVHVRGK 118

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCA 181
            MQEAVP G G M+A++G++   + +   +    GI EI N NGGGQ V++G +  +K  
Sbjct: 119 LMQEAVPLGQGVMLAVMGIEKEELVATVKKLQEYGIMEIVNFNGGGQYVLAG-ESKIKEL 177

Query: 182 ADTCLNK-GAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
             T L + GA++ V LPVSAPFHSSLM   +   +  L+ V    P VP++ N  A  ++
Sbjct: 178 TKTQLKEVGARKIVELPVSAPFHSSLMRAAALKFQEYLEKVEFLPPKVPVISNVTAEILT 237

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
              +I  LL +Q+   V W +++       V    E+G GKVLT L KRI   ++  S++
Sbjct: 238 DPVKIKDLLSKQMASPVLWEQSVLEMVKVEVTKFIEIGPGKVLTNLIKRI-VPVATFSVN 296

Query: 301 KVEDIDLAL 309
            +E +   L
Sbjct: 297 NLESLRFLL 305


>gi|322833650|ref|YP_004213677.1| malonyl CoA-acyl carrier protein transacylase [Rahnella sp. Y9602]
 gi|321168851|gb|ADW74550.1| malonyl CoA-acyl carrier protein transacylase [Rahnella sp. Y9602]
          Length = 309

 Score =  218 bits (555), Expect = 9e-55,   Method: Compositional matrix adjust.
 Identities = 127/307 (41%), Positives = 172/307 (56%), Gaps = 5/307 (1%)

Query: 5   LTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPA 64
           + FPGQGSQ +GM  DL  + P     F E    L  +L  L+  G  EEL  T   QPA
Sbjct: 6   VVFPGQGSQTLGMLADLAAAHPVVEETFAEASSALGYDLWQLVQQGPAEELNKTWQTQPA 65

Query: 65  LTAVSMAFIRV-MEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSM 123
           L A S+A  RV  ++NG         +AGHSLGEY+AL  A        I LV  RGK M
Sbjct: 66  LLAASVAIWRVWQQQNG----TQPVLMAGHSLGEYSALVCAGVLDFKQAISLVELRGKLM 121

Query: 124 QEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAAD 183
           QEAVP G G+M AIIGLD+  +   C ++++  +    N N  GQVVI+G ++AV+ A  
Sbjct: 122 QEAVPAGTGAMYAIIGLDNDAIAKACEESAQGQVVSPVNFNSPGQVVIAGNKEAVERAGA 181

Query: 184 TCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSID 243
            C   GAKRA+ LPVS P H +LM P ++ M   L++VT   P   ++ N      +S +
Sbjct: 182 ACKEAGAKRALPLPVSVPSHCALMKPAAEKMAIALENVTFNAPQYSVVNNVDVKVETSPE 241

Query: 244 EISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVE 303
            I   LV Q+   VRW E++++ A  GV+ + EVG GKVLTGL KRI  +L+A +++   
Sbjct: 242 AIRSALVRQLYSPVRWTESVEYIAAQGVEQLLEVGPGKVLTGLTKRIVDTLTAAAVNDTA 301

Query: 304 DIDLALR 310
            +  AL 
Sbjct: 302 SLAAALE 308


>gi|317047706|ref|YP_004115354.1| malonyl CoA-acyl carrier protein transacylase [Pantoea sp. At-9b]
 gi|316949323|gb|ADU68798.1| malonyl CoA-acyl carrier protein transacylase [Pantoea sp. At-9b]
          Length = 310

 Score =  218 bits (555), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 130/306 (42%), Positives = 179/306 (58%), Gaps = 5/306 (1%)

Query: 5   LTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPA 64
           L FPGQGSQ +GM  DL   +P+    F E    L  +L  L+  G  EEL  T   QPA
Sbjct: 6   LVFPGQGSQTVGMLADLAAEYPQVEATFREASDVLGYDLWQLVQQGPAEELNKTWQTQPA 65

Query: 65  LTAVSMAFIRVME-KNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSM 123
           L A S+A  RV + KN        + +AGHSLGEY+AL  A   + +D I+LV  RGK M
Sbjct: 66  LLAASVAIYRVWQSKNA----PQPAIMAGHSLGEYSALVCAGVLNFADAIKLVELRGKLM 121

Query: 124 QEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAAD 183
           QEAVP G G+M AIIGLDD  +   C ++++  +    N N  GQVVI+G ++AV+ A  
Sbjct: 122 QEAVPEGTGAMQAIIGLDDAAIRKACEESAQGQVVSPVNFNSPGQVVIAGNKEAVERAGA 181

Query: 184 TCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSID 243
            C   GAKRA+ LPVS P H +LM P ++ +   L++++   P VP++ N      +S D
Sbjct: 182 ACKAAGAKRALPLPVSVPSHCALMKPAAEKLAVALEAISFNAPSVPVVNNVDVQCETSAD 241

Query: 244 EISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVE 303
            I   LV Q+   VRW E++++ A+ GV  + E+G GKVLTGL KRI  SL+A +++   
Sbjct: 242 AIRSALVRQLYSPVRWTESVEFIASQGVTQLLEIGPGKVLTGLTKRIVDSLTAAAVNDPA 301

Query: 304 DIDLAL 309
            +  AL
Sbjct: 302 SLTAAL 307


>gi|315179576|gb|ADT86490.1| malonyl Coa-acyl carrier protein transacylase [Vibrio furnissii
           NCTC 11218]
          Length = 307

 Score =  218 bits (555), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 122/302 (40%), Positives = 172/302 (56%), Gaps = 3/302 (0%)

Query: 5   LTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPA 64
           + FPGQGSQ +GM  +L + +   +  F E    L  +L  L+ NG  E+L  T   QPA
Sbjct: 6   IVFPGQGSQAVGMLAELGEQYDVVKQTFAEASDALGYDLWALVQNGPVEDLNQTFRTQPA 65

Query: 65  LTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQ 124
           L A S+A  RV +  GL        +AGHSLGEY+AL  A        I+LV  RG+ MQ
Sbjct: 66  LLASSVAIWRVWQALGL---EQPEVLAGHSLGEYSALVCAGVIDFKAAIKLVELRGQLMQ 122

Query: 125 EAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAADT 184
           EAVP G G+M AIIGLDD  +   C  A++  +    N N  GQVVI+G +DAV+ A   
Sbjct: 123 EAVPAGTGAMYAIIGLDDAAIAKACEDAAQGDVVSPVNFNSPGQVVIAGQKDAVERAGAL 182

Query: 185 CLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSIDE 244
           C   GAKRA+ LPVS P H +LM P ++ +   L+++    P +P++ N   +  +   +
Sbjct: 183 CKEAGAKRALPLPVSVPSHCALMKPAAEKLAVALEALEFNAPQIPVINNVDVATETDPAK 242

Query: 245 ISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVED 304
           I   LV Q+   VRW E ++  A  G++ + EVG GKVLTGL KRI K+L A +++ +  
Sbjct: 243 IKDALVRQLHSPVRWTEGVEKMAAQGIEKLIEVGPGKVLTGLTKRIVKTLDAAAVNDIAS 302

Query: 305 ID 306
           ++
Sbjct: 303 LE 304


>gi|327393486|dbj|BAK10908.1| malonyl CoA-acyl carrier protein transacylase FabD [Pantoea
           ananatis AJ13355]
          Length = 310

 Score =  218 bits (554), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 127/305 (41%), Positives = 174/305 (57%), Gaps = 3/305 (0%)

Query: 5   LTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPA 64
             FPGQGSQ +GM  DL  ++P     F E    L  +L  L+  G  EEL  T   QPA
Sbjct: 6   FVFPGQGSQTVGMLADLAAAYPAVEATFREASDVLGYDLWQLVSQGPAEELNKTWQTQPA 65

Query: 65  LTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQ 124
           L A S+A  RV ++ G    +  + +AGHSLGEY+AL  A   + +D I+LV  RGK MQ
Sbjct: 66  LLAASVAIYRVWQQQG---GQQPALMAGHSLGEYSALVCAGVLNFADAIKLVELRGKLMQ 122

Query: 125 EAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAADT 184
           EAVP G G+M AIIGLDD  +   C ++++  +    N N  GQVVI+G ++AV+ A   
Sbjct: 123 EAVPEGTGAMQAIIGLDDAAIAKACEESAQGQVVSPVNFNSPGQVVIAGNKEAVERAGAA 182

Query: 185 CLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSIDE 244
           C   GAKRA+ LPVS P H +LM P +  +   L+++T   P VP++ N      +  D 
Sbjct: 183 CKAAGAKRALPLPVSVPSHCALMKPAADKLALTLENITFNAPAVPVINNVDVKAETDADA 242

Query: 245 ISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVED 304
           I   L+ Q+   VRW E+++  A  GV  + E+G GKVLTGL KRI   LSA +++    
Sbjct: 243 IRHALIRQLYSPVRWTESVEAMAAQGVTQLIEMGPGKVLTGLTKRIVDGLSAAAVNDTAS 302

Query: 305 IDLAL 309
           +  AL
Sbjct: 303 LTAAL 307


>gi|212712804|ref|ZP_03320932.1| hypothetical protein PROVALCAL_03901 [Providencia alcalifaciens DSM
           30120]
 gi|212684496|gb|EEB44024.1| hypothetical protein PROVALCAL_03901 [Providencia alcalifaciens DSM
           30120]
          Length = 310

 Score =  218 bits (554), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 126/309 (40%), Positives = 176/309 (56%), Gaps = 5/309 (1%)

Query: 5   LTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPA 64
           + FPGQGSQ +GM   L +     +  F E    L  +L  L+ NG +EEL  T   QPA
Sbjct: 6   MVFPGQGSQSLGMLAGLAEQNQLVKDTFAEASEALGYDLWTLVQNGPEEELNKTWQTQPA 65

Query: 65  LTAVSMAFIRV-MEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSM 123
           L A S+A  RV  EKNG    +  + +AGHSLGEY+AL  A        I+LV  RG+ M
Sbjct: 66  LLAASVAIFRVWQEKNG----KMPALMAGHSLGEYSALVCAGVIDFKQAIKLVELRGRLM 121

Query: 124 QEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAAD 183
           Q+AVP G G+M AIIGLD+  ++  C  A++  +    N N  GQVVI+G + AV+ A  
Sbjct: 122 QDAVPEGTGAMYAIIGLDNESIEKACQDAAQGQVVSPVNFNSPGQVVIAGEKAAVERAGA 181

Query: 184 TCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSID 243
            C   GAKRA+ L VS P H +LM P +  +   L+ +   +P  P++ N      +S  
Sbjct: 182 ACKEAGAKRALPLSVSVPSHCALMKPAADKLADALEKIEFCEPTYPVINNVDVKMETSAK 241

Query: 244 EISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVE 303
            I   LV Q+   VRW ET+++ A  G++ + E+G GKVLTGL KRI  +L+AV+++   
Sbjct: 242 NIRDALVRQLYNPVRWTETVEFMAEQGIEQLVEMGPGKVLTGLTKRIVSNLTAVAVNDPV 301

Query: 304 DIDLALRSI 312
            +D AL +I
Sbjct: 302 SLDSALETI 310


>gi|89895407|ref|YP_518894.1| hypothetical protein DSY2661 [Desulfitobacterium hafniense Y51]
 gi|89334855|dbj|BAE84450.1| hypothetical protein [Desulfitobacterium hafniense Y51]
          Length = 313

 Score =  218 bits (554), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 126/300 (42%), Positives = 173/300 (57%), Gaps = 10/300 (3%)

Query: 7   FPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPALT 66
           FPGQGSQ +GMG++L+ + P  + V       L +    ++  G +EEL  T + QPA+ 
Sbjct: 8   FPGQGSQYVGMGKELFAT-PGGQEVLATGQRVLGEEFIRILLEGPEEELKKTAHTQPAIL 66

Query: 67  AVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQEA 126
             S+A  + +++ G  ++ D  Y AGHSLGEY+A  AA + SL + +R+VR RG+ MQ A
Sbjct: 67  LTSIAAWQGLQETG--IRPD--YFAGHSLGEYSAYTAAGSLSLEEALRVVRRRGELMQAA 122

Query: 127 VPPGLGSMVAIIGLDDCVVDSICAQASRVG--ICEIANDNGGGQVVISGLQDAVKCAADT 184
           VP G G+M AI+GL++  V+  C QA   G  I   AN N  GQVVISG  + V+ A   
Sbjct: 123 VPEGQGAMAAILGLENAKVEEACHQAREEGGWIVGPANYNSPGQVVISGETEGVQMACQY 182

Query: 185 CLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSIDE 244
               GAKRA+ L VS PFHS LM    K ++ +L+ V  QDP VP+L N     V     
Sbjct: 183 AKELGAKRALPLAVSGPFHSPLMAEAGKELRQVLEGVAWQDPSVPVLANIDGQEVRERGM 242

Query: 245 ISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVED 304
           I   LV QV+G V W ++I+     GV +  E+G GKVLTGL K+I   L   ++  VED
Sbjct: 243 IVESLVRQVSGAVLWEQSIRLLGEQGVDTFIELGPGKVLTGLVKKI---LPGATLINVED 299


>gi|300311248|ref|YP_003775340.1| malonyl CoA-[acyl-carrier-protein] transacylase [Herbaspirillum
           seropedicae SmR1]
 gi|300074033|gb|ADJ63432.1| malonyl CoA-[acyl-carrier-protein] transacylase protein
           [Herbaspirillum seropedicae SmR1]
          Length = 310

 Score =  218 bits (554), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 130/308 (42%), Positives = 171/308 (55%), Gaps = 4/308 (1%)

Query: 5   LTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPA 64
             FPGQGSQ IGM     D+    R    E    L  +L  L+  G +E+L  T N QP 
Sbjct: 6   FVFPGQGSQAIGMLNGFADN-DVVRQTVAEASDALQFDLGKLIAEGPKEDLDLTTNTQPV 64

Query: 65  LTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQ 124
           +   ++AF R     G    +  + VAGHSLGEY+AL AA   +  D + LVR R ++MQ
Sbjct: 65  MLTAAVAFYRAWLAAG---GKAPALVAGHSLGEYSALVAAGVIAFKDAVPLVRFRAQAMQ 121

Query: 125 EAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAADT 184
           EAVP G G M AI+GL D  V + CA+A++  + E  N N   QVVI+G + AV+ A D 
Sbjct: 122 EAVPVGQGGMAAILGLSDEDVRAACAEAAQGDVVEAVNFNAPAQVVIAGHKAAVERACDI 181

