BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780536|ref|YP_003064949.1| acyl-carrier-protein
S-malonyltransferase [Candidatus Liberibacter asiaticus str. psy62]
         (314 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done



>gi|254780536|ref|YP_003064949.1| acyl-carrier-protein S-malonyltransferase [Candidatus Liberibacter
           asiaticus str. psy62]
 gi|254040213|gb|ACT57009.1| acyl-carrier-protein S-malonyltransferase [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 314

 Score =  229 bits (582), Expect = 6e-58,   Method: Composition-based stats.
 Identities = 314/314 (100%), Positives = 314/314 (100%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN
Sbjct: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
           AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG
Sbjct: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC
Sbjct: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS
Sbjct: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
           SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS
Sbjct: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300

Query: 301 KVEDIDLALRSIVG 314
           KVEDIDLALRSIVG
Sbjct: 301 KVEDIDLALRSIVG 314


>gi|254473422|ref|ZP_05086819.1| malonyl CoA-acyl carrier protein transacylase [Pseudovibrio sp.
           JE062]
 gi|211957538|gb|EEA92741.1| malonyl CoA-acyl carrier protein transacylase [Pseudovibrio sp.
           JE062]
          Length = 317

 Score =  222 bits (565), Expect = 6e-56,   Method: Composition-based stats.
 Identities = 160/314 (50%), Positives = 220/314 (70%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M+   TFPGQGSQ +GMG++L D+FPEAR VFEEVD  L Q+L+ +MW G  +ELT T N
Sbjct: 1   MTIAFTFPGQGSQTVGMGKELADTFPEARAVFEEVDAALGQSLTKIMWEGPADELTLTAN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
            QPAL AVS+A +RV+E  G+ + +  S+VAGHSLGEY+AL AA + S++D  RL+R RG
Sbjct: 61  TQPALMAVSLATMRVLEAKGVDLSKAASFVAGHSLGEYSALAAAGSLSIADAARLLRIRG 120

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
            +MQ+AVP G G+M A++GLD      +  +A++  +C+ ANDN  GQVV+SG + AV+ 
Sbjct: 121 DAMQKAVPVGEGAMAALLGLDFDQAMEVAQEAAQGEVCQAANDNATGQVVVSGHKAAVER 180

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A +    KGA+RAV LPVSAPFH SLM P +  M   L  V  + P VP++ N  A+P++
Sbjct: 181 ACEIAKGKGARRAVLLPVSAPFHCSLMQPAADAMAKALAEVEIKAPAVPLVANVLAAPIT 240

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
             +EI   LVEQVTG VRWRE++ W A++GV ++ E+G+GKVLTG+ +RI KSL  V+++
Sbjct: 241 DPEEIRTRLVEQVTGTVRWRESVSWMADNGVTTLVEIGTGKVLTGMVRRIVKSLEGVAVN 300

Query: 301 KVEDIDLALRSIVG 314
             EDID  +  + G
Sbjct: 301 TAEDIDALVARLEG 314


>gi|110634120|ref|YP_674328.1| [Acyl-carrier-protein] S-malonyltransferase [Mesorhizobium sp.
           BNC1]
 gi|110285104|gb|ABG63163.1| [Acyl-carrier-protein] S-malonyltransferase [Chelativorans sp.
           BNC1]
          Length = 313

 Score =  221 bits (562), Expect = 1e-55,   Method: Composition-based stats.
 Identities = 182/313 (58%), Positives = 236/313 (75%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M+   TFPGQGSQ +GMGRDL ++FPEAR VF+EVD  L Q+LS LMW G +EELT T N
Sbjct: 1   MTIAFTFPGQGSQAVGMGRDLAEAFPEARDVFQEVDEALGQSLSKLMWEGPEEELTLTAN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
           AQPAL AVS+A IRVMEK GL +K  ++YVAGHSLGEY+AL AA  FSL DT RL+R RG
Sbjct: 61  AQPALMAVSLAAIRVMEKAGLPLKDKVAYVAGHSLGEYSALAAAGTFSLLDTARLLRIRG 120

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
            +MQ AVP G G+M AIIGL+   V+ +C +A+   +C+IANDNGGGQ++ISG + AV+ 
Sbjct: 121 NAMQAAVPVGEGAMAAIIGLETADVEDVCLKAANGSVCQIANDNGGGQLIISGAKAAVEE 180

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           AA     +GAKRA+ LPVSAPFHS+LM P +  M+  L  V K  P VP++ N   SP+S
Sbjct: 181 AARLAGERGAKRAIMLPVSAPFHSALMEPAAVRMRDALAEVEKHAPSVPVIANVTVSPLS 240

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
              EI+  LVEQVTGRVRWRET++WFA +GV ++YE+GSGKVLTGLA+RI++ L+A++++
Sbjct: 241 DPQEIAERLVEQVTGRVRWRETVEWFAQNGVDTLYEIGSGKVLTGLARRINRDLNALAVN 300

Query: 301 KVEDIDLALRSIV 313
              DI+  L++++
Sbjct: 301 TPADIEATLKALL 313


>gi|150395968|ref|YP_001326435.1| malonyl CoA-acyl carrier protein transacylase [Sinorhizobium
           medicae WSM419]
 gi|150027483|gb|ABR59600.1| malonyl CoA-acyl carrier protein transacylase [Sinorhizobium
           medicae WSM419]
          Length = 314

 Score =  220 bits (560), Expect = 2e-55,   Method: Composition-based stats.
 Identities = 186/313 (59%), Positives = 238/313 (76%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           MS   TFPGQGSQ +GMG+DL ++FPEA  VF EVD  L + LS +MW+G +E LT T N
Sbjct: 1   MSIAFTFPGQGSQAVGMGKDLAEAFPEAAAVFAEVDEALGEKLSHIMWDGPEETLTLTAN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
           AQPAL AVSMA IRV+E  GL +   +S+VAGHSLGEY+ALCAA  FSL+DT RL+R RG
Sbjct: 61  AQPALMAVSMAVIRVLESRGLDIGSKVSFVAGHSLGEYSALCAAGTFSLADTARLLRIRG 120

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
            +MQ AVP G G+M AIIGL+   V++IC ++S +G C+IANDNGGGQ+VISG + AV+ 
Sbjct: 121 NAMQAAVPVGKGAMAAIIGLEHADVEAICRESSSLGSCQIANDNGGGQLVISGEKPAVEK 180

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           AA     KGAKRA+ LPVSAPFHS+LMTP ++ M+  L +V K DPVVP++ N  A+PV 
Sbjct: 181 AAALATEKGAKRALMLPVSAPFHSALMTPAAEAMREALATVGKHDPVVPVVANVLAAPVR 240

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
              EI+RLLVEQVTG VRWRET++WFA + V ++YE+GSGKVLTGLA+RIDKS++ ++++
Sbjct: 241 DAVEIARLLVEQVTGPVRWRETVEWFAANDVTTLYEIGSGKVLTGLARRIDKSVTGIAVN 300

Query: 301 KVEDIDLALRSIV 313
              DID  L  ++
Sbjct: 301 SPADIDAVLAVLL 313


>gi|118588142|ref|ZP_01545552.1| acyl-carrier-protein S-malonyltransferase [Stappia aggregata IAM
           12614]
 gi|118439764|gb|EAV46395.1| acyl-carrier-protein S-malonyltransferase [Stappia aggregata IAM
           12614]
          Length = 314

 Score =  218 bits (556), Expect = 6e-55,   Method: Composition-based stats.
 Identities = 157/314 (50%), Positives = 213/314 (67%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M+   TFPGQGSQ +GMG+ L D+FPEA+ VF+EVD  L Q LSD+MW G +E LT T N
Sbjct: 1   MTIAFTFPGQGSQGVGMGKALADAFPEAKAVFDEVDEALGQKLSDVMWTGPEETLTLTAN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
           AQPAL AVS+A +RV+E  GL +   +S+VAGHSLGEY+AL AA +  ++   +L+R RG
Sbjct: 61  AQPALMAVSLAAMRVLEARGLDLAGSVSFVAGHSLGEYSALAAAGSLDIATAAKLLRVRG 120

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
            +MQ AVP G G+M A++GL+  V   +   A++  +C+ ANDN  GQVV+SG   AV+ 
Sbjct: 121 DAMQNAVPVGQGAMAALLGLEFDVAVEVAEAAAQGEVCQAANDNAPGQVVVSGHLAAVER 180

