PSIBLAST alignment of GI: 254780536 and protein with PDB id: 1mla

gi|157831981|pdb|1MLA|A Chain A, The Escherichia Coli Malonyl-Coa:acyl Carrier Protein Transacylase At 1.5-Angstroms Resolution. Crystal Structure Of A Fatty Acid Synthase Component Length = 309
 Score =  186 bits (472), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 128/311 (41%), Positives = 175/311 (56%), Gaps = 4/311 (1%)

Query: 1   MS-TVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATC 59
           M+     FPGQGSQ +GM  D+  S+P     F E    L  +L  L   G  EEL  T 
Sbjct: 1   MTQFAFVFPGQGSQTVGMLADMAASYPIVEETFAEASAALGYDLWALTQQGPAEELNKTW 60

Query: 60  NAQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRAR 119
             QPAL   S+A  RV ++ G       + +AGHSLGEY+AL  A     +D +RLV  R
Sbjct: 61  QTQPALLTASVALYRVWQQQGGKA---PAMMAGHSLGEYSALVCAGVIDFADAVRLVEMR 117

Query: 120 GKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVK 179
           GK MQEAVP G G+M AIIGLDD  +   C +A+   +    N N  GQVVI+G ++AV+
Sbjct: 118 GKFMQEAVPEGTGAMAAIIGLDDASIAKACEEAAEGQVVSPVNFNSPGQVVIAGHKEAVE 177

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            A   C   GAKRA+ LPVS P H +LM P +  +   L  +T   P VP++ N      
Sbjct: 178 RAGAACKAAGAKRALPLPVSVPSHCALMKPAADKLAVELAKITFNAPTVPVVNNVDVKCE 237

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
           ++ D I   LV Q+   V+W +++++ A  GV+ +YEVG GKVLTGL KRI  +L+A ++
Sbjct: 238 TNGDAIRDALVRQLYNPVQWTKSVEYMAAQGVEHLYEVGPGKVLTGLTKRIVDTLTASAL 297

Query: 300 SKVEDIDLALR 310
           ++   +  AL 
Sbjct: 298 NEPSAMAAALE 308