Query: 185 CLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSIDE 244
              KGAKRA+ LPVSAPFHSSL+ P S  ++  L +V    P +P++ N   + V+    
Sbjct: 182 AKAKGAKRALPLPVSAPFHSSLLKPASDRLQAYLANVAFSAPQIPLINNVDVAVVNDPAA 241

Query: 245 ISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVED 304
           I   LV Q    VRW ET+Q  A  GV  + E G GKVLTGL KRI+  L   +I   E 
Sbjct: 242 IKDALVRQAAAPVRWVETVQKMAAEGVTHLVECGPGKVLTGLTKRINGDLVGEAIVDQES 301

Query: 305 IDLALRSI 312
           ++  L S+
Sbjct: 302 LNKVLESL 309


>gi|237797059|ref|YP_002864611.1| malonyl CoA-acyl carrier protein transacylase [Clostridium
           botulinum Ba4 str. 657]
 gi|229263479|gb|ACQ54512.1| malonyl CoA-acyl carrier protein transacylase [Clostridium
           botulinum Ba4 str. 657]
          Length = 314

 Score =  217 bits (553), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 123/308 (39%), Positives = 178/308 (57%), Gaps = 7/308 (2%)

Query: 5   LTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPA 64
             F GQG+Q +GMG+DLY++ PE R +F   +  L   L+ + + G ++E+  T N QPA
Sbjct: 6   FIFSGQGAQYVGMGKDLYENIPECREIFHIAEEELQIPLTKICFQGPKDEIDKTENTQPA 65

Query: 65  LTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQ 124
           +  +S+A ++ +EK G  +K D++  AG SLGEY++L  +K       + LVR RG+ M+
Sbjct: 66  ILTLSIAVMKALEKYG--IKPDVT--AGLSLGEYSSLVCSKVIDFRKAVSLVRKRGQYME 121

Query: 125 EAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAADT 184
            AVP G+G+M AIIGL    V  IC     VGI EIAN N  GQ+VISG  +AV+ A + 
Sbjct: 122 HAVPNGVGTMAAIIGLKKEKVKEICDGLKEVGIVEIANINCPGQIVISGEINAVEKACEM 181

Query: 185 CLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSIDE 244
              K A + V L VS PFHSS++    + +   L  +  +   VP + N     V SI E
Sbjct: 182 AKEKRALKCVNLSVSGPFHSSMLKEAGENLYEELQKIQFKSIEVPFITNVTGDFVISISE 241

Query: 245 ISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVED 304
           I  LL +QV   V W ++I+   + GV +  E+G  KVL+G  K+ID+    V+I  VED
Sbjct: 242 IKDLLKKQVMSTVLWEDSIKTMIDFGVDTFIEIGPSKVLSGFVKKIDRK---VNILNVED 298

Query: 305 IDLALRSI 312
           ID   ++I
Sbjct: 299 IDSLNKTI 306


>gi|261868800|ref|YP_003256722.1| malonyl CoA-acyl carrier protein transacylase [Aggregatibacter
           actinomycetemcomitans D11S-1]
 gi|261414132|gb|ACX83503.1| malonyl CoA-acyl carrier protein transacylase [Aggregatibacter
           actinomycetemcomitans D11S-1]
          Length = 312

 Score =  217 bits (553), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 127/302 (42%), Positives = 175/302 (57%), Gaps = 2/302 (0%)

Query: 5   LTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPA 64
           + FPGQGSQ +GM  +L   +P  +  F+     L  +L  L+  G  EEL  T   QP+
Sbjct: 6   MVFPGQGSQAVGMLAELAVEYPVVQDTFKRASEALGYDLWQLVQQGPAEELNKTWQTQPS 65

Query: 65  LTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQ 124
           L A S+A  RV ++    +K ++  +AGHSLGEY+AL  A      D ++LV  RGK MQ
Sbjct: 66  LLAASVAIYRVWQEKYPQLKPEV--MAGHSLGEYSALVCADVLDFQDAVKLVELRGKLMQ 123

Query: 125 EAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAADT 184
           +AVP G G+M AIIGLD+  + + C Q  +  +    N N  GQVVI+G + AV+ AA  
Sbjct: 124 QAVPEGTGAMYAIIGLDNEAIINACKQVEQGEVVSAVNFNSLGQVVIAGAKAAVERAAAL 183

Query: 185 CLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSIDE 244
           C   GAKRA+ L VS P H +LM P +  +   L+S+T + P V +L N      S  + 
Sbjct: 184 CKEAGAKRALPLAVSVPSHCALMKPAADQLSVSLESITLKAPSVAVLNNVDVKGESEAEA 243

Query: 245 ISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVED 304
           I   LV Q+   VRW ET+Q  A +GV+ + E+G GKVL GL KRI  SL AVS++ V+ 
Sbjct: 244 IRHALVRQLYSPVRWTETVQKMAGNGVEVLVEIGPGKVLNGLTKRIVDSLQAVSVNDVKS 303

Query: 305 ID 306
           +D
Sbjct: 304 LD 305


>gi|218296534|ref|ZP_03497262.1| malonyl CoA-acyl carrier protein transacylase [Thermus aquaticus
           Y51MC23]
 gi|218243076|gb|EED09608.1| malonyl CoA-acyl carrier protein transacylase [Thermus aquaticus
           Y51MC23]
          Length = 305

 Score =  217 bits (553), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 130/303 (42%), Positives = 168/303 (55%), Gaps = 8/303 (2%)

Query: 7   FPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPALT 66
           FPGQGSQ +GMG+ LY +FP A+ V +  +  L   L  LMW G +E LT T N QPAL 
Sbjct: 6   FPGQGSQKLGMGQALYQAFPAAKEVLDRAEAALP-GLLKLMWEGPEEALTLTENQQPALL 64

Query: 67  AVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQEA 126
            V  A  R   + G    ++ +  AGHSLGE+TA  AA    L + + LVR RG+ MQEA
Sbjct: 65  CVGYAAYRAFLEAG---GKEPALAAGHSLGEWTAHVAAGTLELEEALHLVRLRGRYMQEA 121

Query: 127 VPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAADTCL 186
           VPPG G+M AI+ L     + I      +   EIAN N   Q VISG ++AV+ AA+   
Sbjct: 122 VPPGEGAMAAILKLPK---EEIAEALKGLEGVEIANLNAPEQTVISGKKEAVEKAAEVLK 178

Query: 187 NKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSIDEIS 246
            K A R VFLPVSAPFHSSLM    + +   L  V  + P  P+  N  ASP    + I 
Sbjct: 179 AKRA-RVVFLPVSAPFHSSLMRSAQERLAQDLARVAFKRPRFPVYANVTASPEEDPERIK 237

Query: 247 RLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVEDID 306
            LL+EQ+T  VRW + +      G++   E GSG+VL GL  R  K   A+S+   E + 
Sbjct: 238 ALLLEQITAPVRWVDILLDMERQGLRRFLEFGSGEVLKGLVARTLKEAEALSVVDPESLR 297

Query: 307 LAL 309
            AL
Sbjct: 298 KAL 300


>gi|91202494|emb|CAJ72133.1| strongly similar to malonyl-CoA acyl carrier protein transacylase
           [Candidatus Kuenenia stuttgartiensis]
          Length = 306

 Score =  217 bits (553), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 114/303 (37%), Positives = 174/303 (57%)

Query: 3   TVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQ 62
           T   FPGQG+Q++GMG+D Y  + EAR +F + +  L  +L+ L + G+QEEL  T  +Q
Sbjct: 4   TAFLFPGQGTQLVGMGKDFYKEYKEAREIFNQANDALGFDLASLCFEGNQEELNKTSLSQ 63

Query: 63  PALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKS 122
           PA+   S+A + V+++     K     VAG SLGEYTA  +A + + +D ++LV  RG  
Sbjct: 64  PAILVTSIAILEVLKEISFFKKTTCDAVAGLSLGEYTAHVSAGSVAFADAVKLVYKRGIY 123

Query: 123 MQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAA 182
           MQEA     G M ++IGL+D  ++ IC + + +G+   AN N  GQVVISG  + ++ A 
Sbjct: 124 MQEACEKSSGGMASVIGLEDKKIEHICRELNPLGVICAANYNSPGQVVISGESNVLERAV 183

Query: 183 DTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSI 242
                +GA+  + L V   FHS LMTP S  +   L+S     P V ++ N  A  VS+ 
Sbjct: 184 LLAKERGARMVIPLKVQGAFHSGLMTPASDKLYSELESTVISKPGVLVVANINAEYVSNP 243

Query: 243 DEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKV 302
           +EI   L++Q+   V+W +++Q   + G    YE+G GK L+GL K+ID +    S S +
Sbjct: 244 EEIRTALIKQLNSPVKWYQSMQKLIHDGFSQFYEIGPGKTLSGLMKKIDPAQQVKSFSTI 303

Query: 303 EDI 305
            D+
Sbjct: 304 ADL 306


>gi|145219015|ref|YP_001129724.1| [Acyl-carrier-protein] S-malonyltransferase [Prosthecochloris
           vibrioformis DSM 265]
 gi|145205179|gb|ABP36222.1| [Acyl-carrier-protein] S-malonyltransferase [Chlorobium
           phaeovibrioides DSM 265]
          Length = 306

 Score =  217 bits (553), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 126/302 (41%), Positives = 175/302 (57%), Gaps = 3/302 (0%)

Query: 5   LTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPA 64
             FPGQGSQ  GMGRDLYDSFP AR + E+ +  L   ++D+M++G++EEL  T   QPA
Sbjct: 4   FVFPGQGSQYCGMGRDLYDSFPVARDLMEQANELLGYRITDVMFSGTEEELRQTNRTQPA 63

Query: 65  LTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQ 124
           +   SMA   +++ N        +  AGHSLGEY+ALC A A S +D +R+V  RG+ MQ
Sbjct: 64  IFLHSMAAAALIKSN---GCGGAAMAAGHSLGEYSALCFAGAISFADALRIVARRGELMQ 120

Query: 125 EAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAADT 184
            A     G+M AIIG+ +  ++ + A+AS+ GI + AN N  GQ+VISG   AVK A + 
Sbjct: 121 NAGKENPGTMAAIIGMAEGELEGLLAEASKEGIVQAANFNSPGQIVISGDIPAVKKAVEL 180

Query: 185 CLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSIDE 244
              KGA+ A  L VS  FHS LM P    +   L+SV  +D  +P+  N  A  V+   E
Sbjct: 181 APAKGARMAKELVVSGAFHSPLMRPAEAELAKALESVEFRDASIPVCMNAVAKLVTDAAE 240

Query: 245 ISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVED 304
           I + L+ Q+T  V W ++I+  A  G     EVG  KVL GL KRI+++ S   +   E 
Sbjct: 241 IRKNLLLQLTSSVLWTQSIETMATAGATEFVEVGPQKVLQGLIKRINRNASLSGVDTAES 300

Query: 305 ID 306
           + 
Sbjct: 301 VQ 302


>gi|119478170|ref|ZP_01618226.1| acyl-carrier-protein S-malonyltransferase [marine gamma
           proteobacterium HTCC2143]
 gi|119448679|gb|EAW29923.1| acyl-carrier-protein S-malonyltransferase [marine gamma
           proteobacterium HTCC2143]
          Length = 308

 Score =  217 bits (552), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 126/309 (40%), Positives = 179/309 (57%), Gaps = 9/309 (2%)

Query: 5   LTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPA 64
             FPGQGSQ +GM +++   FP     F E    L  +L D++ NG Q++L  T   QP 
Sbjct: 8   FVFPGQGSQKVGMLKEIAGQFPVVLDTFAEASDELGYDLWDMVQNGEQQQLNLTERTQPI 67

Query: 65  LTAVSMAFIRV-MEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSM 123
           L   S+A  RV  E+ G+      + +AGHSLGE++AL  A++   S+ + LVRARG+ M
Sbjct: 68  LLTSSVALWRVWAEREGM----RPAMMAGHSLGEFSALVCAESIRFSEAVSLVRARGQFM 123

Query: 124 QEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAAD 183
           Q AVP G GSM A++GLDD V+  +C   S+ G  E  N N  GQVVI+G   AV  A +
Sbjct: 124 QTAVPVGEGSMAAVLGLDDAVIVDVC---SKTG-AEAVNFNSPGQVVIAGKVAAVDQAIE 179

Query: 184 TCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSID 243
                GAKRA+ LPVSAPFH+SLM P ++ +   +  +    P +P++ N  A   S  +
Sbjct: 180 LLKEAGAKRAMTLPVSAPFHTSLMQPAAEKLAEKMGQLRVAVPTIPVVHNVHAETESDPE 239

Query: 244 EISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVE 303
           +I +LLV Q+   V+W   +Q     G++   E G GKVL+GL+KRID+SL   +I +  
Sbjct: 240 KIKQLLVRQLYSPVKWTSCVQTMVAAGIEKTLECGPGKVLSGLSKRIDRSLIGYNIEEPV 299

Query: 304 DIDLALRSI 312
            ++ AL  I
Sbjct: 300 ALEKALAEI 308


>gi|228474117|ref|ZP_04058858.1| malonyl CoA-acyl carrier protein transacylase [Capnocytophaga
           gingivalis ATCC 33624]
 gi|228274631|gb|EEK13472.1| malonyl CoA-acyl carrier protein transacylase [Capnocytophaga
           gingivalis ATCC 33624]
          Length = 292

 Score =  217 bits (552), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 116/298 (38%), Positives = 173/298 (58%), Gaps = 7/298 (2%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M     FPGQGSQ +GMG+DLY+S P A+ +F+E +H L   ++D+M+ G +E L  T  
Sbjct: 1   MKKAYIFPGQGSQFVGMGKDLYESSPLAKSLFDEANHILGFAITDIMFAGDEEALKQTRV 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
            QPA+   S     V+++  L        VAGHSLGE++AL A+   +    +RLV  R 
Sbjct: 61  TQPAIFLHS-----VIQRQVLGEAFTPDMVAGHSLGEFSALVASGVLTFEQGLRLVAKRA 115

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           ++MQ+A     G+M AI+GLDD VV+ +C      G+   AN N  GQ+VISG  +AV+ 
Sbjct: 116 EAMQKACELERGTMAAILGLDDAVVEQVCKDTE--GVVTPANYNCPGQLVISGAYEAVEQ 173