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A +    KGA+RAV LPVSAPFH SLM P ++ M   L +   + P VP++ N  A P++
Sbjct: 181 AVEIAKAKGARRAVMLPVSAPFHCSLMGPAAEKMAEALANAEIRSPAVPLVANVLARPIT 240

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
             +EI   LV+QVTG VRWRE+I W A +GV +  E+G+GKVLTG+ KRI K  + ++++
Sbjct: 241 DANEIRDRLVQQVTGTVRWRESITWLAENGVDTFVEIGTGKVLTGMVKRIAKEATGMAVN 300

Query: 301 KVEDIDLALRSIVG 314
             EDID  +  I G
Sbjct: 301 SPEDIDSLMEKISG 314


>gi|222085441|ref|YP_002543971.1| malonyl CoA-acyl carrier protein transacylase [Agrobacterium
           radiobacter K84]
 gi|221722889|gb|ACM26045.1| malonyl CoA-acyl carrier protein transacylase [Agrobacterium
           radiobacter K84]
          Length = 313

 Score =  216 bits (549), Expect = 4e-54,   Method: Composition-based stats.
 Identities = 183/313 (58%), Positives = 243/313 (77%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M+   TFPGQGSQ +GMG+DL D+F EAR VFEEVD  L + LSD+++NG +++LT T N
Sbjct: 1   MTVAFTFPGQGSQTVGMGKDLADNFAEARAVFEEVDEALGEKLSDVIFNGPEDKLTLTAN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
           AQPAL AVS+A IRV++  GL +K  ++YVAGHSLGEY+ALCAA  FSL+DT RL+R RG
Sbjct: 61  AQPALMAVSIAVIRVLQARGLDLKSKVAYVAGHSLGEYSALCAAGTFSLADTARLLRIRG 120

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
            +MQ AVP G+G+M AIIGL+   V ++C +AS +G C+IANDNGGGQ+VISG +  V+ 
Sbjct: 121 NAMQAAVPVGVGAMAAIIGLEHADVVAVCTEASVLGACQIANDNGGGQIVISGEKAPVEK 180

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           AA+    KGAKRA+ LPVSAPFHSSLM P ++ M+  L  V K +P+VP++ N  A+PV+
Sbjct: 181 AAELATAKGAKRAILLPVSAPFHSSLMAPAAEAMRVALADVAKSNPIVPLIANVRAAPVT 240

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
              EI+ LLVEQVTG+VRWRET++WFA H V ++YE+G+GKVLTGLA+RIDKS++ ++++
Sbjct: 241 DAGEIANLLVEQVTGQVRWRETVEWFAAHNVTTLYEIGAGKVLTGLARRIDKSVNGIAVN 300

Query: 301 KVEDIDLALRSIV 313
              DID AL S++
Sbjct: 301 SAADIDTALASLL 313


>gi|312879970|ref|ZP_07739770.1| (Acyl-carrier-protein) S-malonyltransferase [Aminomonas paucivorans
           DSM 12260]
 gi|310783261|gb|EFQ23659.1| (Acyl-carrier-protein) S-malonyltransferase [Aminomonas paucivorans
           DSM 12260]
          Length = 315

 Score =  216 bits (549), Expect = 4e-54,   Method: Composition-based stats.
 Identities = 133/314 (42%), Positives = 190/314 (60%), Gaps = 1/314 (0%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M+  L FPGQG+Q +GMGR  YD+ P AR VF+EVD  L  +LS +++ G +EEL  T  
Sbjct: 1   MTYALVFPGQGAQEVGMGRGFYDACPAARRVFDEVDEALGFSLSRVIFQGPEEELRKTAL 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
            QPA+  VS+A +  + +    +  + ++VAGHSLGEYTAL AA   S+ D  RLV  RG
Sbjct: 61  TQPAILTVSIAILEALREE-WNLSLEPAFVAGHSLGEYTALVAAGTLSVQDGARLVHLRG 119

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
             MQ AVP G GSM A++GLD   +  +CA+ S +G+CE+AN N  GQ+V+SG   AV+ 
Sbjct: 120 DRMQHAVPLGEGSMAAVLGLDAEAIREVCAEVSALGVCELANYNAPGQIVLSGQVQAVER 179

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A +    +GA + + L VSAPFH +LM PV++ ++   +      P  P+L N  A+P +
Sbjct: 180 AQELAKERGAAKVIPLKVSAPFHCALMRPVAEELERAFEGALWSPPRWPVLANVDAAPKT 239

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
            +  I + L  Q    V W E ++  A+ GV++  E+G G VL+GLAKR  K    +S+S
Sbjct: 240 DVLSIRKALYAQTYSPVLWAEEVRAMADQGVQAFVEIGPGNVLSGLAKRCVKGTKTLSVS 299

Query: 301 KVEDIDLALRSIVG 314
           K ED+   L  + G
Sbjct: 300 KPEDVPGLLAFLEG 313


>gi|15964894|ref|NP_385247.1| acyl-carrier-protein S-malonyltransferase [Sinorhizobium meliloti
           1021]
 gi|9587284|gb|AAF89245.1|AF284419_1 malonyl-CoA:acyl carrier protein transacylase [Sinorhizobium
           meliloti]
 gi|15074073|emb|CAC45720.1| Probable malonyl CoA-acyl carrier protein transacylase
           [Sinorhizobium meliloti 1021]
          Length = 314

 Score =  215 bits (547), Expect = 6e-54,   Method: Composition-based stats.
 Identities = 191/313 (61%), Positives = 243/313 (77%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           MS   TFPGQGSQ +GMG+DL ++FPEA  VF EVD  L++ LSD+MWNG +E LT T N
Sbjct: 1   MSIAFTFPGQGSQAVGMGKDLAEAFPEAAAVFAEVDDALSEKLSDIMWNGPEETLTLTAN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
           AQPAL AVSMA IRV+E  GL +K  +S+VAGHSLGEY+ALCAA  FSL+DT RL+R RG
Sbjct: 61  AQPALMAVSMAVIRVLEAKGLDLKSKVSFVAGHSLGEYSALCAAGTFSLADTARLLRIRG 120

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
            +MQ AVP G G+M AIIGL+   V+++C  AS  G C+IANDNGGGQ+VISG + AV+ 
Sbjct: 121 NAMQAAVPVGKGAMAAIIGLEHDDVEAVCRDASSFGSCQIANDNGGGQLVISGEKPAVEK 180

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           AA     KGAKRA+ LPVSAPFHS+LMTP ++ M+  L +V K+DPVVP++ N  A+PVS
Sbjct: 181 AAALASEKGAKRALMLPVSAPFHSALMTPAAEAMRKALATVEKRDPVVPVVANVLAAPVS 240

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
              EI+RLLVEQVTG+VRWRET++WFA H V ++YE+GSGKVLTGLA+RIDK+++ ++++
Sbjct: 241 DAGEIARLLVEQVTGQVRWRETVEWFAAHEVTTLYEIGSGKVLTGLARRIDKTVTGIAVN 300

Query: 301 KVEDIDLALRSIV 313
              DID AL  ++
Sbjct: 301 SPADIDAALAVLL 313


>gi|307300965|ref|ZP_07580734.1| malonyl CoA-acyl carrier protein transacylase [Sinorhizobium
           meliloti BL225C]
 gi|306903920|gb|EFN34506.1| malonyl CoA-acyl carrier protein transacylase [Sinorhizobium
           meliloti BL225C]
          Length = 314

 Score =  215 bits (547), Expect = 6e-54,   Method: Composition-based stats.
 Identities = 190/313 (60%), Positives = 243/313 (77%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           MS   TFPGQGSQ +GMG+DL ++FPEA  VF EVD  L++ LSD++WNG +E LT T N
Sbjct: 1   MSIAFTFPGQGSQAVGMGKDLAEAFPEAAAVFAEVDDALSEKLSDIIWNGPEETLTLTAN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
           AQPAL AVSMA IRV+E  GL +K  +S+VAGHSLGEY+ALCAA  FSL+DT RL+R RG
Sbjct: 61  AQPALMAVSMAVIRVLEAKGLDLKSKVSFVAGHSLGEYSALCAAGTFSLADTARLLRIRG 120

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
            +MQ AVP G G+M AIIGL+   V+++C  AS  G C+IANDNGGGQ+VISG + AV+ 
Sbjct: 121 NAMQAAVPVGKGAMAAIIGLEHDDVEAVCRDASSFGSCQIANDNGGGQLVISGEKPAVEK 180

