PSIBLAST alignment of GI: 254780536 and protein with PDB id: 2h1y

>gi|149241803|pdb|2H1Y|A Chain A, Crystal Structure Of Malonyl-Coa:acyl Carrier Protein Transacylase (Mcat) From Helicobacter Pylori Length = 321
>gi|149241804|pdb|2H1Y|B Chain B, Crystal Structure Of Malonyl-Coa:acyl Carrier Protein Transacylase (Mcat) From Helicobacter Pylori Length = 321
 Score =  132 bits (331), Expect = 8e-29,   Method: Composition-based stats.
 Identities = 94/312 (30%), Positives = 151/312 (48%), Gaps = 7/312 (2%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M   L FPGQGSQ IGMG+  Y+    A+ +FE   + L  ++   ++    E L  +  
Sbjct: 13  MQYALLFPGQGSQCIGMGKSFYEGHTLAKELFERASNALKVDMKKTLFE-ENELLKESAY 71

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
            QPA+  VS    +++ K          +  GHSLGE +A+  + A      ++L   RG
Sbjct: 72  TQPAIYLVSYIAYQLLNKQANG-GLKPVFALGHSLGEVSAVSLSGALDFEKALKLTHQRG 130

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           K MQEA      SM+ ++G+ +  + S+C +   V     AN NGG QVV++G++D +K 
Sbjct: 131 KMMQEACANKDASMMVVLGVSEESLLSLCQRTKNVWC---ANFNGGMQVVLAGVKDDLKA 187

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
              T    GAKR VFL +S   H   + P+    + +L+   K      I+ N       
Sbjct: 188 LEPTLKEMGAKRVVFLEMSVASHCPFLEPMIFKFQELLEKSLKDKFHFEIISNATNEAYH 247

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
           +  +   LL  Q+T  VR+++ ++   N  V   +E+G G VL GL KR   +   +S+ 
Sbjct: 248 NKAKAVELLSLQLTQPVRYQDCVKS-NNDRVDIFFELGCGSVLKGLNKR-LSNKPTISVG 305

Query: 301 KVEDIDLALRSI 312
             + +D A+  +
Sbjct: 306 DNKGLDEAIEFL 317