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A +T    GAKRA+ LPV   FHS+LM P  + +   +  +T Q P+ PI  N   + ++
Sbjct: 174 ACETLKAAGAKRALILPVGGAFHSALMKPAEEELAKAIGEITFQKPLCPIYQNVTTTAMT 233

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVS 298
             + I + L+ Q+T  V+W +++Q     G  +  E+  GKVL GL K+I+K + A+S
Sbjct: 234 DPETIKKNLIAQLTAPVKWTQSVQQMIQDGATTFVELAPGKVLQGLIKKINKEVEAIS 291


>gi|193214392|ref|YP_001995591.1| malonyl CoA-acyl carrier protein transacylase [Chloroherpeton
           thalassium ATCC 35110]
 gi|193087869|gb|ACF13144.1| malonyl CoA-acyl carrier protein transacylase [Chloroherpeton
           thalassium ATCC 35110]
          Length = 307

 Score =  217 bits (552), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 118/301 (39%), Positives = 174/301 (57%), Gaps = 6/301 (1%)

Query: 5   LTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPA 64
           L FPGQGSQ  GM +D+ + +PE + + E+ +  +  ++SD+M++GS+E L  T   Q A
Sbjct: 4   LVFPGQGSQYKGMAKDICERYPECQELVEKANQIVGYSISDIMFDGSEEALRQTRYTQLA 63

Query: 65  LTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQ 124
           +      F+  M       + D+   AGHSLGEY+ALC +K+ +  D +R+V  RG+ MQ
Sbjct: 64  I------FLHSMMAAHFLDESDVVMTAGHSLGEYSALCFSKSIAFEDAVRIVAKRGELMQ 117

Query: 125 EAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAADT 184
           +A     GSM AIIGLD+ V++ + ++A+  G  + AN N  GQVVISG  +A+K A + 
Sbjct: 118 KAGETNPGSMAAIIGLDEKVLEDVLSEANTFGTVQAANFNSPGQVVISGEVEAIKKAVEI 177

Query: 185 CLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSIDE 244
              KG+K A  L VS  FHS+LM P  K +   L ++  +   +P+  N  A PV+  DE
Sbjct: 178 AKAKGSKLAKELVVSGAFHSALMKPAEKELAEALANIEIKRAEIPVCMNTVAKPVTDADE 237

Query: 245 ISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVED 304
           I   L+ Q+T  V W+++I      GV+   EVG  KVL GL KRID+S     +   ED
Sbjct: 238 IRENLIHQLTSPVLWQQSIMHMVAGGVREFLEVGPQKVLQGLIKRIDRSAKLSGVDTAED 297

Query: 305 I 305
           +
Sbjct: 298 M 298


>gi|168187326|ref|ZP_02621961.1| malonyl CoA-acyl carrier protein transacylase [Clostridium
           botulinum C str. Eklund]
 gi|169294789|gb|EDS76922.1| malonyl CoA-acyl carrier protein transacylase [Clostridium
           botulinum C str. Eklund]
          Length = 314

 Score =  217 bits (552), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 113/307 (36%), Positives = 183/307 (59%), Gaps = 5/307 (1%)

Query: 1   MSTV-LTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATC 59
           MS +   F GQG+Q IGMG++LY++  E++ VF + D+ L  ++S+L ++G  +EL  T 
Sbjct: 1   MSKIAFLFSGQGAQYIGMGKELYENIEESKEVFHKADNALGFSISELCFSGEAQELNKTE 60

Query: 60  NAQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRAR 119
           N QPA+   S+A ++ +EK    +K D+  VAG SLGEY+AL  +      D +R+V+ R
Sbjct: 61  NTQPAILTTSIAALKALEK--YEIKPDV--VAGLSLGEYSALVCSGVLEFEDAVRVVKKR 116

Query: 120 GKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVK 179
           GK MQ+ VP G+G+M AIIGLD   +   C +A+  GI E+AN N   Q+VI+G   AV 
Sbjct: 117 GKFMQQEVPFGVGTMAAIIGLDRENIKEACNRAASEGIVEVANYNCSSQIVIAGEIKAVD 176

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            A D     GAKRA+ L VSAPFHSS++    + +     ++  ++  +P++ N   + +
Sbjct: 177 KALDIAKELGAKRAIKLQVSAPFHSSMLKGAGEKLYNEFQNIELKEIKIPVMTNVTGTYI 236

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
            S+ +I  +L +QV   V W + I+     GV +  E+G GK L G  K+I++ +  +++
Sbjct: 237 KSVSDIKGILKKQVMSSVLWEDIIKNMIEEGVDTFIEIGPGKALVGFVKKINRKVKVLNV 296

Query: 300 SKVEDID 306
             ++ ++
Sbjct: 297 EDLKSLE 303


>gi|299067018|emb|CBJ38213.1| Malonyl CoA-acyl carrier protein transacylase [Ralstonia
           solanacearum CMR15]
          Length = 309

 Score =  217 bits (552), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 125/291 (42%), Positives = 160/291 (54%), Gaps = 4/291 (1%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M+    FPGQGSQ +GM  + +   P       E    L Q++  L+  G  +EL  T N
Sbjct: 1   MTFAFVFPGQGSQSVGM-LNAFADHPVVAATLAEASDALGQDIGKLIAEGPADELNLTTN 59

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
            QP +   ++A  R  +  G       + VAGHSLGEY+AL AA A +  D + LVR R 
Sbjct: 60  TQPVMLTAAVAVYRAWQAAGGPTP---AVVAGHSLGEYSALVAAGAIAFKDAVPLVRFRA 116

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           K+MQEAVP G G M AI+GL D  V + CA+AS  G+ E  N N   QVVI+G + AV+ 
Sbjct: 117 KAMQEAVPVGEGGMAAILGLSDDDVRAACAEASSAGVVEAVNFNAPAQVVIAGAKAAVEK 176

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A +    KGAKRA+ LPVSAPFHSSL+ P S  ++  L  V    P + ++ N   + VS
Sbjct: 177 ACEIAKAKGAKRALPLPVSAPFHSSLLKPASDRLREYLSGVAVSAPAILVINNVDVALVS 236

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRID 291
               I   LV Q    VRW ET+Q     G+  V E G GKVL GL KRID
Sbjct: 237 DPAAIKDALVRQAASPVRWVETVQKMKADGIARVVECGPGKVLAGLTKRID 287


>gi|123441940|ref|YP_001005923.1| malonyl CoA-acyl carrier protein transacylase [Yersinia
           enterocolitica subsp. enterocolitica 8081]
 gi|122088901|emb|CAL11708.1| malonyl CoA-acyl carrier protein transacylase [Yersinia
           enterocolitica subsp. enterocolitica 8081]
          Length = 309

 Score =  217 bits (552), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 124/307 (40%), Positives = 171/307 (55%), Gaps = 3/307 (0%)

Query: 5   LTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPA 64
           + FPGQG+Q +GM  DL   FP     F E    L  +L  L+  G  EEL  T   QPA
Sbjct: 6   MVFPGQGAQSLGMLADLAAQFPIVEETFSEASSVLGYDLWQLVQQGPAEELNKTWQTQPA 65

Query: 65  LTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQ 124
           L   S+A  RV +  G  +    + +AGHSLGEY+AL  A        +RLV  RGK MQ
Sbjct: 66  LLTASVAIWRVWQHQGGNLP---AMMAGHSLGEYSALVCAGVLDFKQAVRLVELRGKLMQ 122

Query: 125 EAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAADT 184
           EAVP G G+M AIIGLD+  +   C +++   +    N N  GQVVI+G ++AV+ A   
Sbjct: 123 EAVPEGTGAMYAIIGLDNESIAKACEESALGQVVSPVNFNSPGQVVIAGNKEAVERAGAA 182

Query: 185 CLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSIDE 244
           C   GAKRA+ LPVS P H +LM P +  +   L+ +  Q P+ P++ N       S + 
Sbjct: 183 CKALGAKRALPLPVSVPSHCALMKPAADKLAVALEEIEFQAPLFPVVNNVDVKTEVSPEA 242

Query: 245 ISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVED 304
           I   LV Q+   VRW E++++ A  G++ + EVG GKVLTGL KRI  +L+A  ++ V  
Sbjct: 243 IRSALVRQLYNPVRWTESVEFMAAEGIELLLEVGPGKVLTGLTKRIVDTLAAAPVNDVAT 302

Query: 305 IDLALRS 311
           +  AL +
Sbjct: 303 LTSALEN 309


>gi|220935005|ref|YP_002513904.1| (acyl-carrier-protein) S-malonyltransferase [Thioalkalivibrio sp.
           HL-EbGR7]
 gi|219996315|gb|ACL72917.1| (acyl-carrier-protein) S-malonyltransferase [Thioalkalivibrio sp.
           HL-EbGR7]
          Length = 311

 Score =  217 bits (552), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 134/309 (43%), Positives = 174/309 (56%), Gaps = 3/309 (0%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M+    FPGQGSQ +GM   L D+ P+ R  F+E    L  +L  L+ NG +E+L  T N
Sbjct: 1   MTFACVFPGQGSQSLGMLSALSDAHPQVRETFQEASDVLGFDLWSLVQNGPEEDLNRTEN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
            QPA+ A  +A  RV +  G       + +AGHSLGEYTAL  A A   SD   LV  RG
Sbjct: 61  TQPAMLAAGVAVWRVWQAAGGPAP---AVMAGHSLGEYTALVCAGAMGFSDAAGLVAERG 117

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           + MQ AV PG G+M AI+GLDD  V  +CA+A+  G+ E  N N  GQVVI+G   AV  
Sbjct: 118 RLMQGAVAPGQGAMAAILGLDDAQVIEVCARAAEGGVVEAVNFNSPGQVVIAGETAAVDR 177

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A       GAKR+V LPVS P H  LM   ++ +   L SV    P +P++ N   S  S
Sbjct: 178 AVALAAEAGAKRSVKLPVSVPSHCRLMAGAAERLAERLASVAIVSPSIPVIHNVDVSSHS 237

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
              +I  +L  Q+   VRW E++Q  A  GV +V E+G GKVLTGL KRIDK+L+   + 
Sbjct: 238 DPAQIRAVLAAQLHRPVRWVESVQKMAADGVTTVLELGPGKVLTGLNKRIDKTLALACVQ 297

Query: 301 KVEDIDLAL 309
             E +  AL
Sbjct: 298 DPESLAQAL 306


>gi|225850203|ref|YP_002730437.1| malonyl CoA-acyl carrier protein transacylase [Persephonella marina
           EX-H1]
 gi|225645269|gb|ACO03455.1| malonyl CoA-acyl carrier protein transacylase [Persephonella marina
           EX-H1]
          Length = 326

 Score =  217 bits (552), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 119/302 (39%), Positives = 174/302 (57%), Gaps = 5/302 (1%)

Query: 5   LTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPA 64
             FPGQGSQ  GMGRD+Y+S+P+ R + E+V+  L  +L+++++   Q+ +  T   QPA
Sbjct: 28  FVFPGQGSQYKGMGRDIYESYPQIRELHEKVNERLGFDLTEIIFEDDQK-INLTQFTQPA 86

Query: 65  LTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQ 124
           L   S +    ++     +  D  Y+AGHSLGE+TAL    +    D + +   RGK MQ
Sbjct: 87  LVLTSYSVFYALKDKKPDLLPD--YLAGHSLGEFTALAVGGSIDPVDAVWITHIRGKLMQ 144

Query: 125 EAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAADT 184
           EAVP G+G M AIIGL    ++ I    +  G+ EIAN N   Q VISG ++AV+ A   
Sbjct: 145 EAVPEGVGGMAAIIGLKSEDIEKIIKDIN--GVVEIANYNSYEQTVISGEKEAVEKAMKI 202

Query: 185 CLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSIDE 244
              KGAK+ V L VS P HSSL+   ++     LD +  +D  +P++ N  A P+   DE
Sbjct: 203 LKEKGAKKVVPLAVSVPAHSSLLRDKAEEFGKYLDEIQIKDLKIPVVSNVTARPIKGSDE 262

Query: 245 ISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVED 304
           I   L       VRW +++++    GV S YE+G  KVL+GL KRID+SL+  ++  +ED
Sbjct: 263 IKEELKVHFYSPVRWVQSVEFMIKDGVNSFYEIGPKKVLSGLIKRIDRSLNIKNVENLED 322

Query: 305 ID 306
           I+
Sbjct: 323 IE 324


>gi|115351052|ref|YP_772891.1| malonyl CoA-acyl carrier protein transacylase [Burkholderia
           ambifaria AMMD]
 gi|115281040|gb|ABI86557.1| [Acyl-carrier-protein] S-malonyltransferase [Burkholderia ambifaria
           AMMD]
          Length = 310

 Score =  217 bits (552), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 136/310 (43%), Positives = 175/310 (56%), Gaps = 4/310 (1%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M     FPGQGSQ +GM  + +      R   +E    LNQ++  L+  G  EEL  T N
Sbjct: 1   MKFAFVFPGQGSQSVGM-LNAFADLAVVRETLQEASDALNQDIGKLIAEGPAEELNLTTN 59

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
            QP +   + A  R  ++ G       S VAGHSLGEYTAL AA A +  D + LVR R 
Sbjct: 60  TQPVMLTAAYACYRAWQQAGGPAP---SIVAGHSLGEYTALVAAGAIAFKDAVPLVRFRA 116

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           ++MQ AVP G G M AI+GLDD  V ++CA+A+  G+ E  N N   QVVI+G + AV+ 
Sbjct: 117 QAMQTAVPVGQGGMAAILGLDDDTVRAVCAEAAAAGVVEAVNFNAPAQVVIAGAKAAVEK 176

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A +    KGAKRA+ LPVSAPFHSSL+ P S  ++  L SV  + P +P++ N   + VS
Sbjct: 177 ACEIAKAKGAKRALPLPVSAPFHSSLLKPASDQLRDYLASVDVKAPQIPVVNNIDVAVVS 236

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
               I   LV Q  G VRW E +Q  A  GV  V E G GKVL GL KRID +L   S+ 
Sbjct: 237 DPAAIKDALVRQAAGPVRWVECVQHIAGTGVTHVIECGPGKVLAGLTKRIDGNLVGASVF 296

Query: 301 KVEDIDLALR 310
               +D AL+
Sbjct: 297 DPASLDEALK 306


>gi|254427295|ref|ZP_05041002.1| malonyl CoA-acyl carrier protein transacylase [Alcanivorax sp.
           DG881]
 gi|196193464|gb|EDX88423.1| malonyl CoA-acyl carrier protein transacylase [Alcanivorax sp.
           DG881]
          Length = 309