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           AA     KGAKRA+ LPVSAPFHS+LMTP ++ M+  L +V K+DPVVP++ N  A+PVS
Sbjct: 181 AAALASEKGAKRALMLPVSAPFHSALMTPAAEAMRKALATVEKRDPVVPVVANVLAAPVS 240

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
              EI+RLLVEQVTG+VRWRET++WFA H V ++YE+GSGKVLTGLA+RIDK+++ ++++
Sbjct: 241 DAGEIARLLVEQVTGQVRWRETVEWFAAHEVTTLYEIGSGKVLTGLARRIDKTVTGIAVN 300

Query: 301 KVEDIDLALRSIV 313
              DID AL  ++
Sbjct: 301 SPADIDAALAVLL 313


>gi|147678078|ref|YP_001212293.1| (acyl-carrier-protein) S-malonyltransferase [Pelotomaculum
           thermopropionicum SI]
 gi|146274175|dbj|BAF59924.1| (acyl-carrier-protein) S-malonyltransferase [Pelotomaculum
           thermopropionicum SI]
          Length = 313

 Score =  215 bits (547), Expect = 7e-54,   Method: Composition-based stats.
 Identities = 134/314 (42%), Positives = 183/314 (58%), Gaps = 4/314 (1%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M     FPGQGSQ +GMGR+LY SF EA+ VF+  D  L   +S L + G ++EL  T N
Sbjct: 1   MKVAFVFPGQGSQYVGMGRELYSSFSEAKEVFKRADEALGFPISSLCFEGPEDELNKTVN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
            QPA+  VS+A + V++  G  V    + VAGHSLGEYTAL AA + +  D +RLV  RG
Sbjct: 61  TQPAVLTVSVACLEVLKVKGGGV---PAAVAGHSLGEYTALVAAGSLTFEDAVRLVHKRG 117

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           + MQEAVP G G M A++GL    V  +C +AS  GI E  N N   QVV++G    +K 
Sbjct: 118 RYMQEAVPLGKGGMAAVLGLSAEAVAEVCRKASSEGIVEPVNLNCPCQVVVAGDIAGLKA 177

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A       GA+R + LPVSAPFHSSLM P  + +   L  V   DP +P++ N  A  V 
Sbjct: 178 AELLSKEAGARRFISLPVSAPFHSSLMKPAGERLAMDLAEVVVGDPAIPVVANVSADFVH 237

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
           +  E+   L+ QV   VRW E+I    + G+ +  EVG GKVL+GL K+I + +S  +I 
Sbjct: 238 TGKEVKEALIRQVYSPVRWEESILRLISSGINTFVEVGPGKVLSGLIKKISREVSVYNIE 297

Query: 301 KVEDIDLALRSIVG 314
             + ++  L ++ G
Sbjct: 298 DKDSLEKVL-ALTG 310


>gi|307322235|ref|ZP_07601603.1| malonyl CoA-acyl carrier protein transacylase [Sinorhizobium
           meliloti AK83]
 gi|306892122|gb|EFN22940.1| malonyl CoA-acyl carrier protein transacylase [Sinorhizobium
           meliloti AK83]
          Length = 314

 Score =  215 bits (546), Expect = 9e-54,   Method: Composition-based stats.
 Identities = 191/313 (61%), Positives = 243/313 (77%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           MS   TFPGQGSQ +GMG+DL ++FPEA  VF EVD  L + LSD+MWNG +E LT T N
Sbjct: 1   MSIAFTFPGQGSQAVGMGKDLAEAFPEAAAVFAEVDDALGEKLSDIMWNGPEETLTLTAN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
           AQPAL AVSMA IRV+E  GL +K  +S+VAGHSLGEY+ALCAA  FSL+DT RL+R RG
Sbjct: 61  AQPALMAVSMAVIRVLEAKGLDLKSKVSFVAGHSLGEYSALCAAGTFSLADTARLLRIRG 120

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
            +MQ AVP G G+M AIIGL+   V+++C  AS +G C+IANDNGGGQ+VISG + AV+ 
Sbjct: 121 NAMQAAVPVGKGAMAAIIGLEHDDVEAVCRDASSLGSCQIANDNGGGQLVISGEKPAVEK 180

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           AA     KGAKRA+ LPVSAPFHS+LMTP ++ M+  L +V K+DPVVP++ N  A+PVS
Sbjct: 181 AAALASEKGAKRALMLPVSAPFHSALMTPAAEAMRKALATVEKRDPVVPVVANVLAAPVS 240

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
              EI+RLLVEQVTG+VRWRET++WFA H V ++YE+GSGKVLTGLA+RIDK+++ ++++
Sbjct: 241 DAGEIARLLVEQVTGQVRWRETVEWFAAHEVTTLYEIGSGKVLTGLARRIDKTVTGIAVN 300

Query: 301 KVEDIDLALRSIV 313
              DID AL  ++
Sbjct: 301 SATDIDAALAVLL 313


>gi|254502650|ref|ZP_05114801.1| malonyl CoA-acyl carrier protein transacylase [Labrenzia alexandrii
           DFL-11]
 gi|222438721|gb|EEE45400.1| malonyl CoA-acyl carrier protein transacylase [Labrenzia alexandrii
           DFL-11]
          Length = 314

 Score =  214 bits (545), Expect = 1e-53,   Method: Composition-based stats.
 Identities = 161/312 (51%), Positives = 215/312 (68%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M+T  TFPGQGSQ +GMG+ L D+FPEAR VF+EVD  L+Q LSD+MWNG + +LT T N
Sbjct: 1   MTTAFTFPGQGSQAVGMGKLLADTFPEARAVFDEVDDALDQKLSDIMWNGPEGDLTLTAN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
           AQPAL AVS+A +RV+E  GL +K  +S+VAGHSLGEY+AL AA +  ++   +L+R RG
Sbjct: 61  AQPALMAVSLATMRVLEAKGLDLKASVSFVAGHSLGEYSALAAAGSLDVATAAKLLRVRG 120

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
            +MQ AVP G G+M A++GLD      I   A++  +C+ ANDN  GQVV+SG   AV+ 
Sbjct: 121 NAMQNAVPVGQGAMAALLGLDFEAAAEIAKDAAQGEVCQAANDNAPGQVVVSGHVAAVER 180

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A +    +GA+RAV LPVSAPFH SLM P ++ M   L +   + PVVP++ N  A+P++
Sbjct: 181 AVEIAKARGARRAVLLPVSAPFHCSLMGPAAEAMAEALTNADIKAPVVPLVANVLATPIT 240

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
              +I   LVEQVTG VRWRE+I W A  GV +  EVG+GKVLTG+ KRI K  S ++I+
Sbjct: 241 DPVDIRDRLVEQVTGTVRWRESISWLAGEGVDTFVEVGTGKVLTGMVKRIAKEASGMAIN 300

Query: 301 KVEDIDLALRSI 312
             +DID  +  +
Sbjct: 301 SPDDIDAVIEKL 312


>gi|315122865|ref|YP_004063354.1| acyl-carrier-protein S-malonyltransferase [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313496267|gb|ADR52866.1| acyl-carrier-protein S-malonyltransferase [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 314

 Score =  214 bits (544), Expect = 2e-53,   Method: Composition-based stats.
 Identities = 259/314 (82%), Positives = 287/314 (91%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M+ VLTFPGQGSQ++GMGRDL +SFPEARLVFEEVDHTLNQ+LSDLMWNG QEELT T N
Sbjct: 1   MAIVLTFPGQGSQIVGMGRDLCESFPEARLVFEEVDHTLNQHLSDLMWNGPQEELTVTYN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
           AQPALTAVSMAFIRVMEKNGLC +RDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG
Sbjct: 61  AQPALTAVSMAFIRVMEKNGLCFERDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           KSMQEAVPPGLG M AIIGLDD  V+  C QAS++GIC+IANDNGGGQ+VISG+QDAVKC
Sbjct: 121 KSMQEAVPPGLGGMAAIIGLDDRAVEFACEQASKIGICQIANDNGGGQIVISGMQDAVKC 180

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A D+CL KGA+RAVFLPVSAPFHSSLM PVSKVM+ ML  + KQDPVVP+LPN CASPVS
Sbjct: 181 AVDSCLEKGARRAVFLPVSAPFHSSLMAPVSKVMQNMLGDIQKQDPVVPVLPNVCASPVS 240

