PSIBLAST alignment of GI: 254780536 and protein with PDB id: 3h0p

>gi|227343886|pdb|3H0P|A Chain A, 2.0 Angstrom Crystal Structure Of An Acyl Carrier Protein S- Malonyltransferase From Salmonella Typhimurium. Length = 312
>gi|227343887|pdb|3H0P|B Chain B, 2.0 Angstrom Crystal Structure Of An Acyl Carrier Protein S- Malonyltransferase From Salmonella Typhimurium Length = 312
 Score =  175 bits (442), Expect = 9e-42,   Method: Composition-based stats.
 Identities = 119/308 (38%), Positives = 165/308 (53%), Gaps = 3/308 (0%)

Query: 4   VLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQP 63
              FPGQGSQ +G   +   ++P     F E    L  +L  L   G  EEL  T   QP
Sbjct: 8   AFVFPGQGSQSVGXLAEXAANYPIVEETFAEASAALGYDLWALTQQGPAEELNKTWQTQP 67

Query: 64  ALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSM 123
           AL   S+A  RV ++ G       +  AGHSLGEY+AL  A   + +D +RLV  RGK  
Sbjct: 68  ALLTASVALWRVWQQQGGKX---PALXAGHSLGEYSALVCAGVINFADAVRLVEXRGKFX 124

Query: 124 QEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAAD 183
           QEAVP G G   AIIGLDD  +   C +++   +    N N  GQVVI+G ++AV+ A  
Sbjct: 125 QEAVPEGTGGXSAIIGLDDASIAKACEESAEGQVVSPVNFNSPGQVVIAGHKEAVERAGA 184

Query: 184 TCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSID 243
            C   GAKRA+ LPVS P H +L  P +  +   L  +T   P VP++ N      +   
Sbjct: 185 ACKAAGAKRALPLPVSVPSHCALXKPAADKLAVELAKITFSAPTVPVVNNVDVKCETDAA 244

Query: 244 EISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVE 303
            I   LV Q+   V+W +++++ A  GV+ +YEVG GKVLTGL KRI  +L+A ++++  
Sbjct: 245 AIRDALVRQLYNPVQWTKSVEFIAAQGVEHLYEVGPGKVLTGLTKRIVDTLTASALNEPA 304

Query: 304 DIDLALRS 311
            +  AL  
Sbjct: 305 ALSAALTQ 312