 Score =  217 bits (552), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 126/294 (42%), Positives = 170/294 (57%), Gaps = 4/294 (1%)

Query: 3   TVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQ 62
           T   FPGQGSQ +GM  +  +  P  +  F+E    L+Q+L  L   G +E L  T   Q
Sbjct: 4   TAFIFPGQGSQSLGMLSEFAER-PAVKQTFQEASGALDQDLWALAQEGPKEALNQTEITQ 62

Query: 63  PALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKS 122
           P L    +A  R+ E++G       + +AGHSLGEY+AL  A   +L D +RLVR RG+ 
Sbjct: 63  PLLLTAGVALWRLWEQSG---GPRPNVLAGHSLGEYSALTCAGVINLGDAVRLVRTRGQL 119

Query: 123 MQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAA 182
           MQ+AV  G GSM AI+GLDD  V S CAQA++ G+ E  N N  GQVVI+G  DAV+ A 
Sbjct: 120 MQKAVGQGEGSMAAILGLDDEQVRSACAQAAQGGVVEAVNFNAPGQVVIAGSVDAVERAI 179

Query: 183 DTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSI 242
             C   GAKRA+ LPVS P H +LM P ++ +   L+S       +P++ N   +  +  
Sbjct: 180 AACKEAGAKRAMALPVSVPSHCALMKPAAEQLADTLNSTRFHAAEMPVINNVDVAMETDP 239

Query: 243 DEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSA 296
           ++I   L+ Q+   VRW ETIQ     GV  +YE G GKVL GL KRID+ ++A
Sbjct: 240 EKIRDALIRQLYSPVRWVETIQALKEQGVGHLYECGPGKVLCGLVKRIDRDMAA 293


>gi|315633650|ref|ZP_07888940.1| malonyl-CoA-[acyl-carrier-protein] transacylase [Aggregatibacter
           segnis ATCC 33393]
 gi|315477692|gb|EFU68434.1| malonyl-CoA-[acyl-carrier-protein] transacylase [Aggregatibacter
           segnis ATCC 33393]
          Length = 312

 Score =  216 bits (551), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 127/302 (42%), Positives = 175/302 (57%), Gaps = 2/302 (0%)

Query: 5   LTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPA 64
           + FPGQGSQ +GM  +L   +P  +  F++    L  +L  L+  G  EEL  T   QPA
Sbjct: 6   MVFPGQGSQTVGMLAELAGDYPIVQETFKQASEVLGYDLWQLVQEGPVEELNKTWQTQPA 65

Query: 65  LTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQ 124
           L   S+A  RV ++    +K ++  +AGHSLGEY+AL  A      D ++LV  RGK MQ
Sbjct: 66  LLTASVAVYRVWQQKYPALKPEV--MAGHSLGEYSALVCAGVLDFQDAVKLVELRGKLMQ 123

Query: 125 EAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAADT 184
           +AVP G G+M AIIGLD+  + + C QA +  +    N N  GQVVI+G + AV+ AA  
Sbjct: 124 QAVPEGTGAMYAIIGLDNDAIINACKQAEQGEVVSAVNFNSPGQVVIAGAKAAVERAAAL 183

Query: 185 CLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSIDE 244
           C   GAKRA+ L VS P H +LM P +  +   L+S+T ++  V +L N         D 
Sbjct: 184 CKEAGAKRALPLAVSVPSHCALMKPAADQLSVSLESITLKEAGVSVLNNVDVKNEIEADA 243

Query: 245 ISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVED 304
           I   LV Q+   VRW ET++  A +GV+ + EVG GKVL GL KRI  SL AVS++ V+ 
Sbjct: 244 IRNALVRQLYSPVRWTETVEKMAQNGVEVLVEVGPGKVLNGLTKRIVDSLQAVSVNDVKS 303

Query: 305 ID 306
           +D
Sbjct: 304 LD 305


>gi|260597463|ref|YP_003210034.1| malonyl CoA-acyl carrier protein transacylase [Cronobacter
           turicensis z3032]
 gi|260216640|emb|CBA29952.1| Malonyl CoA-acyl carrier protein transacylase [Cronobacter
           turicensis z3032]
          Length = 324

 Score =  216 bits (551), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 129/305 (42%), Positives = 176/305 (57%), Gaps = 3/305 (0%)

Query: 5   LTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPA 64
             FPGQGSQ +GM  D+  +FP     F E    L  +L  L+  G  EEL  T   QPA
Sbjct: 21  FVFPGQGSQAVGMLSDMAANFPVIEATFREASAALGYDLWALVQQGPAEELNKTWQTQPA 80

Query: 65  LTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQ 124
           L   S+A  RV ++ G    +  + +AGHSLGEY+AL  A     +D +RLV  RGK MQ
Sbjct: 81  LLTASVALWRVWQEQG---GKAPALMAGHSLGEYSALVCAGVIDFADAVRLVELRGKFMQ 137

Query: 125 EAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAADT 184
           EAVP G G+M AIIGLDD  +   C  A+   +    N N  GQVVI+G +DAV+ A   
Sbjct: 138 EAVPEGTGAMAAIIGLDDDAIAKACQDAAEGQVVSPVNFNSPGQVVIAGHKDAVERAGAA 197

Query: 185 CLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSIDE 244
           C   GAKRA+ LPVS P H +LM P ++ +   L+ +T   P +P++ N      +S + 
Sbjct: 198 CKAAGAKRALPLPVSVPSHCALMKPAAEKLAAELEKITFNAPQIPVVNNVDVKCETSPEA 257

Query: 245 ISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVED 304
           I   LV Q+   V+W +++++ A  GV  +YEVG GKVLTGLAKRI  +L+A +I++   
Sbjct: 258 IRDALVRQLYSPVQWTKSVEFIAAQGVTQLYEVGPGKVLTGLAKRIVDTLTAAAINEPAS 317

Query: 305 IDLAL 309
           +  AL
Sbjct: 318 LSAAL 322


>gi|168183680|ref|ZP_02618344.1| malonyl CoA-acyl carrier protein transacylase [Clostridium
           botulinum Bf]
 gi|182673270|gb|EDT85231.1| malonyl CoA-acyl carrier protein transacylase [Clostridium
           botulinum Bf]
          Length = 314

 Score =  216 bits (551), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 123/308 (39%), Positives = 178/308 (57%), Gaps = 7/308 (2%)

Query: 5   LTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPA 64
             F GQG+Q +GMG+DLY++ PE R +F   +  L   L+ + + G ++E+  T N QPA
Sbjct: 6   FIFSGQGAQYVGMGKDLYENIPECREIFHIAEEELQIPLTKICFQGPKDEIDKTENTQPA 65

Query: 65  LTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQ 124
           +  +S+A ++ +EK G  +K D++  AG SLGEY++L  +K       + LVR RG+ M+
Sbjct: 66  ILTLSIAAMKALEKYG--IKPDVT--AGLSLGEYSSLVCSKVIDFRKAVSLVRKRGQYME 121

Query: 125 EAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAADT 184
            AVP G+G+M AIIGL    V  IC     VGI EIAN N  GQ+VISG  +AV+ A + 
Sbjct: 122 HAVPNGVGTMAAIIGLKKEKVKEICDGLKEVGIVEIANINCPGQIVISGEINAVEKACEM 181

Query: 185 CLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSIDE 244
              K A + V L VS PFHSS++    + +   L  +  +   VP + N     V SI E
Sbjct: 182 AKEKRALKCVNLSVSGPFHSSMLKEAGENLYEELQKIQFKSIEVPFITNVTGDFVISISE 241

Query: 245 ISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVED 304
           I  LL +QV   V W ++I+   + GV +  E+G  KVL+G  K+ID+    V+I  VED
Sbjct: 242 IKDLLKKQVMSTVLWEDSIKTMIDFGVDTFIEIGPSKVLSGFVKKIDRK---VNILNVED 298

Query: 305 IDLALRSI 312
           ID   ++I
Sbjct: 299 IDSLNKTI 306


>gi|167623706|ref|YP_001674000.1| malonyl CoA-acyl carrier protein transacylase [Shewanella
           halifaxensis HAW-EB4]
 gi|167353728|gb|ABZ76341.1| malonyl CoA-acyl carrier protein transacylase [Shewanella
           halifaxensis HAW-EB4]
          Length = 308

 Score =  216 bits (551), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 127/304 (41%), Positives = 173/304 (56%), Gaps = 3/304 (0%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
           +T   FPGQGSQ +GM  +L  +       F +   TL  +L +L+  G  E L  T   
Sbjct: 3   NTAFVFPGQGSQALGMLAELAQNNAIITETFAQASSTLGYDLWELVQQGPVETLNETDKT 62

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPAL A S+A  R    +G   K   S +AGHSLGEY+AL  A        I+LV  RG+
Sbjct: 63  QPALLAASVAVYRAYLASG---KAMPSVMAGHSLGEYSALVCAGVIDFEAAIKLVELRGQ 119

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCA 181
            MQ+AVP G G+M AIIGLD+  +   C +AS   +    N N  GQVVI+G + AV+ A
Sbjct: 120 LMQQAVPAGTGAMFAIIGLDNDAIAKACEEASEGDVVSPVNYNSPGQVVIAGEKAAVERA 179

Query: 182 ADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSS 241
           A  C   GAK AV LPVS P H  LM P +  +   L+S+   +P V ++ N   +  +S
Sbjct: 180 AALCKANGAKMAVALPVSVPSHCQLMKPAADKLAVALESIEFSEPSVKVINNVDVASPTS 239

Query: 242 IDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISK 301
             EI   LV Q+   VRW ET++  A+ GV +++E+G GKVLTGL KRI++SLSA +++ 
Sbjct: 240 AAEIKDALVRQLYCPVRWSETVELMASEGVTNLFEMGPGKVLTGLTKRINRSLSAQAVND 299

Query: 302 VEDI 305
           V  +
Sbjct: 300 VASL 303


>gi|148381539|ref|YP_001256080.1| malonyl CoA-acyl carrier protein transacylase [Clostridium
           botulinum A str. ATCC 3502]
 gi|153931629|ref|YP_001385913.1| malonyl CoA-acyl carrier protein transacylase [Clostridium
           botulinum A str. ATCC 19397]
 gi|153937434|ref|YP_001389320.1| malonyl CoA-acyl carrier protein transacylase [Clostridium
           botulinum A str. Hall]
 gi|148291023|emb|CAL85160.1| malonyl CoA-acyl carrier protein transacylase [Clostridium
           botulinum A str. ATCC 3502]
 gi|152927673|gb|ABS33173.1| malonyl CoA-acyl carrier protein transacylase [Clostridium
           botulinum A str. ATCC 19397]
 gi|152933348|gb|ABS38847.1| malonyl CoA-acyl carrier protein transacylase [Clostridium
           botulinum A str. Hall]
          Length = 314

 Score =  216 bits (551), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 123/308 (39%), Positives = 177/308 (57%), Gaps = 7/308 (2%)

Query: 5   LTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPA 64
             F GQG+Q +GMG+DLY + PE R +FE  +  L   L+ + + G ++E+  T N QPA
Sbjct: 6   FIFSGQGAQYVGMGKDLYKNIPECRKIFEIAEEELQIPLTKICFQGPKDEIDKTENTQPA 65

Query: 65  LTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQ 124
           +  +S+A ++ +EK G  +K D++  AG SLGEY+AL  +K     + + LVR RG+ M+
Sbjct: 66  ILTLSIAAMKALEKYG--IKPDVT--AGLSLGEYSALVCSKVIDFKEAVSLVRKRGQYME 121

Query: 125 EAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAADT 184
            AVP G+G+M AIIGL    V  IC    +VGI EIAN N  GQ+VISG  +AV+ A + 
Sbjct: 122 HAVPNGVGTMAAIIGLKKEKVKEICDDLKKVGIVEIANINCPGQIVISGEINAVEKACEM 181

Query: 185 CLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSIDE 244
              K A + V L VS PFHSS++    + +   L  +      VP + N     V +  E
Sbjct: 182 AKEKRALKCVNLSVSGPFHSSMLKEAGENLYEELQKIRFNSIEVPFITNVTGDFVINTSE 241

Query: 245 ISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVED 304
           I  LL +QV   V W  +I+   + GV +  E+G  KVL+G  K+ID+    V+I  VED
Sbjct: 242 IKDLLKKQVMSTVLWEGSIKTMIDFGVDTFIEIGPSKVLSGFVKKIDRK---VNILNVED 298

Query: 305 IDLALRSI 312
           ID   ++I
Sbjct: 299 IDSLNKTI 306


>gi|163731330|ref|ZP_02138777.1| malonyl CoA-acyl carrier protein transacylase [Roseobacter
           litoralis Och 149]
 gi|161394784|gb|EDQ19106.1| malonyl CoA-acyl carrier protein transacylase [Roseobacter
           litoralis Och 149]
          Length = 247

 Score =  216 bits (551), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 111/214 (51%), Positives = 145/214 (67%), Gaps = 1/214 (0%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           MS    FPGQG+Q IGMGR L +++P A+ VF+EVD  L + LS L+W G  E LT T N
Sbjct: 1   MSIAFVFPGQGAQTIGMGRALAEAYPAAQAVFDEVDDALGEKLSALIWEGDIETLTLTQN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
           AQPAL A SMA IR +   G+ V + +S+VAGHSLGEY+AL AA  FS++D  RL+R RG
Sbjct: 61  AQPALMATSMAAIRALASEGIGVDK-LSFVAGHSLGEYSALAAAGTFSIADAARLLRTRG 119

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
            +MQ AVP G G+M A++GLD      + A+A++  +C+IAN+N   Q V+SG + AV+ 
Sbjct: 120 LAMQRAVPVGQGAMAAVLGLDFDTATDVAARAAQGQVCQIANENDPAQNVVSGERGAVER 179

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVM 214
           A       GAKRA+ LPVSAPFH +LM P +K M
Sbjct: 180 AIVLAKEAGAKRALLLPVSAPFHCALMAPAAKEM 213


>gi|323143084|ref|ZP_08077787.1| [acyl-carrier-protein] S-malonyltransferase [Succinatimonas hippei
           YIT 12066]
 gi|322417134|gb|EFY07765.1| [acyl-carrier-protein] S-malonyltransferase [Succinatimonas hippei
           YIT 12066]
          Length = 311