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
            IDEIS+LLVEQVT RVRWRETIQWFANHG+  +YE+GSGKVLTGLAKRIDKS+SA+S+ 
Sbjct: 241 DIDEISKLLVEQVTARVRWRETIQWFANHGMTHIYEIGSGKVLTGLAKRIDKSISAISVD 300

Query: 301 KVEDIDLALRSIVG 314
           K+E+IDLAL +I+G
Sbjct: 301 KIENIDLALETIIG 314


>gi|258514465|ref|YP_003190687.1| malonyl CoA-acyl carrier protein transacylase [Desulfotomaculum
           acetoxidans DSM 771]
 gi|257778170|gb|ACV62064.1| malonyl CoA-acyl carrier protein transacylase [Desulfotomaculum
           acetoxidans DSM 771]
          Length = 312

 Score =  212 bits (539), Expect = 6e-53,   Method: Composition-based stats.
 Identities = 131/314 (41%), Positives = 193/314 (61%), Gaps = 4/314 (1%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           MS    FPGQGSQ +GM R  YD++   R +F+  D  L  ++S+L + G +E L  T N
Sbjct: 1   MSLAFVFPGQGSQYVGMCRQFYDNYQVVRDIFDLADKALAFSISELCFQGPEELLGQTEN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
            QPA+   S+A   V+ + G+        +AGHSLGEY+AL AA A S SD +++VR RG
Sbjct: 61  TQPAVLTASIACQAVLLEAGIA----PEALAGHSLGEYSALVAAGALSFSDAVQIVRKRG 116

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           + MQ+AVPPG G+M AI+GLD  ++  +C  AS +G+ E+AN N  GQ+VI+G   A++ 
Sbjct: 117 QLMQQAVPPGGGAMAAILGLDAGMLQEVCKHASDLGMVEVANYNCPGQLVIAGSAAALEK 176

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A       GAKRA+ L VS PFHS+LM P ++ +   L+ ++  +P + ++ N  A  V+
Sbjct: 177 AIVLAKEAGAKRAIKLVVSGPFHSALMFPAAEKLGRELEQISIIEPKLRLVANISADYVT 236

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
           + ++I   LV QV G VRW E +Q   N G+ +  EVG GKVL+GL K+IDK ++  ++ 
Sbjct: 237 TAEQIKDCLVRQVYGPVRWIEVVQKMINDGIDTFVEVGPGKVLSGLIKKIDKRVNIYNVE 296

Query: 301 KVEDIDLALRSIVG 314
               ++ AL S+ G
Sbjct: 297 DQPSLEKALASLKG 310


>gi|209548659|ref|YP_002280576.1| malonyl CoA-acyl carrier protein transacylase [Rhizobium
           leguminosarum bv. trifolii WSM2304]
 gi|209534415|gb|ACI54350.1| malonyl CoA-acyl carrier protein transacylase [Rhizobium
           leguminosarum bv. trifolii WSM2304]
          Length = 314

 Score =  212 bits (538), Expect = 7e-53,   Method: Composition-based stats.
 Identities = 183/312 (58%), Positives = 242/312 (77%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M+   TFPGQGSQ +GMG+DL ++F EAR VF+EVD  L + LSD+M+NG +E LT T N
Sbjct: 1   MTIAFTFPGQGSQAVGMGKDLAENFAEARAVFDEVDEALGEKLSDVMFNGPEETLTLTAN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
           AQPAL AVS+A +R++E  GL +K  ++YVAGHSLGEY+ALCAA  FSL+DT RL+R RG
Sbjct: 61  AQPALMAVSIAVVRILEAKGLDLKSKVAYVAGHSLGEYSALCAAGTFSLADTARLLRIRG 120

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
            +MQ AVP G+G+M AIIGL+   V ++C +A+  G C+IANDNGGGQ+VISG + AV+ 
Sbjct: 121 NAMQAAVPVGVGAMAAIIGLEHADVVAVCEEAAATGACQIANDNGGGQIVISGEKAAVEK 180

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           AA    +KGAKRA+ LPVSAPFHS LM P +  M+  L  V K DPVVP++ N  A+PV+
Sbjct: 181 AAGLATDKGAKRAILLPVSAPFHSKLMAPAADAMREALAKVAKSDPVVPVIANVRAAPVT 240

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
           + DEI+ LLVEQVTG+VRWRET++WFA +GV ++YE+GSGKVLTGLA+RIDK+++ +S++
Sbjct: 241 TADEIASLLVEQVTGQVRWRETVEWFAGNGVTTLYELGSGKVLTGLARRIDKTINGISVN 300

Query: 301 KVEDIDLALRSI 312
              DID A+ ++
Sbjct: 301 GPADIDAAVAAL 312


>gi|319784435|ref|YP_004143911.1| malonyl CoA-acyl carrier protein transacylase [Mesorhizobium ciceri
           biovar biserrulae WSM1271]
 gi|317170323|gb|ADV13861.1| malonyl CoA-acyl carrier protein transacylase [Mesorhizobium ciceri
           biovar biserrulae WSM1271]
          Length = 313

 Score =  211 bits (536), Expect = 1e-52,   Method: Composition-based stats.
 Identities = 172/313 (54%), Positives = 230/313 (73%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M+   TFPGQGSQ +GMG+DL ++FPEAR +F+EVD  L +NLS L+W G +E L  T N
Sbjct: 1   MAVAFTFPGQGSQAVGMGKDLAEAFPEARRIFQEVDDALGENLSKLIWEGPEETLMLTAN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
           AQPAL AVS+A IR +E  G  +K  ++YVAGHSLGEY+AL AA   S++D  RL+R RG
Sbjct: 61  AQPALMAVSLAAIRALESRGFSLKGKVAYVAGHSLGEYSALAAAGFVSVADAARLLRIRG 120

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
            +MQ AVP G G+M AIIGL+   V++ CA+A++  +C+IANDNGGGQ+VISG + AV+ 
Sbjct: 121 NAMQAAVPAGEGAMAAIIGLEQADVEAACAEAAKGSVCQIANDNGGGQLVISGARAAVEL 180

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           AA  C  KGAKRA+ L VSAPFHS+LM P + VM+  L  VTK  PVVP+L N   SP S
Sbjct: 181 AAKLCTEKGAKRALMLQVSAPFHSALMAPAANVMRDALAGVTKNAPVVPVLSNVTVSPTS 240

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
             DEI+R LVEQ+TGRVRWRET++WF  +GV ++YE+G+GKVL+GLA+RI++ ++  S+ 
Sbjct: 241 DPDEIARRLVEQITGRVRWRETVEWFGANGVTTLYEIGAGKVLSGLARRINRDIATASVG 300

Query: 301 KVEDIDLALRSIV 313
              +++  L ++ 
Sbjct: 301 SAAEVEATLAALA 313


>gi|13476513|ref|NP_108083.1| acyl-carrier-protein S-malonyltransferase [Mesorhizobium loti
           MAFF303099]
 gi|14027274|dbj|BAB54228.1| malonyl CoA-acyl carrier protein transacylase [Mesorhizobium loti
           MAFF303099]
          Length = 315

 Score =  211 bits (536), Expect = 1e-52,   Method: Composition-based stats.
 Identities = 172/315 (54%), Positives = 229/315 (72%), Gaps = 2/315 (0%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M+   TFPGQGSQ +GMG+DL D+FPEAR VF+EVD  L +NLS L+W G +E LT T N
Sbjct: 1   MAVAFTFPGQGSQAVGMGKDLADAFPEARRVFQEVDDALGENLSKLIWEGPEETLTLTAN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
           AQPAL AVS+A IR +E  G  +K  ++YVAGHSLGEY+AL AA   S++D  RL+R RG
Sbjct: 61  AQPALMAVSLAAIRALEARGFSLKDKVAYVAGHSLGEYSALAAAGFVSVADAARLLRIRG 120

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRV--GICEIANDNGGGQVVISGLQDAV 178
            +MQ AVP G G+M AIIGL+   V++ C +A++    +C+IANDNGGGQ+VISG + AV
Sbjct: 121 NAMQAAVPAGEGAMAAIIGLEQPDVEAACIEAAQGASKVCQIANDNGGGQLVISGAKAAV 180

Query: 179 KCAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASP 238
           + AA  C  KGAKRA+ L VSAPFHS+LM P + VM+  L  VTK  P VP++ N   +P
Sbjct: 181 ELAAKLCTEKGAKRALMLQVSAPFHSALMAPAANVMREALAGVTKHAPGVPVVSNVTVTP 240

