PSIBLAST alignment of GI: 254780536 and protein with PDB id: 3qat

>gi|320089963|pdb|3QAT|A Chain A, Crystal Structure Of Acyl-Carrier-Protein-S-Malonyltransferase From Bartonella Henselae Length = 318
>gi|320089964|pdb|3QAT|B Chain B, Crystal Structure Of Acyl-Carrier-Protein-S-Malonyltransferase From Bartonella Henselae Length = 318
 Score =  184 bits (466), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 177/312 (56%), Positives = 229/312 (73%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M    TFPGQGSQ+IGMG+ L + F  AR+VFEEVD  L++ LSD+++ G  + LT T N
Sbjct: 5   MGAAFTFPGQGSQLIGMGKVLTEQFVAARMVFEEVDDALSEKLSDIIFEGPADVLTLTAN 64

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
           AQPAL AVSMA IRVME+ GL V++ + +VAGHSLGEY+ALCAA  FSL+DT RL+R RG
Sbjct: 65  AQPALMAVSMAVIRVMEQLGLNVEKKVKFVAGHSLGEYSALCAAGTFSLTDTARLLRIRG 124

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
            +MQ AV  G GSM A+IGLD+  V+ IC   +  G+C+IANDNGGGQ+VISG   AV+ 
Sbjct: 125 NAMQAAVAVGEGSMAALIGLDEKDVEEICEIVAEEGLCQIANDNGGGQIVISGEAKAVET 184

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A +    KGAKRAV LPVSAPFHS+LM P +  MK  L +V K  P+VP++ N    P S
Sbjct: 185 AVEVASQKGAKRAVLLPVSAPFHSALMQPAANAMKNALLTVNKTAPIVPLIANVSVIPES 244

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
             + I  LLV+QVTGRVRWRETI+W + +GV +++E+GSGKVLTGLA+RI+K + A+++ 
Sbjct: 245 DPERIVSLLVQQVTGRVRWRETIEWISANGVNTLFEIGSGKVLTGLARRINKDIKALTVG 304

Query: 301 KVEDIDLALRSI 312
             E+I+ ALR +
Sbjct: 305 TAEEIEAALRVL 316