 Score =  216 bits (551), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 131/312 (41%), Positives = 182/312 (58%), Gaps = 11/312 (3%)

Query: 5   LTFPGQGSQVIGMGRDLYDSF---PEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
           + FPGQGSQ +GM    + SF   PE +  +EE +  L+ +L  +   G  EEL  T   
Sbjct: 6   VVFPGQGSQSVGM----FASFIEDPEVKRTYEEANDALSYDLKKISLEGPAEELNKTEVT 61

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPA+ A S+A +R ++     V    + VAGHSLGEY+AL AA A   +D +RLVR RG+
Sbjct: 62  QPAILAASVAALRALKSRIDAVP---AAVAGHSLGEYSALVAAGALDFADALRLVRLRGQ 118

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVG-ICEIANDNGGGQVVISGLQDAVKC 180
           +MQ AVP G G+M A++GL D VV   C   S+ G     AN N  GQVVISG ++AV  
Sbjct: 119 AMQAAVPQGKGAMAAVLGLADEVVIDGCKAVSQDGDAVWAANFNTPGQVVISGAKEAVDR 178

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           AA      GAKR V L VSAP H  +M   +  +K  L S+T +D  +P+  N  A P++
Sbjct: 179 AAKFFAENGAKRVVPLAVSAPSHCPMMQSAADKLKEALSSITLKDAAIPVYCNAYAKPLT 238

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
           + DEI + L+ Q+ G VRW E ++   + GV ++ E G GKVL GL ++IDKSL   +I 
Sbjct: 239 AKDEIVKALILQLVGPVRWVECVKAMQSDGVSALIECGPGKVLCGLNRKIDKSLDLANIC 298

Query: 301 KVEDIDLALRSI 312
             + ++ A+  I
Sbjct: 299 DEDSLNKAIELI 310


>gi|219669835|ref|YP_002460270.1| malonyl CoA-acyl carrier protein transacylase [Desulfitobacterium
           hafniense DCB-2]
 gi|219540095|gb|ACL21834.1| malonyl CoA-acyl carrier protein transacylase [Desulfitobacterium
           hafniense DCB-2]
          Length = 313

 Score =  216 bits (551), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 129/300 (43%), Positives = 174/300 (58%), Gaps = 10/300 (3%)

Query: 7   FPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPALT 66
           FPGQGSQ +GMG++L+ +    + V       L + L  ++  G +EEL  T   QPA+ 
Sbjct: 8   FPGQGSQYVGMGKELFATG-WGQEVLTTGQRVLGEELIRILLEGPEEELKKTTYTQPAIL 66

Query: 67  AVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQEA 126
             SMA  R +++ G  ++ D  Y+AGHSLGEY+A  AA + SL + +R+VR RG+ MQ A
Sbjct: 67  LTSMAAWRGLQEAG--IRPD--YLAGHSLGEYSAYTAAGSISLEEALRVVRRRGELMQAA 122

Query: 127 VPPGLGSMVAIIGLDDCVVDSICAQASRVG--ICEIANDNGGGQVVISGLQDAVKCAADT 184
           VP G G+M AI+GL++  V+  C QA   G  I   AN N  GQVVISG  D V+ A   
Sbjct: 123 VPEGQGAMAAILGLENAKVEEACRQAREEGGWIVGPANYNSPGQVVISGETDGVQKACHY 182

Query: 185 CLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSIDE 244
               GAKRA+ L VS PFHS LM    K ++ +L +V  QDP VP++ N  A  V     
Sbjct: 183 AKELGAKRALPLAVSGPFHSPLMAEAGKELRQVLAAVAWQDPNVPVIANIDAQEVREGSM 242

Query: 245 ISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVED 304
           I   LV QV+G V W ++I+     GV +  E+G GKVLTGL K+I   L   ++  VED
Sbjct: 243 IVESLVRQVSGAVLWEQSIRLLGEQGVDTFIELGPGKVLTGLVKKI---LPGATLINVED 299


>gi|312882460|ref|ZP_07742201.1| malonyl CoA-acyl carrier protein transacylase [Vibrio
           caribbenthicus ATCC BAA-2122]
 gi|309369860|gb|EFP97371.1| malonyl CoA-acyl carrier protein transacylase [Vibrio
           caribbenthicus ATCC BAA-2122]
          Length = 308

 Score =  216 bits (550), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 120/304 (39%), Positives = 178/304 (58%), Gaps = 3/304 (0%)

Query: 5   LTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPA 64
           + FPGQGSQ +GM  +L + +   +  F+E    L  +L  L+ NG  E+L  T   QPA
Sbjct: 6   IVFPGQGSQSVGMLAELGEQYNVVKQTFDEASDVLGYDLWALVQNGPVEDLNQTFRTQPA 65

Query: 65  LTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQ 124
           L   S+A  RV ++ G       + +AGHSLGEY+AL  A      + ++LV  RG+ MQ
Sbjct: 66  LLTASVAIWRVWQELGF---EQPANLAGHSLGEYSALVCAGVVDFREAVKLVELRGRLMQ 122

Query: 125 EAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAADT 184
           EAVP G G+M AIIGL D ++   C++A++  +    N N  GQVVI+G +DAV+ AA  
Sbjct: 123 EAVPSGTGAMYAIIGLSDDLIAKACSEAAQDDVVSPVNYNSPGQVVIAGSKDAVERAAIL 182

Query: 185 CLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSIDE 244
           C   GAKRA+ LPVS P H +LM P +  +   L+++  + P +P++ N      +  ++
Sbjct: 183 CKEAGAKRALPLPVSVPSHCALMKPAADKLAMALETIEFKLPNLPVINNVDVIAETDPEK 242

Query: 245 ISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVED 304
           I   LV Q+   VRW E+++  A   V+ + E+G GKVLTGL KRI K+LS  +++ V  
Sbjct: 243 IKDALVRQLYSPVRWTESVELMAQQDVEKLLELGPGKVLTGLTKRIVKTLSGAAVNDVTS 302

Query: 305 IDLA 308
           ++ A
Sbjct: 303 LEAA 306


>gi|57233934|ref|YP_181988.1| malonyl CoA-acyl carrier protein transacylase [Dehalococcoides
           ethenogenes 195]
 gi|57224382|gb|AAW39439.1| malonyl CoA-acyl carrier protein transacylase [Dehalococcoides
           ethenogenes 195]
          Length = 310

 Score =  216 bits (550), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 125/310 (40%), Positives = 179/310 (57%), Gaps = 11/310 (3%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           + T   FPGQG+Q +GMGRDLY  F  AR +F+  D  L  +LS L + G +E+L  T N
Sbjct: 4   IKTAYVFPGQGAQFVGMGRDLYSEFHSARELFDLADKALGFSLSKLCFEGPEEDLKDTRN 63

Query: 61  AQPALTAVSM----AFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLV 116
           +Q A+   S+    AFI   + N L    + S+VAGHSLGEY+AL A         I L 
Sbjct: 64  SQSAIVGHSLCALAAFIESGKSNLL---PEPSFVAGHSLGEYSALGAGGILPYPQAILLA 120

Query: 117 RARGKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQD 176
           R RG+ M EA     G+M A++GL + ++  IC +      C IAN N  GQ+VISGL++
Sbjct: 121 RKRGELMAEAAAKTPGAMAAVLGLSEEILADICLKTG----CYIANYNSPGQLVISGLKE 176

Query: 177 AVKCAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCA 236
            V+ A+      GA + V L VS  FH+ LM+P S  +K +LDS       +P++ N  A
Sbjct: 177 TVEKASAQAAESGAMKVVPLQVSGGFHTPLMSPASAGLKAVLDSTGFDTARIPLVANTSA 236

Query: 237 SPVSSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSA 296
           SP+++  +I   LV Q+TG V+W+++I+     GV +  E+G GKVL GL KRI++S+S 
Sbjct: 237 SPLTNPQDIKSELVNQLTGGVQWQKSIENMIAAGVNTFVEIGPGKVLAGLIKRINRSVSI 296

Query: 297 VSISKVEDID 306
            +I+    I 
Sbjct: 297 YNINDAASIQ 306


>gi|162452089|ref|YP_001614456.1| malonyl CoA-acyl carrier protein transacylase [Sorangium cellulosum
           'So ce 56']
 gi|161162671|emb|CAN93976.1| Malonyl CoA-acyl carrier protein transacylase [Sorangium cellulosum
           'So ce 56']
          Length = 313

 Score =  216 bits (550), Expect = 4e-54,   Method: Compositional matrix adjust.
 Identities = 126/306 (41%), Positives = 178/306 (58%), Gaps = 2/306 (0%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M     FPGQG+Q +GMG+ L +    AR  F   D  L + +S L + G  E LT T N
Sbjct: 1   MKIAWLFPGQGAQEVGMGKALAEVSAAARGAFARADAALGEPISRLCFEGPMEALTQTSN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
            QPA+ A S A    + ++   ++  + Y AGHSLGEY+AL AA A  + D +RL R RG
Sbjct: 61  TQPAIVATSCAVAAALIEHLPNLEPPL-YAAGHSLGEYSALVAAGALEIEDAVRLCRIRG 119

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
            +MQEAVP G G+M A+I LD  VV +ICA+A+R  +   AN NG GQ+VI+G   AV  
Sbjct: 120 SAMQEAVPAGEGAMAALIALDQEVVLAICAEAARGEVVAPANYNGPGQIVIAGHAGAVAR 179

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A +  + +G K A+ L VSAPFH +LM P ++ ++  L+         P++ N  A+P +
Sbjct: 180 AGELAVARGGK-AIPLKVSAPFHCALMRPAAERLRPELERTQLMPLAFPVIANVDATPNA 238

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
             + +  LL+ Q+ G V+W  TI+  A  GV    E+G GKVL GL KRI K +  +S+S
Sbjct: 239 DPERVRSLLLRQIDGTVQWMRTIERMAEDGVTHALEIGPGKVLAGLVKRITKQIKVLSVS 298

Query: 301 KVEDID 306
            +  I+
Sbjct: 299 DMAGIE 304


>gi|194290165|ref|YP_002006072.1| malonyl CoA-acyl carrier protein transacylase [Cupriavidus
           taiwanensis LMG 19424]
 gi|193224000|emb|CAQ70009.1| Malonyl CoA-acyl carrier protein transacylase [Cupriavidus
           taiwanensis LMG 19424]
          Length = 309

 Score =  216 bits (550), Expect = 4e-54,   Method: Compositional matrix adjust.
 Identities = 127/299 (42%), Positives = 165/299 (55%), Gaps = 4/299 (1%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M     FPGQGSQ +GM     D+    R   EE    L Q+L  L+  G  EEL  T N
Sbjct: 1   MKFAFVFPGQGSQSVGMLNAFADNA-VVRATVEEASAALGQDLGRLIAEGPAEELNLTTN 59

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
            QP +   ++A  R     G       + VAGHSLGEY+AL AA     +D + LVR R 
Sbjct: 60  TQPVMLTAAVAIYRAWLDAGGPAP---ALVAGHSLGEYSALVAAGVIPFADAVPLVRFRA 116

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           ++MQEAVP G G M AI+GL D  V + CA+AS  G+ E  N N   QVVI+G + AV+ 
Sbjct: 117 QAMQEAVPVGEGGMAAILGLSDDDVRAACAEASATGVVEAVNFNAPSQVVIAGHKGAVEK 176

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A +    KGAKRA+ LPVSAPFHSSL+ P S  ++  +  +    P +P++ N   + V+
Sbjct: 177 ACEIAKAKGAKRALPLPVSAPFHSSLLKPASDRLRERMAGLAFSAPSIPLVNNVDVAIVN 236

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
             + I   LV Q    VRW E +Q  A  G+  V E G GKVL G+ KRID +LS  +I
Sbjct: 237 DPEGIKDALVRQAAAPVRWVECVQKMAAEGITHVIECGPGKVLAGMTKRIDGNLSGGAI 295


>gi|291534398|emb|CBL07510.1| malonyl CoA-acyl carrier protein transacylase [Roseburia
           intestinalis M50/1]
          Length = 308

 Score =  216 bits (550), Expect = 4e-54,   Method: Compositional matrix adjust.
 Identities = 121/305 (39%), Positives = 170/305 (55%), Gaps = 8/305 (2%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
            TV  FPGQG+Q IGM +D YD+ PE R +FEE       +++ L +    +++  T   
Sbjct: 3   KTVFMFPGQGAQYIGMAKDFYDAIPECREIFEEASEASGLDIAALCFE-ENDKINITEYT 61

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           Q  +     A +R +E  G   K D++  AG SLGEY AL A  A S  D   LVR RG 
Sbjct: 62  QICMLTAEAAILRALEVKGY--KADVT--AGLSLGEYGALIACGALSRKDAFALVRKRGI 117

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCA 181
            MQEAVP G G+M A++ LD   ++  C +    GI  IAN N  GQ+VI+G + AV  A
Sbjct: 118 YMQEAVPEG-GAMAAVLALDTAQIEEACKKTE--GIVSIANYNCPGQIVITGEEKAVAAA 174

Query: 182 ADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSS 241
            + C   GAKR V L VS PFHS+++    + +   L  VT   P +P + N  A  V+ 
Sbjct: 175 GELCKEAGAKRVVPLKVSGPFHSAMLKGAGEKLGEELKHVTVHTPAIPYVANVTADYVTK 234

Query: 242 IDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISK 301
            +EI  LL +QV+  VRW++TI+     G     E+G GK LTG  ++I++ ++AV+I K
Sbjct: 235 EEEIKPLLEKQVSSSVRWQQTIERLIADGADKFVEIGPGKTLTGFMRKINRDVAAVNIDK 294

Query: 302 VEDID 306
            ED +
Sbjct: 295 YEDFE 299


>gi|257468856|ref|ZP_05632950.1| malonyl-CoA-[acyl-carrier-protein] transacylase [Fusobacterium
           ulcerans ATCC 49185]
 gi|317063106|ref|ZP_07927591.1| malonyl-CoA-[acyl-carrier-protein] transacylase [Fusobacterium
           ulcerans ATCC 49185]
 gi|313688782|gb|EFS25617.1| malonyl-CoA-[acyl-carrier-protein] transacylase [Fusobacterium
           ulcerans ATCC 49185]
          Length = 304

 Score =  216 bits (549), Expect = 4e-54,   Method: Compositional matrix adjust.
 Identities = 118/302 (39%), Positives = 174/302 (57%), Gaps = 6/302 (1%)