Query: 239 VSSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVS 298
            S  DEI+R LVEQ+TGRVRWRET++WF  +GV ++YE+G+GKVL+GLA+RI++ ++  +
Sbjct: 241 TSDPDEIARRLVEQITGRVRWRETVEWFGANGVTTLYEIGAGKVLSGLARRINRDIATSA 300

Query: 299 ISKVEDIDLALRSIV 313
           +    D++ AL +  
Sbjct: 301 VGTPADVEAALATFA 315


>gi|260466961|ref|ZP_05813143.1| malonyl CoA-acyl carrier protein transacylase [Mesorhizobium
           opportunistum WSM2075]
 gi|259029258|gb|EEW30552.1| malonyl CoA-acyl carrier protein transacylase [Mesorhizobium
           opportunistum WSM2075]
          Length = 312

 Score =  210 bits (534), Expect = 2e-52,   Method: Composition-based stats.
 Identities = 176/312 (56%), Positives = 232/312 (74%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M+   TFPGQGSQ +GMG+DL DSFPEAR VF+EVD  L +NLS L+W G +E LT T N
Sbjct: 1   MAVAFTFPGQGSQAVGMGKDLADSFPEARRVFQEVDDALGENLSKLIWEGPEEALTLTAN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
           AQPAL AVS+A IR +E  G  +K  ++YVAGHSLGEY+AL AA   S+ D  RL+R RG
Sbjct: 61  AQPALMAVSLAAIRALESRGFSLKDKVAYVAGHSLGEYSALAAAGFVSVGDAARLLRIRG 120

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
            +MQ AVPPG G+M AIIGL+   V++ CA+A++  +C++ANDNGGGQ+VISG + AV+ 
Sbjct: 121 NAMQAAVPPGEGAMAAIIGLEQADVEAACAEAAKGSVCQVANDNGGGQLVISGAKAAVEL 180

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           AA  C+ KGAKRA+ L VSAPFHS+LMTP +++M+  L  V K  PVVPI+ N   +P S
Sbjct: 181 AARLCIEKGAKRALMLQVSAPFHSALMTPAAEIMRDALAEVAKAAPVVPIVSNVTVTPTS 240

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
             DEISR LVEQV  RVRWRET++WF  +GV ++YE+G+GKVL+GLA+RI++ ++  S+ 
Sbjct: 241 DPDEISRRLVEQVVARVRWRETVEWFGANGVTALYEIGAGKVLSGLARRINRDIATASVG 300

Query: 301 KVEDIDLALRSI 312
              D++ AL ++
Sbjct: 301 AAVDVEAALAAL 312


>gi|108762809|ref|YP_632933.1| malonyl CoA-acyl carrier protein transacylase [Myxococcus xanthus
           DK 1622]
 gi|108466689|gb|ABF91874.1| malonyl CoA-acyl carrier protein transacylase [Myxococcus xanthus
           DK 1622]
          Length = 313

 Score =  210 bits (533), Expect = 3e-52,   Method: Composition-based stats.
 Identities = 138/311 (44%), Positives = 180/311 (57%), Gaps = 4/311 (1%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
                FPGQGSQ +GMG+DLY+ FPEAR VF+ VD  L + LS L + G  E L  T N 
Sbjct: 3   KVAFVFPGQGSQAVGMGKDLYEKFPEARAVFDAVDAALGEKLSTLCFEGPDEALKLTANT 62

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPA+  VS+A   V  K G       S+VAGHSLGEY+AL AA A  L D +R+VRARG 
Sbjct: 63  QPAILTVSLAAHAVFAKRG----PAPSFVAGHSLGEYSALVAAGAMDLGDAVRVVRARGT 118

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCA 181
            MQEAVP G+G+M A++GL    V + C  A+   +   AN N   Q VI+G   AV+ A
Sbjct: 119 FMQEAVPAGVGAMAAVLGLVPEKVKAACDAAAEGQVVSPANYNSPEQTVIAGDAAAVERA 178

Query: 182 ADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSS 241
              C   GAKR + LPVSAPFH +LM PV   +  +L  +    P VP++ N  A P + 
Sbjct: 179 GVKCKEAGAKRVMPLPVSAPFHCALMAPVQPRLAEVLGGIQVSAPSVPVVTNVEARPNAD 238

Query: 242 IDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISK 301
              +  LL+EQV+  VRW E ++     GV  + E+G GKVL GL KRI K +   ++  
Sbjct: 239 ASRVVPLLLEQVSSPVRWIECVEALKAEGVTRIIELGPGKVLVGLVKRITKDIELFNVED 298

Query: 302 VEDIDLALRSI 312
              +D AL ++
Sbjct: 299 SASLDKALAAL 309


>gi|325292473|ref|YP_004278337.1| malonyl-CoA:acyl carrier protein transacylase [Agrobacterium sp.
           H13-3]
 gi|325060326|gb|ADY64017.1| malonyl-CoA:acyl carrier protein transacylase [Agrobacterium sp.
           H13-3]
          Length = 314

 Score =  210 bits (533), Expect = 3e-52,   Method: Composition-based stats.
 Identities = 187/314 (59%), Positives = 242/314 (77%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M    TFPGQGSQ IGMG++L D++PEAR VF+EVD  L Q LSD+MWNG +E LT T N
Sbjct: 1   MGIAFTFPGQGSQAIGMGKELADTYPEARAVFQEVDDALGQKLSDIMWNGPEETLTLTAN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
           AQPAL AVSMA +RV+E  GL +   +SYVAGHSLGEY+ALCAA  FS++DT RL+R RG
Sbjct: 61  AQPALMAVSMAVMRVLEARGLKLSDAVSYVAGHSLGEYSALCAAGTFSIADTARLLRIRG 120

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
            +MQ AVP G G+M AIIGL+   V +IC +A+ +G+C+IANDNGGGQ+VISG + AV+ 
Sbjct: 121 NAMQAAVPVGEGAMAAIIGLEHDAVSAICEEAAILGVCQIANDNGGGQLVISGGKAAVEK 180

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           AA     KGAKRA+ LPVSAPFHS+LM P ++ M+  L +V K +PVVP++ N  A+PVS
Sbjct: 181 AAAIASEKGAKRAIMLPVSAPFHSALMAPAAEAMREALAAVEKNNPVVPVIANVRAAPVS 240

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
             +EI+ LLVEQVTG+VRWRET++WFA + V  +YE+GSGKVLTGLA+RIDK+++ V+++
Sbjct: 241 DANEIAALLVEQVTGQVRWRETVEWFAANNVTQLYEIGSGKVLTGLARRIDKTVNGVAVN 300

Query: 301 KVEDIDLALRSIVG 314
              DID  L +++G
Sbjct: 301 GAADIDQLLATLIG 314


>gi|15888434|ref|NP_354115.1| malonyl-CoA:acyl carrier protein transacylase [Agrobacterium
           tumefaciens str. C58]
 gi|15156124|gb|AAK86900.1| malonyl-CoA:acyl carrier protein transacylase [Agrobacterium
           tumefaciens str. C58]
          Length = 331

 Score =  210 bits (533), Expect = 3e-52,   Method: Composition-based stats.
 Identities = 186/314 (59%), Positives = 241/314 (76%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M    TFPGQGSQ +GMG++L D++PEAR VF+EVD  L+Q LSD+MWNG +E LT T N
Sbjct: 18  MGIAFTFPGQGSQAVGMGKELADTYPEARAVFQEVDDALDQKLSDIMWNGPEETLTLTAN 77

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
           AQPAL AVSMA +RV+E  GL +   +SYVAGHSLGEY+ALCAA  FS++DT RL+R RG
Sbjct: 78  AQPALMAVSMAVMRVLEARGLKLSDTVSYVAGHSLGEYSALCAAGTFSIADTARLLRIRG 137

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
            +MQ AVP G G+M AIIGL+   V +IC +A  +G+C+IANDNGGGQ+VISG + AV+ 
Sbjct: 138 NAMQAAVPVGEGAMAAIIGLEHDAVSAICEEAGILGVCQIANDNGGGQLVISGSKTAVEK 197

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           AA     KGAKRA+ LPVSAPFHS+LM P ++ M+  L  V K +PVVP++ N  A+PVS
Sbjct: 198 AAAIASEKGAKRAIMLPVSAPFHSALMAPAAEAMREALAKVEKHNPVVPVVANVRAAPVS 257

