PSIBLAST alignment of GI: 254780536 and protein with PDB id: 3hjv

>gi|239782135|pdb|3HJV|A Chain A, 1.7 Angstrom Resolution Crystal Structure Of An Acyl Carrier Protein S-Malonyltransferase From Vibrio Cholerae O1 Biovar Eltor Str. N16961 Length = 312
>gi|239782136|pdb|3HJV|B Chain B, 1.7 Angstrom Resolution Crystal Structure Of An Acyl Carrier Protein S-Malonyltransferase From Vibrio Cholerae O1 Biovar Eltor Str. N16961 Length = 312
 Score =  182 bits (460), Expect = 9e-44,   Method: Composition-based stats.
 Identities = 117/307 (38%), Positives = 166/307 (54%), Gaps = 3/307 (0%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
              + FPGQGSQ +G   DL + +   +  F E    L  +L  L+ +G  E+L  T   
Sbjct: 8   KFAIVFPGQGSQAVGXLADLAEQYAVVKQTFAEASEVLGYDLWALVQDGPVEDLNQTFRT 67

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPAL A S+A  RV ++ GL      + +AGHSLGEY+AL  A        I+LV  RG+
Sbjct: 68  QPALLAASVAIWRVWQQLGL---EQPAVLAGHSLGEYSALVCAGVIDFKQAIKLVELRGQ 124

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCA 181
             Q+AVP G G+  AIIGL+D  +   CA A++  +    N N  GQVVI+G +DAV+ A
Sbjct: 125 LXQQAVPAGTGAXYAIIGLEDEAIAKACADAAQGEVVSPVNFNSPGQVVIAGQKDAVERA 184

Query: 182 ADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSS 241
              C   GAKRA+ LPVS P H +L  P +  +   L  +    P +P++ N      + 
Sbjct: 185 GVLCKEAGAKRALPLPVSVPSHCALXKPAADELAKTLAELEFNAPQIPVINNVDVVAETD 244

Query: 242 IDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISK 301
             +I   L+ Q+   VRW E ++  +  GV+ + E G GKVLTGL KRI K+L  V+++ 
Sbjct: 245 PVKIKDALIRQLYSPVRWTECVEQXSAQGVEKLIEXGPGKVLTGLTKRIVKTLEGVAVND 304

Query: 302 VEDIDLA 308
           V  +D  
Sbjct: 305 VASLDAV 311