Query: 5   LTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPA 64
             FPGQG+Q +GMG++LY++   A+  F+ +   L+ +L  +M+ G +E L  T N QPA
Sbjct: 6   FVFPGQGTQYVGMGKELYENSELAKKEFDSLFSKLDFDLKTVMFEGPEEALKETKNTQPA 65

Query: 65  LTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQ 124
           + ++S+   +++E  G  VK D  YVAGHS+GEY A  AA   S  DT++L  ARGK M 
Sbjct: 66  IVSMSLILTKLLEAKG--VKPD--YVAGHSVGEYAAFGAAGYLSTEDTVKLTSARGKFMN 121

Query: 125 EAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAADT 184
           +      G M AIIGLD   +  +       GI E  N N   Q VI+G +DA++ A   
Sbjct: 122 DTAVKVNGGMAAIIGLDSEKIKEVLTNVE--GIVEAVNFNEPNQTVIAGQKDAIERACTA 179

Query: 185 CLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSIDE 244
               GA+RA+ L VS PFHSSLM    + +K   +  T Q   V ++ N  A  ++SI++
Sbjct: 180 LKEAGARRAMPLAVSGPFHSSLMKEAGEKLKEEAEKYTFQMTDVKLVANTTADTLNSIED 239

Query: 245 ISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVED 304
           I   +  Q  G V+W +T++   + GV  +YE+G GKVL GL K+IDK +   +I K+ED
Sbjct: 240 IKNEIYAQSFGPVKWVDTVKKLKSEGVTKIYEIGPGKVLAGLVKKIDKEIEIKNIEKLED 299

Query: 305 ID 306
           ++
Sbjct: 300 LE 301


>gi|332162107|ref|YP_004298684.1| malonyl CoA-acyl carrier protein transacylase [Yersinia
           enterocolitica subsp. palearctica 105.5R(r)]
 gi|318606156|emb|CBY27654.1| malonyl CoA-acyl carrier protein transacylase [Yersinia
           enterocolitica subsp. palearctica Y11]
 gi|325666337|gb|ADZ42981.1| malonyl CoA-acyl carrier protein transacylase [Yersinia
           enterocolitica subsp. palearctica 105.5R(r)]
 gi|330861069|emb|CBX71338.1| malonyl CoA-acyl carrier protein transacylase [Yersinia
           enterocolitica W22703]
          Length = 309

 Score =  216 bits (549), Expect = 5e-54,   Method: Compositional matrix adjust.
 Identities = 123/307 (40%), Positives = 170/307 (55%), Gaps = 3/307 (0%)

Query: 5   LTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPA 64
           + FPGQGSQ +GM  DL   FP     F E    L  +L  L+  G  EEL  T   QPA
Sbjct: 6   MVFPGQGSQSLGMLADLAAQFPIVEETFSEASSVLGYDLWQLVQQGPAEELNKTWQTQPA 65

Query: 65  LTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQ 124
           L   S+A  RV +  G    +  + +AGHSLGEY+AL  A        +RLV  RGK MQ
Sbjct: 66  LLTASVAIWRVWQHQG---GKLPTMMAGHSLGEYSALVCAGVLDFKQAVRLVELRGKLMQ 122

Query: 125 EAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAADT 184
           EAVP G G+M AIIGLD+  +   C +++   +    N N  GQVVI+G ++AV+ A   
Sbjct: 123 EAVPEGTGAMYAIIGLDNESIAKACEESALGQVVSPVNFNSPGQVVIAGNKEAVERAGAA 182

Query: 185 CLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSIDE 244
           C   GAKRA+ LPVS P H +LM P +  +   L+ +  Q P+ P++ N       S + 
Sbjct: 183 CKALGAKRALPLPVSVPSHCALMKPAADKLAVALEEIEFQAPLFPVVNNVDVKTEVSPEA 242

Query: 245 ISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVED 304
           I   LV Q+   VRW E++++ A  G++ + EVG GKVL GL KRI  +L+A +++ V  
Sbjct: 243 IRSALVRQLYNPVRWAESVEFMAAEGIELLLEVGPGKVLAGLTKRIVDTLAAAAVNDVAT 302

Query: 305 IDLALRS 311
           +   L +
Sbjct: 303 LTSTLEN 309


>gi|28870987|ref|NP_793606.1| malonyl CoA-acyl carrier protein transacylase [Pseudomonas syringae
           pv. tomato str. DC3000]
 gi|213969780|ref|ZP_03397915.1| malonyl CoA-acyl carrier protein transacylase [Pseudomonas syringae
           pv. tomato T1]
 gi|28854236|gb|AAO57301.1| malonyl CoA-acyl carrier protein transacylase [Pseudomonas syringae
           pv. tomato str. DC3000]
 gi|213925588|gb|EEB59148.1| malonyl CoA-acyl carrier protein transacylase [Pseudomonas syringae
           pv. tomato T1]
          Length = 312

 Score =  216 bits (549), Expect = 5e-54,   Method: Compositional matrix adjust.
 Identities = 124/288 (43%), Positives = 167/288 (57%), Gaps = 3/288 (1%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
           S    FPGQGSQ +GM  +     P     FE+    L  +L  L  +G  E L  T   
Sbjct: 4   SLAFVFPGQGSQSLGMLAEQGAQHPLILDTFEQASEALGYDLWALTQSGPAELLNQTDKT 63

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPA+   S+A   V    G  V    ++VAGHSLGEY+AL AA++ SL+D ++LV  RG+
Sbjct: 64  QPAILTASIALWHVWLAEGGAVP---AFVAGHSLGEYSALVAAQSLSLADAVKLVERRGQ 120

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCA 181
            MQEAVP G G M AI+GLDD  V + CA+A++  +    N N  GQVVI+G  +AVK A
Sbjct: 121 LMQEAVPAGQGGMAAILGLDDADVIAACAEAAQGEVVSAVNFNSPGQVVIAGSAEAVKRA 180

Query: 182 ADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSS 241
            + C  +GAKRA+ LPVS P H  LM P ++     ++++  Q P + ++ N  AS VS 
Sbjct: 181 MELCKARGAKRALPLPVSVPSHCELMRPAAERFVEAVEAIEWQAPSIALVQNVSASAVSD 240

Query: 242 IDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKR 289
           +  + R L+EQ+   VRW E+IQ  A+HG   + E G GKVL GL KR
Sbjct: 241 LATLKRDLLEQLYKPVRWVESIQCLASHGATRLVECGPGKVLAGLNKR 288


>gi|237737602|ref|ZP_04568083.1| malonyl-CoA-[acyl-carrier-protein] transacylase [Fusobacterium
           mortiferum ATCC 9817]
 gi|229419482|gb|EEO34529.1| malonyl-CoA-[acyl-carrier-protein] transacylase [Fusobacterium
           mortiferum ATCC 9817]
          Length = 303

 Score =  215 bits (548), Expect = 5e-54,   Method: Compositional matrix adjust.
 Identities = 121/307 (39%), Positives = 179/307 (58%), Gaps = 9/307 (2%)

Query: 1   MSTV-LTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATC 59
           MS +   FPGQG+Q +GMG++LY++   AR  F+ +   L+ +L  +M+ G +E L  T 
Sbjct: 1   MSKIAFVFPGQGTQYVGMGKELYENNELARQEFDNLFSKLDFDLKTVMFEGPEEVLKETK 60

Query: 60  NAQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRAR 119
           N QPA+ ++S+   +++E  G  VK D  YVAGHS+GEY A  AA    + DT++L  AR
Sbjct: 61  NTQPAIVSMSLILKKLLEAKG--VKAD--YVAGHSVGEYAAFGAAGYLLIEDTVKLTSAR 116

Query: 120 GKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRV-GICEIANDNGGGQVVISGLQDAV 178
           GK M E      G M AIIGLD    D I  +  +V G+ E  N N   Q VI+G +DA+
Sbjct: 117 GKFMNEVAEKVNGGMAAIIGLDS---DKIIEELKKVDGVVEAVNFNEPKQTVIAGEKDAI 173

Query: 179 KCAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASP 238
             A +     GA+RA+ L VS PFHSSLM    + +K   +        + ++ N  A+ 
Sbjct: 174 AKACEVLKEAGARRAMPLAVSGPFHSSLMKEAGEKLKEEAEKYNFTMTDIKLVANTTANI 233

Query: 239 VSSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVS 298
           ++S+DE+   +  Q  G V+W +TI+   + GV ++YE+G GKVL GL K+IDK +   +
Sbjct: 234 LTSVDEVKDEIYRQSFGPVKWVDTIKKLKSEGVTTIYEIGPGKVLAGLIKKIDKEIEVKN 293

Query: 299 ISKVEDI 305
           I K+ED+
Sbjct: 294 IEKLEDL 300


>gi|260888911|ref|ZP_05900174.1| malonyl CoA-acyl carrier protein transacylase [Leptotrichia
           hofstadii F0254]
 gi|260861358|gb|EEX75858.1| malonyl CoA-acyl carrier protein transacylase [Leptotrichia
           hofstadii F0254]
          Length = 298

 Score =  215 bits (548), Expect = 5e-54,   Method: Compositional matrix adjust.
 Identities = 117/307 (38%), Positives = 186/307 (60%), Gaps = 11/307 (3%)

Query: 1   MSTV-LTFPGQGSQVIGMGRDLYDSF-PEARLVFEEVDHTLNQNLSDLMWNGSQEELTAT 58
           MS +   FPGQG+Q  GMG+ LYD    E + + +E+    N+++  +++ G+ EEL  T
Sbjct: 1   MSKIAFVFPGQGTQYAGMGKKLYDEVNDENKKLIDEIFKN-NEDVKTVIFEGTDEELKNT 59

Query: 59  CNAQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRA 118
             AQPA+   S+   +++++ G+    +  +VAGHSLGEY++L AA   + +DT++L+  
Sbjct: 60  KYAQPAIALFSVVLTKLLKEKGI----NADFVAGHSLGEYSSLYAAGVLNETDTLKLISK 115

Query: 119 RGKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAV 178
           RG+ M  A   G   M AI+GL    V++IC + +  GI E  N N   Q VI+G ++ +
Sbjct: 116 RGEIMSGANIDG--GMAAILGLSAEDVENICGEIN--GIVEAVNYNEPKQTVIAGEKEVI 171

Query: 179 KCAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASP 238
           +   +    KGA+RA+ L VS PFHSSLM PV++++K   ++ T  +P  PI+ N  A+ 
Sbjct: 172 EKNLELFKEKGARRALPLAVSGPFHSSLMKPVAEILKKEFENYTWNNPATPIIANTTANI 231

Query: 239 VSSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVS 298
           ++S DEI   L  Q  G V+W +TI   + +GV  +YE+G GKVL GL K+I+K +  ++
Sbjct: 232 LNSADEIQNELYSQTFGPVKWVDTINKLSENGVTKIYEIGPGKVLAGLIKKINKEIEVIN 291

Query: 299 ISKVEDI 305
           I  VE++
Sbjct: 292 IENVENL 298


>gi|322513606|ref|ZP_08066704.1| malonyl-CoA-[acyl-carrier-protein] transacylase [Actinobacillus
           ureae ATCC 25976]
 gi|322120566|gb|EFX92466.1| malonyl-CoA-[acyl-carrier-protein] transacylase [Actinobacillus
           ureae ATCC 25976]
          Length = 311

 Score =  215 bits (548), Expect = 5e-54,   Method: Compositional matrix adjust.
 Identities = 132/304 (43%), Positives = 182/304 (59%), Gaps = 4/304 (1%)

Query: 5   LTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPA 64
           + FPGQGSQ +GM  DL  ++P     F++    L  +L DL+ NG+ E+L  T   QPA
Sbjct: 6   MVFPGQGSQAVGMLVDLATTYPIVEETFKQASDVLGYDLWDLVQNGTAEDLGQTQRTQPA 65

Query: 65  LTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQ 124
           L A S+A  RV ++    +K   S +AGHSLGEY+AL  A      D I+LV  RG +MQ
Sbjct: 66  LLASSVAIYRVWQQKYPELKP--SVMAGHSLGEYSALVCAGVLDFQDAIKLVELRGNAMQ 123

Query: 125 EAVPPGLGSMVAIIGLDDCVVDSICAQA-SRVG-ICEIANDNGGGQVVISGLQDAVKCAA 182
           +AVP G G+M AIIGLD+  + + C QA + VG I    N N  GQVVI+G + A + A 
Sbjct: 124 QAVPAGTGAMYAIIGLDNQAIINACEQAQAEVGEIVSAVNFNSPGQVVIAGTKAAAEKAG 183

Query: 183 DTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSI 242
           + C   GAKRA+ L VS P H +LM P +  +   L ++T   PVVP++ N   S  +  
Sbjct: 184 ELCKAAGAKRALPLAVSVPSHCALMKPAADKLAEALQNITLNVPVVPVINNVDVSVETDA 243

Query: 243 DEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKV 302
           + I   LV Q+   VRW ET++  AN GV ++YE+G GKVLTGLA RI K L+A +++ V
Sbjct: 244 EAIRNALVRQLYSPVRWTETVEKMANEGVTTLYEIGPGKVLTGLAGRIVKELNAKAVNDV 303

Query: 303 EDID 306
             ++
Sbjct: 304 ASLE 307


>gi|283797603|ref|ZP_06346756.1| malonyl CoA-acyl carrier protein transacylase [Clostridium sp.
           M62/1]
 gi|291074712|gb|EFE12076.1| malonyl CoA-acyl carrier protein transacylase [Clostridium sp.
           M62/1]
 gi|295089950|emb|CBK76057.1| malonyl CoA-acyl carrier protein transacylase [Clostridium cf.
           saccharolyticum K10]
          Length = 305

 Score =  215 bits (548), Expect = 5e-54,   Method: Compositional matrix adjust.
 Identities = 119/303 (39%), Positives = 179/303 (59%), Gaps = 9/303 (2%)

Query: 5   LTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPA 64
             FPGQG+QV GMG+D Y+     + VF+     L  ++ +L +    + L  T   QPA
Sbjct: 6   FIFPGQGAQVCGMGQDFYEQTETGKQVFDTATEILGFSMPELCFE-KNDRLDITEYTQPA 64

Query: 65  LTAVSMAFIRV-MEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSM 123
           +   S+A ++V ME+ G  +K D +  AG SLGEY A+ AA   S+ D IR VR RG  M
Sbjct: 65  MVTASLAMMKVLMERTG--IKPDAA--AGLSLGEYPAMAAAGVMSVEDAIRTVRQRGILM 120