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
             +EI+ LLVEQVTG+VRWRET++WFA + V  +YE+GSGKVLTGLA+RIDK+++ V+++
Sbjct: 258 DANEIAALLVEQVTGQVRWRETVEWFAANNVTQLYEIGSGKVLTGLARRIDKTVNGVAVN 317

Query: 301 KVEDIDLALRSIVG 314
              DID  L +++G
Sbjct: 318 GAADIDQLLATLIG 331


>gi|169830825|ref|YP_001716807.1| malonyl CoA-acyl carrier protein transacylase [Candidatus
           Desulforudis audaxviator MP104C]
 gi|169637669|gb|ACA59175.1| malonyl CoA-acyl carrier protein transacylase [Candidatus
           Desulforudis audaxviator MP104C]
          Length = 313

 Score =  209 bits (532), Expect = 4e-52,   Method: Composition-based stats.
 Identities = 129/313 (41%), Positives = 179/313 (57%), Gaps = 5/313 (1%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M T   FPGQGSQ +GMG +L+ S+P  R +F   D  L  +L+ L + G +EEL  T N
Sbjct: 1   MKTAFLFPGQGSQYVGMGEELHRSYPVVRRIFTRADEILGFSLTKLCFEGPREELQKTAN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
            QPA+ A S+A   V+ + G+        +AGHSLGEYTAL  A AFS  D +RLVR RG
Sbjct: 61  TQPAVFATSVACFEVLREKGIL----PDVLAGHSLGEYTALVVAGAFSFEDGLRLVRRRG 116

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           + MQEAVP G G MVA++GL+   +  I  +A R G+  +AN N  GQVV++G   A++ 
Sbjct: 117 QLMQEAVPLGTGGMVAVLGLERETLKEIATEAGRAGVINLANFNCPGQVVLAGEMAALER 176

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A D     GAK+ V L VS PFHSSLM    + +   LD +  +DP  P++ N     + 
Sbjct: 177 AVDLAKQAGAKKCVPLSVSGPFHSSLMRSAGERLAQALDGIEIRDPRTPVVANVDGRFLV 236

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRID-KSLSAVSI 299
           +  E+   LV Q+   VRW E IQ     GV++  EVG GKVL+GL K+I  +  + +++
Sbjct: 237 TAAEVRAALVRQIYSPVRWEEGIQTLIGAGVRTFVEVGPGKVLSGLVKKIASRDTAILNV 296

Query: 300 SKVEDIDLALRSI 312
                +   L  +
Sbjct: 297 EDGASLQKVLACL 309


>gi|116251323|ref|YP_767161.1| malonyl CoA-acyl carrier protein transacylase [Rhizobium
           leguminosarum bv. viciae 3841]
 gi|115255971|emb|CAK07052.1| putative malonyl CoA-acyl carrier protein transacylase [Rhizobium
           leguminosarum bv. viciae 3841]
          Length = 314

 Score =  209 bits (532), Expect = 4e-52,   Method: Composition-based stats.
 Identities = 186/312 (59%), Positives = 242/312 (77%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M+   TFPGQGSQ +GMG+DL ++F EAR VFEEVD  L + LSD+M+NG ++ LT T N
Sbjct: 1   MTIAFTFPGQGSQAVGMGKDLAENFAEARAVFEEVDEALGEKLSDVMFNGPEDTLTLTAN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
           AQPAL AVS+A IRV+E  GL +K  ++YVAGHSLGEY+ALCAA  FSL+DT RL+R RG
Sbjct: 61  AQPALMAVSIAVIRVLEAKGLDLKSKVAYVAGHSLGEYSALCAAGTFSLADTARLLRIRG 120

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
            +MQ AVP G+G+M AIIGL+   V ++C +AS +G C+IANDNGGGQ+VISG + AV+ 
Sbjct: 121 NAMQAAVPVGVGAMAAIIGLEHADVIAVCEEASVIGACQIANDNGGGQIVISGEKAAVEK 180

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           AA    +KGAKRA+ LPVSAPFHS LM P +  M+  L  V K DPVVP++ N  A+PV+
Sbjct: 181 AAALATDKGAKRAILLPVSAPFHSMLMAPAADAMREALAKVAKSDPVVPVIANVRAAPVT 240

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
             DEI+ LLVEQVTG+VRWRET++WFA +GV ++YE+GSGKVLTGLA+RIDK+++ +S++
Sbjct: 241 GADEIASLLVEQVTGQVRWRETVEWFAGNGVTTLYELGSGKVLTGLARRIDKTINGISVN 300

Query: 301 KVEDIDLALRSI 312
              DID A+ ++
Sbjct: 301 GPADIDAAVAAL 312


>gi|328544023|ref|YP_004304132.1| Malonyl CoA-acyl carrier protein transacylase (MCT) [polymorphum
           gilvum SL003B-26A1]
 gi|326413767|gb|ADZ70830.1| Malonyl CoA-acyl carrier protein transacylase (MCT) [Polymorphum
           gilvum SL003B-26A1]
          Length = 337

 Score =  209 bits (531), Expect = 5e-52,   Method: Composition-based stats.
 Identities = 156/314 (49%), Positives = 213/314 (67%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           MS    FPGQGSQV+GMG+   ++ PEAR VF EVD  L ++LS++MWNG ++ LT T N
Sbjct: 24  MSVAFLFPGQGSQVVGMGKVFAETCPEARAVFAEVDEALGESLSEIMWNGPEDSLTLTAN 83

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
           AQPAL AVS+A +RV+E  G+ +K   S+VAGHSLGEY+AL AA +  ++D  RL+R RG
Sbjct: 84  AQPALMAVSLASMRVLEARGVELKASASFVAGHSLGEYSALAAAGSLKIADAARLLRIRG 143

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           ++MQ AVP G G+M A++GLD      + A+A++  +CE ANDN  GQVV+SG + AV+ 
Sbjct: 144 EAMQAAVPVGQGAMAALLGLDFEAARDVAAEAAQGEVCEAANDNAPGQVVVSGHRAAVER 203

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A +    +GA+RAV LPVSAPFH SLM P +  M   L  V    P VP++ N  A+P++
Sbjct: 204 AVEIAKGRGARRAVLLPVSAPFHCSLMAPAADAMAEALAKVEIVPPAVPLVCNVLAAPIT 263

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
             DEI + LVEQVTG VRWRE++ W A  GV +  E+G+GKVLTG+ KRI    + ++++
Sbjct: 264 DPDEIRKRLVEQVTGTVRWRESVGWLAGQGVDTFVEIGAGKVLTGMVKRIAADGTGLAVN 323

Query: 301 KVEDIDLALRSIVG 314
              D+D  L  + G
Sbjct: 324 APADVDALLERLNG 337


>gi|296133574|ref|YP_003640821.1| malonyl CoA-acyl carrier protein transacylase [Thermincola sp. JR]
 gi|296032152|gb|ADG82920.1| malonyl CoA-acyl carrier protein transacylase [Thermincola potens
           JR]
          Length = 313

 Score =  209 bits (531), Expect = 5e-52,   Method: Composition-based stats.
 Identities = 125/312 (40%), Positives = 177/312 (56%), Gaps = 3/312 (0%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M   + FPGQGSQ +GMG+DLYD+  EAR +FE+ D  L  +LS + ++G +EEL  T  
Sbjct: 1   MKLAVVFPGQGSQYVGMGKDLYDNSSEARALFEKADQLLGYSLSSVCFHGPEEELRKTPV 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
            QPA+   S        +     K  +  VAGHSLGEY+AL AA+     + ++LV  RG
Sbjct: 61  TQPAMLTTSTVLF---REFSKRNKIPVQVVAGHSLGEYSALVAAECLYFEEAVQLVEKRG 117

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           + M+EA   G G M A++GL+   V+  C +AS  G  EIAN N  GQ+VISG    ++ 
Sbjct: 118 RLMEEAASKGEGGMAAVLGLERSAVEKACREASAAGKVEIANYNCPGQIVISGTAGGLEK 177

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           AA+ C   GAKR V L VS PFHSSLM P  + +  +L       P  P + N  A  VS
Sbjct: 178 AAELCRALGAKRIVTLNVSGPFHSSLMKPAEENLAQILKETVINAPKYPFICNVTADFVS 237

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
            ++EI   L  QV+  V W + +Q    HGV +  E+G GKVLTGL ++I++ ++  +I 
Sbjct: 238 DVEEIREFLTRQVSHSVLWEDMVQNMIVHGVDTFVEIGPGKVLTGLIRKINREVTVYNIE 297

Query: 301 KVEDIDLALRSI 312
            +  ++  L  +
Sbjct: 298 DLTSLENTLAKL 309


>gi|294793525|ref|ZP_06758662.1| malonyl CoA-acyl carrier protein transacylase [Veillonella sp.
           3_1_44]
 gi|294455095|gb|EFG23467.1| malonyl CoA-acyl carrier protein transacylase [Veillonella sp.
           3_1_44]
          Length = 313

 Score =  208 bits (529), Expect = 8e-52,   Method: Composition-based stats.
 Identities = 124/315 (39%), Positives = 175/315 (55%), Gaps = 5/315 (1%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M T   FPGQGSQ +GM +DLY+++P  +  FEE D  L  ++S L + G   EL  T N
Sbjct: 1   MKTAFVFPGQGSQKVGMLQDLYNAYPIVKQRFEEADEALGYSISKLCFEGPDTELVKTAN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
            QPA+   S+A   ++++ G         V GHSLGEY+AL AA   +  D + +V  RG
Sbjct: 61  TQPAILTASVACYEILKEQGFT----PDIVGGHSLGEYSALVAAGVLNFKDAVYVVHKRG 116

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQAS-RVGICEIANDNGGGQVVISGLQDAVK 179
           + MQEAVP G G+M AI+ L    V  IC + +  VG  +  N N  GQ+VI+G   AV+
Sbjct: 117 EYMQEAVPLGKGAMAAILALPREQVVEICEEVNASVGSVQAVNFNCPGQIVIAGETAAVE 176

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            AA+     GAKRAV LPVSAPFHS LM P +  +K  LD +   D  +P++ N     +
Sbjct: 177 TAAEKMKEAGAKRAVMLPVSAPFHSRLMEPAALRLKEELDKIQVCDAQIPVVANVTGKIL 236

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
           ++ ++I   LV Q    V W + +    N GV    EVG GKVLTG  K+I+K +   ++
Sbjct: 237 TNANDIKESLVTQAANPVLWEDCVTEMVNFGVTRFVEVGPGKVLTGFTKKINKDMELANV 296

Query: 300 SKVEDIDLALRSIVG 314
             +  ++  L  + G
Sbjct: 297 EDIASLEKTLEFLKG 311


>gi|238019513|ref|ZP_04599939.1| hypothetical protein VEIDISOL_01382 [Veillonella dispar ATCC 17748]
 gi|237864212|gb|EEP65502.1| hypothetical protein VEIDISOL_01382 [Veillonella dispar ATCC 17748]
          Length = 320

 Score =  208 bits (529), Expect = 8e-52,   Method: Composition-based stats.
 Identities = 125/315 (39%), Positives = 174/315 (55%), Gaps = 5/315 (1%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M T   FPGQGSQ +GM +DLY+++P  +  FEE D  L  ++S L + G   EL  T N
Sbjct: 8   MKTAFVFPGQGSQKVGMLQDLYNAYPIVKQRFEEADEALGYSISKLCFEGPDTELVKTAN 67

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
            QPA+   S+A   V+++ G         V GHSLGEY+AL AA   +  D + +V  RG
Sbjct: 68  TQPAILTASVACYEVLKEQGFT----PDIVGGHSLGEYSALVAAGVLNFKDAVYVVHKRG 123

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQ-ASRVGICEIANDNGGGQVVISGLQDAVK 179
           + MQEAVP G G+M AI+ L    V  IC +    VG  +  N N  GQ+VI+G   AV+
Sbjct: 124 EYMQEAVPLGKGAMAAILALPREQVVEICKEVNDSVGSVQAVNFNCPGQIVIAGETAAVE 183

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            AA+     GAKRAV LPVSAPFHS LM P +  +K  LD +   D  +P++ N     +
Sbjct: 184 TAAEKMKEAGAKRAVMLPVSAPFHSRLMEPAALRLKEELDKIQVSDAQIPVVANVTGKIL 243

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
           ++ ++I   LV Q    V W + +    N GV    EVG GKVLTG  K+I+K +   ++
Sbjct: 244 TNANDIKESLVTQAANPVLWEDCVAEMVNFGVTRFVEVGPGKVLTGFTKKINKDMELANV 303

Query: 300 SKVEDIDLALRSIVG 314
             +  ++  L  + G
Sbjct: 304 EDIASLEKTLEFLKG 318


>gi|294791667|ref|ZP_06756815.1| malonyl CoA-acyl carrier protein transacylase [Veillonella sp.
           6_1_27]
 gi|294456897|gb|EFG25259.1| malonyl CoA-acyl carrier protein transacylase [Veillonella sp.
           6_1_27]
          Length = 313

 Score =  208 bits (529), Expect = 8e-52,   Method: Composition-based stats.
 Identities = 124/315 (39%), Positives = 176/315 (55%), Gaps = 5/315 (1%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M T   FPGQGSQ +GM +DLY+++P  +  FEE D  L  ++S L + G   EL  T N
Sbjct: 1   MKTAFVFPGQGSQKVGMLQDLYNAYPIVKQRFEEADEALGYSISKLCFEGPDTELVKTAN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
            QPA+   S+A   ++++ G         V GHSLGEY+AL AA   +  D + +V  RG
Sbjct: 61  TQPAILTASVACYEILKEQGF----MPDIVGGHSLGEYSALVAAGVLNFKDAVYVVHKRG 116

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQAS-RVGICEIANDNGGGQVVISGLQDAVK 179
           + MQEAVP G G+M AI+ L    V  IC + +  VG  +  N N  GQ+VI+G   AV+
Sbjct: 117 EYMQEAVPLGKGAMAAILALPREQVVEICEEVNASVGSVQAVNFNCPGQIVIAGETAAVE 176

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            AA+     GAKRAV LPVSAPFHS LM P +  +K  LD +   D  +P++ N     +
Sbjct: 177 TAAEKMKEAGAKRAVMLPVSAPFHSRLMEPAALRLKEELDKIQVSDAQIPVVANVTGKIL 236

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
           ++ ++I + LV Q    V W + +    N GV    EVG GKVLTG  K+I+K +   ++
Sbjct: 237 TNANDIKKSLVTQAANPVLWEDCVAEMVNFGVTRFVEVGPGKVLTGFTKKINKDMELANV 296

Query: 300 SKVEDIDLALRSIVG 314
             +  ++  L  + G
Sbjct: 297 EDIASLEKTLEFLKG 311


>gi|288575037|ref|ZP_06393394.1| malonyl CoA-acyl carrier protein transacylase [Dethiosulfovibrio
           peptidovorans DSM 11002]
 gi|288570778|gb|EFC92335.1| malonyl CoA-acyl carrier protein transacylase [Dethiosulfovibrio
           peptidovorans DSM 11002]
          Length = 318

 Score =  208 bits (529), Expect = 9e-52,   Method: Composition-based stats.
 Identities = 141/313 (45%), Positives = 196/313 (62%), Gaps = 2/313 (0%)

Query: 1   MS-TVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATC 59
           M    L FPGQG+Q +GMGRDLY+SFP AR VF+E D  L  +LS +++ G +E+LT T 
Sbjct: 3   MKRFALLFPGQGAQSVGMGRDLYESFPAARRVFDEADEALGFSLSSIIFEGPEEKLTLTE 62

Query: 60  NAQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRAR 119
             QPAL  VS+AF R + ++   +     +VAGHSLGEY+AL A+   SL+D +RLV AR
Sbjct: 63  YTQPALLTVSLAFFRALTED-NGIVLSPDFVAGHSLGEYSALVASGTLSLADGVRLVNAR 121

Query: 120 GKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVK 179
           G+ MQ+AVP G G+M AI+GL D  V  IC++     +CE AN N  GQVVISG  D+V 
Sbjct: 122 GRLMQKAVPEGEGAMAAILGLKDSDVRDICSRFDGDKVCEAANFNSPGQVVISGDSDSVA 181

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            A +     GAKRA+ L VSAPFH  LMT V+  +   ++  +  +   P++ N  ASPV
Sbjct: 182 KAIEAAKEAGAKRAIPLNVSAPFHCRLMTDVADELSKEMERCSWSESSCPLVANVSASPV 241

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
           +S+++I   L  Q    VRW E++++ ++ GV +  E+G GKVL GLAK+  K    +SI
Sbjct: 242 TSVEDIRAGLYRQTYSPVRWVESMRYMSDAGVSTFLELGPGKVLAGLAKKCVKGSKTLSI 301