Query: 124 QEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAAD 183
           QEAVP G+G+M A++ +D   ++ +      V   +IAN N  GQ+VISG ++AV  AA+
Sbjct: 121 QEAVPAGIGAMAAVLAMDAEEIERVIEPIEGV---QIANYNCPGQIVISGKKEAVDEAAE 177

Query: 184 TCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSID 243
                GAKR + L VS PFHS ++T   + +  +LD+V   +PV+P   N  A  V+  +
Sbjct: 178 KLKEAGAKRVIPLNVSGPFHSRMLTEAGEKLGKVLDTVEIHEPVIPYAANVTAEYVTKAE 237

Query: 244 EISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVE 303
           ++  LLV+QV+  VRW +T++     GV +  E+G GK L G  K+ID+++  ++I K+E
Sbjct: 238 DVKPLLVKQVSSSVRWEQTMRMMLQDGVDTFIEIGPGKTLAGFMKKIDRNVRVINIEKLE 297

Query: 304 DID 306
           DI+
Sbjct: 298 DIE 300


>gi|297566947|ref|YP_003685919.1| malonyl CoA-acyl carrier protein transacylase [Meiothermus silvanus
           DSM 9946]
 gi|296851396|gb|ADH64411.1| malonyl CoA-acyl carrier protein transacylase [Meiothermus silvanus
           DSM 9946]
          Length = 304

 Score =  215 bits (548), Expect = 6e-54,   Method: Compositional matrix adjust.
 Identities = 128/303 (42%), Positives = 167/303 (55%), Gaps = 8/303 (2%)

Query: 7   FPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPALT 66
           FPGQGSQ +GMG+ LY     AR   E  + TL   L  L+W G ++ L  T N QPAL 
Sbjct: 6   FPGQGSQEVGMGKALYQGSRAAREALERAEATLP-GLLGLLWEGPEDALKLTANQQPALL 64

Query: 67  AVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQEA 126
           AV  A  +   + G    ++ +Y AGHSLGE+TA  AA   +L D +RLVR RG+ MQEA
Sbjct: 65  AVGYAAYQAYREAG---GKEPTYAAGHSLGEWTAHVAAGTLALEDALRLVRKRGEYMQEA 121

Query: 127 VPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAADTCL 186
           VP G G+M AI+      ++ I  + + +   E+AN N   Q VISG  + V  A +   
Sbjct: 122 VPVGQGAMAAIL---KVPLEVILEEIAGIEGVELANLNSPEQTVISGKAEGVHRAVELLK 178

Query: 187 NKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSIDEIS 246
            + A RAV LPVSAPFHSSLM P  + +   L  V    P  P+  N  A P +    I 
Sbjct: 179 ARRA-RAVLLPVSAPFHSSLMRPARERLAHDLQHVPFSSPKFPVYSNVTAHPETDPSRIK 237

Query: 247 RLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVEDID 306
            LL+EQ+T  VRW E +Q    HGV    E GSG+VLTGL  R  + + A S++   +I 
Sbjct: 238 TLLLEQITHSVRWVEILQSLKAHGVAKFLEFGSGRVLTGLVGRTLEGVEANSLTTPAEIA 297

Query: 307 LAL 309
            AL
Sbjct: 298 EAL 300


>gi|237747697|ref|ZP_04578177.1| S-malonyltransferase [Oxalobacter formigenes OXCC13]
 gi|229379059|gb|EEO29150.1| S-malonyltransferase [Oxalobacter formigenes OXCC13]
          Length = 310

 Score =  215 bits (548), Expect = 6e-54,   Method: Compositional matrix adjust.
 Identities = 126/311 (40%), Positives = 175/311 (56%), Gaps = 10/311 (3%)

Query: 5   LTFPGQGSQVIGMGRDLYDSFPEARLV---FEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
             FPGQGSQ +GM     + F + ++V     E    L  +L  ++  G +E+L  T N 
Sbjct: 6   FVFPGQGSQAVGM----LNGFADNKVVQDTLAEASDALGFDLGKMIAEGPKEDLDLTTNT 61

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QP +   S+AF R     G  +      VAGHSLGE++AL A+     +D ++LVR R +
Sbjct: 62  QPVMLTSSVAFYRAWIAAGGALPE---VVAGHSLGEFSALVASGVIPFADAVKLVRFRAQ 118

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCA 181
           +MQEAVP G GSM AIIGL    V + C +A++  + E AN N   Q+VI+G   A+  A
Sbjct: 119 AMQEAVPVGQGSMAAIIGLSGDEVKAACGEAAQGEVVEPANFNSPTQIVIAGHNTALARA 178

Query: 182 ADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSS 241
            D    KGAKRA+ LPVSAPFHSSL+ P S  +   +  +    P +P++ N   + +S+
Sbjct: 179 CDIAKAKGAKRALMLPVSAPFHSSLLQPASVRLAEYMSKLDFSAPQIPLINNVDVAILSN 238

Query: 242 IDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISK 301
            +EI   LV QV   VRW ETI+  A  G+  V E G GKVL GL+KRID SL+  +I  
Sbjct: 239 PEEIKDALVRQVASSVRWVETIEKMAGMGITHVVECGPGKVLAGLSKRIDSSLTGDAIVD 298

Query: 302 VEDIDLALRSI 312
              +D  L ++
Sbjct: 299 QASLDKVLETL 309


>gi|34498870|ref|NP_903085.1| acyl-carrier-protein S-malonyltransferase [Chromobacterium
           violaceum ATCC 12472]
 gi|34332878|gb|AAQ61079.2| malonyl CoA-acyl carrier protein transacylase [Chromobacterium
           violaceum ATCC 12472]
          Length = 309

 Score =  215 bits (548), Expect = 6e-54,   Method: Compositional matrix adjust.
 Identities = 129/314 (41%), Positives = 179/314 (57%), Gaps = 6/314 (1%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M+    FPGQGSQ + M  D +   P  +  FEE   TL+ +L  ++   S + + AT N
Sbjct: 1   MAFAFLFPGQGSQSLKM-MDGFADLPVVQHTFEEASDTLSLDLWAMLRADSADAINATVN 59

Query: 61  AQPALTAVSMA-FIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRAR 119
            QP + A   A ++   E NG    +  S VAGHSLGEYTAL AA A   ++ ++LVR R
Sbjct: 60  TQPIMLAAGYATYLAWQELNG----KQPSVVAGHSLGEYTALVAAGALPFAEAVKLVRLR 115

Query: 120 GKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVK 179
            ++MQ AVP G G+M AI+ L D  + + CA+A++  + E  N N  GQVVI+G + AV+
Sbjct: 116 AEAMQAAVPAGAGAMAAILNLPDDDIRAACAEAAQGEVVEAVNFNSPGQVVIAGNKGAVE 175

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            A D C  KGAKRA+ LPVS P H SLM P ++ +   L  V    P VP+L N   +  
Sbjct: 176 RAMDLCKEKGAKRALPLPVSVPSHCSLMRPAAERLAEALRDVHLSAPAVPVLHNADVASY 235

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
           +   +I   L  Q+   VRW ETIQ  A  GV  + E G GKVLTGLAKRID ++  +++
Sbjct: 236 NDAAQIRDALTRQLFMPVRWTETIQKLAAEGVTLMAECGPGKVLTGLAKRIDGNVKCLAL 295

Query: 300 SKVEDIDLALRSIV 313
           +    ++ A   +V
Sbjct: 296 TDRAALEAAREELV 309


>gi|254492064|ref|ZP_05105240.1| malonyl CoA-acyl carrier protein transacylase [Methylophaga
           thiooxidans DMS010]
 gi|224462728|gb|EEF79001.1| malonyl CoA-acyl carrier protein transacylase [Methylophaga
           thiooxydans DMS010]
          Length = 270

 Score =  215 bits (548), Expect = 7e-54,   Method: Compositional matrix adjust.
 Identities = 115/249 (46%), Positives = 155/249 (62%), Gaps = 3/249 (1%)

Query: 51  SQEELTATCNAQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLS 110
           S+++L  T   QPA+    +A  RV +      K D  Y AGHSLGEYTAL AA A   +
Sbjct: 8   SEDQLNQTDKTQPAMLTAGIAVWRVWQSVA-TTKPD--YFAGHSLGEYTALVAANALDFA 64

Query: 111 DTIRLVRARGKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVV 170
           D ++LV  RG+ MQ+AVP G G+M AI+GL+D VV  +CA A+  G+ E  N N  GQVV
Sbjct: 65  DAVKLVEMRGRYMQQAVPAGEGAMAAILGLEDQVVRELCADAAANGVVEAVNYNSPGQVV 124

Query: 171 ISGLQDAVKCAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPI 230
           I+G  +AVK A +    KGAKRA+ LPVS P H +LM P ++ +   L+++  Q P  P+
Sbjct: 125 IAGSANAVKRAIEIATEKGAKRALLLPVSVPSHCALMKPAAQQLTDALNNIPVQLPTTPV 184

Query: 231 LPNFCASPVSSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRI 290
           + N   +  +   +I +LL EQ+   VRW ETIQWFA   V ++ E G GKVL GL KRI
Sbjct: 185 IHNASVTVATDAAQIKQLLAEQLFSPVRWVETIQWFAAQDVSNIVECGPGKVLAGLNKRI 244

Query: 291 DKSLSAVSI 299
           DKSL+A+ +
Sbjct: 245 DKSLNAMPL 253


>gi|298486219|ref|ZP_07004282.1| Malonyl CoA-acyl carrier protein transacylase [Pseudomonas
           savastanoi pv. savastanoi NCPPB 3335]
 gi|298159226|gb|EFI00284.1| Malonyl CoA-acyl carrier protein transacylase [Pseudomonas
           savastanoi pv. savastanoi NCPPB 3335]
          Length = 312

 Score =  215 bits (547), Expect = 7e-54,   Method: Compositional matrix adjust.
 Identities = 124/288 (43%), Positives = 166/288 (57%), Gaps = 3/288 (1%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
           S    FPGQGSQ +GM  +     P     FE+    L  +L  L  NG  E L  T   
Sbjct: 4   SLAFVFPGQGSQSLGMLAEQGAQHPLILDTFEQASEALGYDLWALTQNGPAELLNQTDKT 63

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPA+   S+A   V    G  V    ++VAGHSLGEY+AL AA++ SL+D ++LV  RG+
Sbjct: 64  QPAILTASVALWHVWLAEGGAVP---AFVAGHSLGEYSALVAAQSLSLADAVKLVERRGQ 120

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCA 181
            MQEAVP G G M AI+GLDD  V + CA+A++  +    N N  GQVVI+G  +AVK A
Sbjct: 121 LMQEAVPAGQGGMAAILGLDDADVIAACAEAAQGEVVSAVNFNSPGQVVIAGSAEAVKRA 180

Query: 182 ADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSS 241
            + C  +GAKRA+ LPVS P H  LM P ++     ++++  Q P + ++ N  AS VS 
Sbjct: 181 MELCKARGAKRALPLPVSVPSHCELMRPAAERFAEAVEAIEWQAPEIALVQNVSASAVSD 240

Query: 242 IDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKR 289
           +  + R L+EQ+   VRW E+IQ  A+ G   + E G GKVL GL KR
Sbjct: 241 LATLKRDLLEQLYKPVRWVESIQCLASRGANQLVECGPGKVLAGLNKR 288


>gi|329900904|ref|ZP_08272636.1| Malonyl CoA-acyl carrier protein transacylase [Oxalobacteraceae
           bacterium IMCC9480]
 gi|327549316|gb|EGF33888.1| Malonyl CoA-acyl carrier protein transacylase [Oxalobacteraceae
           bacterium IMCC9480]
          Length = 315

 Score =  215 bits (547), Expect = 7e-54,   Method: Compositional matrix adjust.
 Identities = 123/290 (42%), Positives = 167/290 (57%), Gaps = 4/290 (1%)

Query: 5   LTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPA 64
             FPGQGSQ IGM     D+    R    E    L  +L++L+ +G +E L  T N QP 
Sbjct: 6   FVFPGQGSQAIGMLNAFSDN-AAVRETVAEASEVLKIDLAELIASGPKELLDLTTNTQPV 64

Query: 65  LTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQ 124
           +   ++A  R    +G  V    +  AGHSLGEY+AL A+   S  D + LVR R ++MQ
Sbjct: 65  MLTAAVAMYRAWIADGGPVP---AMFAGHSLGEYSALVASGVLSFKDAVPLVRFRAEAMQ 121

Query: 125 EAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAADT 184
           +AVP G G M AI+GL D  V ++CA++++  + E  N N   QVVI+G + AV+ A + 
Sbjct: 122 QAVPVGQGGMAAILGLTDADVIALCAESAQGEVVEAVNFNAPAQVVIAGTKAAVERACEM 181

Query: 185 CLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSIDE 244
              KGAKRA+ LPVSAPFHSSL+ P S  ++  LD +    P+VP++ N   + VS +  
Sbjct: 182 AKAKGAKRALILPVSAPFHSSLLKPASDRLRVYLDPLHFATPLVPVINNVDVAIVSDVAG 241

Query: 245 ISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSL 294
           +   LV Q    VRW ETI   A  G+  V E G GKVL+GL KRID +L
Sbjct: 242 VKDALVRQAASPVRWVETIGKMAASGITHVIECGPGKVLSGLTKRIDSTL 291


>gi|78485056|ref|YP_390981.1| malonyl CoA-acyl carrier protein transacylase [Thiomicrospira
           crunogena XCL-2]
 gi|78363342|gb|ABB41307.1| [Acyl-carrier-protein] S-malonyltransferase [Thiomicrospira
           crunogena XCL-2]
          Length = 307

 Score =  215 bits (547), Expect = 8e-54,   Method: Compositional matrix adjust.
 Identities = 121/296 (40%), Positives = 171/296 (57%), Gaps = 9/296 (3%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           MS    FPGQGSQ +GM  D+  + P  +  F+E    L  +L D++ NG +++L  T  
Sbjct: 1   MSYAFVFPGQGSQSLGMMADMAATHPVVKTTFDEASAALGYDLWDIIQNGPEDKLNQTDI 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDIS--YVAGHSLGEYTALCAAKAFSLSDTIRLVRA 118
            QPA+    +A  R      L  ++++S  ++AGHSLGEY+AL AA   SLS  ++LV  
Sbjct: 61  TQPAMLTSGIATWR-----ALAEQKELSPAFLAGHSLGEYSALVAAGVMSLSQGVKLVAE 115

Query: 119 RGKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAV 178
           RG+ MQ AVP G G+M A++GL+D  +  ICAQ S  G+ E  N N  GQVVI+G + AV
Sbjct: 116 RGRLMQSAVPAGEGAMAAVLGLEDQQIIDICAQQS--GVVEAVNFNSPGQVVIAGEKKAV 173

Query: 179 KCAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASP 238
             A       GAKR V L VS P H SLM P ++ +   L+ ++   P +P+L N     
Sbjct: 174 DAALPAFEAAGAKRVVLLAVSVPSHCSLMKPAAEALAKELEGMSLNAPSIPVLHNASVES 233

Query: 239 VSSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSL 294
                 I   LVEQ+   V+W +TI+    +GV+S+YE+G GKVL GL +RID+ +
Sbjct: 234 YQDEASIKHALVEQLYRPVQWVKTIEKMKENGVESLYELGPGKVLMGLNRRIDRKM 289


>gi|90021275|ref|YP_527102.1| [Acyl-carrier-protein] S-malonyltransferase [Saccharophagus
           degradans 2-40]
 gi|89950875|gb|ABD80890.1| [Acyl-carrier-protein] S-malonyltransferase [Saccharophagus
           degradans 2-40]
          Length = 314

 Score =  215 bits (547), Expect = 8e-54,   Method: Compositional matrix adjust.
 Identities = 126/302 (41%), Positives = 181/302 (59%), Gaps = 5/302 (1%)

Query: 5   LTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPA 64
             FPGQGSQ +GM  D Y      +  F+E    L  +L  L+ +G+Q+EL  T   QPA
Sbjct: 9   FVFPGQGSQKVGMLADFYQEGSVFKQTFDEAQAALGYDLWALIQSGTQDELNMTEVTQPA 68

Query: 65  LTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQ 124
           L A S+A  R  +  G       +Y++GHSLGE++AL  A   +  D +RLVR+RGK MQ
Sbjct: 69  LLACSVALWRKWQAEG---GAQPAYMSGHSLGEWSALVCAGVVAFEDALRLVRSRGKYMQ 125

Query: 125 EAVPPGLGSMVAIIGLDDCVVDSICAQASRVG-ICEIANDNGGGQVVISGLQDAVKCAAD 183
           EAVP G+G+M AIIGLDD  V++ CA A+  G I    N N  GQ+VI+G++  V+ A +
Sbjct: 126 EAVPAGVGAMAAIIGLDDAAVEAACATAAEGGDIVSPVNYNSPGQLVIAGMKAGVEKAME 185

Query: 184 TCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSID 243
            C   GAKRA+ LPVSAPFH++LM P +  +   +++V    P++P++ N  A   +  +
Sbjct: 186 LCKEAGAKRALPLPVSAPFHTALMKPAADKLAAEVEAVEFNAPLIPVVHNVTAKTEADAN 245

Query: 244 EISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVE 303
            I  L+++Q++  V W + +      GV+   E G GKVL+GL KRI KSL AVS ++  
Sbjct: 246 TIKALMIQQISAPVLWVDCVNELVALGVEKTVECGPGKVLSGLNKRIQKSL-AVSATETT 304

Query: 304 DI 305
           D+
Sbjct: 305 DL 306


>gi|56478541|ref|YP_160130.1| acyl-carrier-protein S-malonyltransferase [Aromatoleum aromaticum
           EbN1]
 gi|56314584|emb|CAI09229.1| probable malonyl CoA-[acyl-carrier-protein] transacylase
           [Aromatoleum aromaticum EbN1]
          Length = 309

 Score =  215 bits (547), Expect = 9e-54,   Method: Compositional matrix adjust.
 Identities = 127/312 (40%), Positives = 169/312 (54%), Gaps = 4/312 (1%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M   L FPGQGSQ +GM    Y    E R  F E    L ++L  ++  G  E L  T N
Sbjct: 1   MVFALVFPGQGSQSVGM-MSAYGERAEIRDTFAEASDALGEDLWQMVSEGPAERLALTVN 59

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
            QP +    +A  R     G       S VAGHSLGEY+AL AA A S  D + LVR R 
Sbjct: 60  TQPLMLTAGVAAYRAWLAAG---GPKPSLVAGHSLGEYSALVAAGALSFKDAVPLVRFRA 116

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           ++MQEAVP G G+M A++GLD   V   CA+ASR  + E AN N  GQ+VI+G + AV+ 
Sbjct: 117 QAMQEAVPAGEGAMAALLGLDVDAVREACAEASRGEVVEAANLNAPGQIVIAGAKGAVER 176

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A +    +GAKRA+ LPVSAPFH +LM P ++ +   L +V    P + +L N   +  +
Sbjct: 177 AIEAAKGRGAKRAMLLPVSAPFHCALMRPAAERLAERLATVAIASPEIAVLNNVDVAVCN 236

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
               I   LV Q    VRW E +Q  +  GV  V+E G GKVL G+ KRI   L   SI 
Sbjct: 237 DPAAIRDALVRQAFSPVRWIEIVQEISRRGVGHVFECGPGKVLAGMTKRIAGDLQGGSIH 296

Query: 301 KVEDIDLALRSI 312
               ++L++ ++
Sbjct: 297 DAASLELSIAAV 308


>gi|78189620|ref|YP_379958.1| malonyl CoA-acyl carrier protein transacylase [Chlorobium
           chlorochromatii CaD3]
 gi|78171819|gb|ABB28915.1| [Acyl-carrier-protein] S-malonyltransferase [Chlorobium
           chlorochromatii CaD3]
          Length = 303

 Score =  214 bits (546), Expect = 9e-54,   Method: Compositional matrix adjust.
 Identities = 128/302 (42%), Positives = 175/302 (57%), Gaps = 6/302 (1%)

Query: 5   LTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPA 64
             FPGQGSQ  GMGRDL++SFPEAR + E+ +  L  +++D+M+ GS+EEL  T   QPA
Sbjct: 4   FVFPGQGSQYCGMGRDLFESFPEARALMEQANEILGYSITDIMFTGSEEELRQTKFTQPA 63

Query: 65  LTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQ 124
           +   SM    ++  NG      +S  AGHSLGEY+ALC A A S  D +R+V  RG  MQ
Sbjct: 64  IFLHSMVLATLLGNNG------VSMCAGHSLGEYSALCFAGAMSFEDALRIVAKRGNLMQ 117

Query: 125 EAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAADT 184
           EA     G+M AIIG+ D  ++ + A+A   GI + AN N  GQ+VISG   AVK A   
Sbjct: 118 EAGTQNPGTMAAIIGMADEALEGLLAEAQSDGIVQAANFNSPGQIVISGDVAAVKKAVAL 177

Query: 185 CLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSIDE 244
             +KGA+ A  L VS  FHS LM P  + +   L  V  ++  +P+  N  A  V+S  E
Sbjct: 178 APSKGARMAKELVVSGAFHSPLMKPAEEELAAALAQVEIKEARIPVCMNAVAKAVTSAAE 237

Query: 245 ISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVED 304
           I   LV Q+T  V W ++I+  A  GV +  EVG  KVL GL KRI K+++  ++    +
Sbjct: 238 IRCNLVLQLTSSVLWTQSIEAMAQAGVTTFVEVGPQKVLQGLIKRIVKNVTIQTVDTAAE 297

Query: 305 ID 306
           + 
Sbjct: 298 LQ 299


>gi|66044891|ref|YP_234732.1| acyl-carrier-protein S-malonyltransferase [Pseudomonas syringae pv.
           syringae B728a]
 gi|63255598|gb|AAY36694.1| Malonyl CoA-acyl carrier protein transacylase [Pseudomonas syringae
           pv. syringae B728a]
          Length = 312

 Score =  214 bits (546), Expect = 9e-54,   Method: Compositional matrix adjust.
 Identities = 124/288 (43%), Positives = 166/288 (57%), Gaps = 3/288 (1%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
           S    FPGQGSQ +GM  +     P     FE+    L  +L  L  NG  E L  T   
Sbjct: 4   SLAFVFPGQGSQSLGMLAEQGAHHPLILDTFEQASEALGYDLWALTQNGPAELLNQTDKT 63

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPA+   S+A   V    G  V    ++VAGHSLGEY+AL AA++ SL+D ++LV  RG+
Sbjct: 64  QPAILTASVALWHVWLAEGGAVP---AFVAGHSLGEYSALVAAQSLSLADAVKLVERRGQ 120

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCA 181
            MQEAVP G G M AI+GLDD  V + CA+A++  +    N N  GQVVI+G  +AVK A
Sbjct: 121 LMQEAVPAGQGGMAAILGLDDADVIAACAEAAQGEVVSAVNFNSPGQVVIAGSAEAVKRA 180

Query: 182 ADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSS 241
            + C  +GAKRA+ LPVS P H  LM P ++     ++++  Q P + ++ N  AS VS 
Sbjct: 181 MELCKARGAKRALPLPVSVPSHCELMRPAAERFAEAVEAIEWQAPEIALVQNVSASAVSD 240

Query: 242 IDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKR 289
           +  + R L+EQ+   VRW E+IQ  A+ G   + E G GKVL GL KR
Sbjct: 241 LATLKRDLLEQLYKPVRWVESIQCLASRGATQLVECGPGKVLAGLNKR 288


>gi|156934422|ref|YP_001438338.1| hypothetical protein ESA_02253 [Cronobacter sakazakii ATCC BAA-894]
 gi|156532676|gb|ABU77502.1| hypothetical protein ESA_02253 [Cronobacter sakazakii ATCC BAA-894]
          Length = 309

 Score =  214 bits (546), Expect = 9e-54,   Method: Compositional matrix adjust.
 Identities = 127/305 (41%), Positives = 176/305 (57%), Gaps = 3/305 (0%)

Query: 5   LTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPA 64
             FPGQGSQ +GM  D+  +FP     F E    L  +L  L+  G  EEL  T   QPA
Sbjct: 6   FVFPGQGSQAVGMLSDMAANFPVIEATFREASAALGYDLWALVQQGPAEELNKTWQTQPA 65

Query: 65  LTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQ 124
           L   S+A  RV ++ G    +  + +AGHSLGEY+AL  A     +D +RLV  RGK MQ
Sbjct: 66  LLTASVALWRVWQEQG---GKAPALMAGHSLGEYSALVCAGVIGFADAVRLVELRGKFMQ 122

Query: 125 EAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAADT 184
           EAVP G G+M AIIGLDD  +   C +A+   +    N N  GQVVI+G ++AV+ A   
Sbjct: 123 EAVPEGTGAMAAIIGLDDDAIAKACEEAAEGQVVSPVNFNSPGQVVIAGHKEAVERAGAA 182

Query: 185 CLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSIDE 244
           C   GAKRA+ LPVS P H +LM P ++ +   L+ +T   P +P++ N      +S + 
Sbjct: 183 CKAAGAKRALPLPVSVPSHCALMKPAAEKLAAELEKITFNAPQIPVVNNVDVKCETSPEA 242

Query: 245 ISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVED 304
           I   LV Q+   V+W +++++ A  GV  +YEVG GKVLTGL KRI  +L+A +I++   
Sbjct: 243 IRDALVRQLYSPVQWTKSVEFIAAQGVTQLYEVGPGKVLTGLTKRIVDTLTAAAINEPAS 302

Query: 305 IDLAL 309
           +  AL
Sbjct: 303 LSAAL 307


>gi|300691985|ref|YP_003752980.1| Malonyl CoA-acyl carrier protein transacylase [Ralstonia
           solanacearum PSI07]
 gi|299079045|emb|CBJ51707.1| Malonyl CoA-acyl carrier protein transacylase [Ralstonia
           solanacearum PSI07]
          Length = 309

 Score =  214 bits (546), Expect = 9e-54,   Method: Compositional matrix adjust.
 Identities = 126/291 (43%), Positives = 162/291 (55%), Gaps = 4/291 (1%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M+    FPGQGSQ +GM  + +   P       E    L Q++  L+  G  +EL  T N
Sbjct: 1   MTFAFVFPGQGSQSVGM-LNAFADHPAVAATLAEASDALGQDIGRLIAEGPADELNLTAN 59

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
            QP +   ++A  R  +  G       + VAGHSLGEY+AL AA A +  D + LVR R 
Sbjct: 60  TQPVMLTAAVAVYRAWQAAGGPAP---TVVAGHSLGEYSALVAAGAIAFKDAVPLVRFRA 116

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           K+MQEAVP G G M AI+GL D  V + CA+AS  G+ E  N N   QVVI+G + AV+ 
Sbjct: 117 KAMQEAVPVGEGGMAAILGLSDDDVRAACAEASIAGVVEAVNFNAPAQVVIAGAKAAVEK 176

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A +    KGAKRA+ LPVSAPFHSSL+ P S  ++  L +VT   P +P++ N     V+
Sbjct: 177 ACEVAKAKGAKRALPLPVSAPFHSSLLKPASDRLREHLANVTVSAPSIPVINNVDVVVVN 236

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRID 291
               I   LV Q    VRW ET+Q     G+  V E G GKVL GL KRID
Sbjct: 237 DPAAIKDALVRQAASPVRWVETVQKMKADGITRVVECGPGKVLAGLTKRID 287


>gi|257413115|ref|ZP_04742024.2| malonyl CoA-acyl carrier protein transacylase [Roseburia
           intestinalis L1-82]
 gi|257204614|gb|EEV02899.1| malonyl CoA-acyl carrier protein transacylase [Roseburia
           intestinalis L1-82]
 gi|291541242|emb|CBL14353.1| malonyl CoA-acyl carrier protein transacylase [Roseburia
           intestinalis XB6B4]
          Length = 312

 Score =  214 bits (546), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 121/305 (39%), Positives = 170/305 (55%), Gaps = 8/305 (2%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
            TV  FPGQG+Q IGM +D YD+ PE R VFEE       +++ L +    +++  T   
Sbjct: 7   KTVFMFPGQGAQYIGMAKDFYDAIPECREVFEEASEASGLDIAALCFE-ENDKINITEYT 65

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           Q  +     A +R +E  G   K D++  AG SLGEY AL A  A S  D   LVR RG 
Sbjct: 66  QICMLTAEAAILRALEVKGY--KADVT--AGLSLGEYGALIACGALSRKDAFALVRKRGI 121

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCA 181
            MQEAVP G G+M A++ LD   ++  C +    G