Query: 300 SKVEDIDLALRSI 312
              ED+D  +  +
Sbjct: 302 GSAEDLDKVVDFL 314


>gi|269797761|ref|YP_003311661.1| malonyl CoA-acyl carrier protein transacylase [Veillonella parvula
           DSM 2008]
 gi|282849035|ref|ZP_06258424.1| [acyl-carrier-protein] S-malonyltransferase [Veillonella parvula
           ATCC 17745]
 gi|269094390|gb|ACZ24381.1| malonyl CoA-acyl carrier protein transacylase [Veillonella parvula
           DSM 2008]
 gi|282581310|gb|EFB86704.1| [acyl-carrier-protein] S-malonyltransferase [Veillonella parvula
           ATCC 17745]
          Length = 313

 Score =  208 bits (529), Expect = 9e-52,   Method: Composition-based stats.
 Identities = 124/315 (39%), Positives = 175/315 (55%), Gaps = 5/315 (1%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M T   FPGQGSQ +GM +DLY+++P  +  FEE D  L  ++S L + G   EL  T N
Sbjct: 1   MKTAFVFPGQGSQKVGMLQDLYNAYPIVKQRFEEADEALGYSISKLCFEGPDTELVKTAN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
            QPA+   S+A   ++++ G         V GHSLGEY+AL AA   +  D + +V  RG
Sbjct: 61  TQPAILTASVACYEILKEQGFT----PDIVGGHSLGEYSALVAAGVLNFKDAVYVVHKRG 116

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQAS-RVGICEIANDNGGGQVVISGLQDAVK 179
           + MQEAVP G G+M AI+ L    V  IC + +  VG  +  N N  GQ+VI+G   AV+
Sbjct: 117 EYMQEAVPLGKGAMAAILALPREQVVEICEEVNASVGSVQAVNFNCPGQIVIAGETAAVE 176

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            AA+     GAKRAV LPVSAPFHS LM P +  +K  LD +   D  +P++ N     +
Sbjct: 177 TAAEKMKEAGAKRAVMLPVSAPFHSRLMEPAALRLKEELDKIQVSDAQIPVVANVTGKIL 236

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
           ++ ++I   LV Q    V W + +    N GV    EVG GKVLTG  K+I+K +   ++
Sbjct: 237 TNANDIKESLVTQAANPVLWEDCVAEMVNFGVTRFVEVGPGKVLTGFTKKINKDMELANV 296

Query: 300 SKVEDIDLALRSIVG 314
             +  ++  L  + G
Sbjct: 297 EDIASLEKTLEFLKG 311


>gi|227821463|ref|YP_002825433.1| malonyl-CoA:acyl carrier protein transacylase [Sinorhizobium fredii
           NGR234]
 gi|227340462|gb|ACP24680.1| malonyl-CoA:acyl carrier protein transacylase [Sinorhizobium fredii
           NGR234]
          Length = 314

 Score =  207 bits (527), Expect = 1e-51,   Method: Composition-based stats.
 Identities = 186/306 (60%), Positives = 236/306 (77%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           MS   TFPGQGSQ +GMG+DL ++FPEA  VF EVD  L + LSD +WNG +E LT T N
Sbjct: 1   MSIAFTFPGQGSQAVGMGKDLAEAFPEAAAVFAEVDDALGEKLSDTIWNGPEETLTLTAN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
           AQPAL AVS+A IRV+E  GL +   +S+VAGHSLGEY+ALCAA  FSL+DT RL+R RG
Sbjct: 61  AQPALMAVSIAVIRVLEARGLDLGSKVSFVAGHSLGEYSALCAAGTFSLADTARLLRIRG 120

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
            +MQ AVP G G+M AIIGL+   V+++C +AS +G C+IANDNGGGQ+VISG + AV+ 
Sbjct: 121 NAMQAAVPVGKGAMAAIIGLEHDDVEAVCREASSLGACQIANDNGGGQLVISGEKQAVEK 180

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           AA     KGAKRA+ LPVSAPFHSSLM P ++ M+  L  V K+DPVVP++ N  A+PVS
Sbjct: 181 AAALATEKGAKRALMLPVSAPFHSSLMAPAAEAMREALAQVEKRDPVVPVVANVLAAPVS 240

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
              EI+RLLVEQVTG+VRWRET+QWFA + V ++YE+GSGKVLTGLA+RIDK+++ ++++
Sbjct: 241 DAGEIARLLVEQVTGQVRWRETVQWFAGNDVTTLYEIGSGKVLTGLARRIDKTVNGIAVN 300

Query: 301 KVEDID 306
              DID
Sbjct: 301 TPADID 306


>gi|90419490|ref|ZP_01227400.1| malonyl Coenzyme A-acyl carrier protein transacylase [Aurantimonas
           manganoxydans SI85-9A1]
 gi|90336427|gb|EAS50168.1| malonyl Coenzyme A-acyl carrier protein transacylase [Aurantimonas
           manganoxydans SI85-9A1]
          Length = 310

 Score =  207 bits (527), Expect = 1e-51,   Method: Composition-based stats.
 Identities = 165/308 (53%), Positives = 204/308 (66%), Gaps = 1/308 (0%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M+T L FPGQGSQ +GMGR LYDSF  +R VF+EVD  L + LS+L++ G ++ LT T N
Sbjct: 1   MTTALVFPGQGSQSVGMGRTLYDSFDASRAVFDEVDEALGEKLSELIFEGPEDRLTLTEN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
           AQPAL AVSMA IR +E  G  V    +YVAGHSLGEY+AL A  A S+  T +L+R RG
Sbjct: 61  AQPALMAVSMAAIRALEAEGFSV-ETAAYVAGHSLGEYSALAAVGALSIGQTAKLLRIRG 119

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
            +MQEAVP G GSM AIIGLD   V  +C  A+   +CE ANDNGGGQ+VISG   A+  
Sbjct: 120 NAMQEAVPSGAGSMAAIIGLDAEAVAKLCEDAAEGEVCEPANDNGGGQIVISGNAAAIDR 179

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A      +GAKRA+ L VSAPFH  LM P +  M   L       P VP++ N  A+P S
Sbjct: 180 AIALAQERGAKRALPLSVSAPFHCRLMQPAADRMAEALADAEILVPRVPVVTNVTAAPTS 239

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
              EI   LV QVTG+VRWRE+I+W A +GV S+ E+GSGKVLTGLA+RID+SL   +I 
Sbjct: 240 DPAEIRERLVRQVTGQVRWRESIEWLAANGVNSLVEIGSGKVLTGLARRIDRSLEGRAIG 299

Query: 301 KVEDIDLA 308
             +D+   
Sbjct: 300 TADDVRAF 307


>gi|241203937|ref|YP_002975033.1| malonyl CoA-acyl carrier protein transacylase [Rhizobium
           leguminosarum bv. trifolii WSM1325]
 gi|240857827|gb|ACS55494.1| malonyl CoA-acyl carrier protein transacylase [Rhizobium
           leguminosarum bv. trifolii WSM1325]
          Length = 314

 Score =  207 bits (526), Expect = 2e-51,   Method: Composition-based stats.
 Identities = 183/312 (58%), Positives = 244/312 (78%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M+   TFPGQGSQ +GMG+DL ++F EAR VF+EVD  L + LSD+M+NG ++ LT T N
Sbjct: 1   MTIAFTFPGQGSQAVGMGKDLAENFAEARAVFQEVDEALGEKLSDVMFNGPEDTLTLTAN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
           AQPAL AVS+A +RV+E  GL +K  ++YVAGHSLGEY+ALCAA  FSL+DT RL+R RG
Sbjct: 61  AQPALMAVSIAVVRVLEAKGLDLKSKVAYVAGHSLGEYSALCAAGTFSLADTARLLRIRG 120

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
            +MQ AVP G+G+M AIIGL+   V ++C  A+ +G C+IANDNGGGQ+VISG + AV+ 
Sbjct: 121 NAMQAAVPVGVGAMAAIIGLEHADVAAVCEAAAAIGACQIANDNGGGQIVISGEKAAVEK 180

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           AA    +KGAKRA+ LPVSAPFHS+LM P ++ M+  L +V K DPVVP++ N  A+PV+
Sbjct: 181 AAGLATDKGAKRAILLPVSAPFHSTLMAPAAEAMREALATVAKSDPVVPVIANVRAAPVT 240

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
             DEI+ LLVEQVTG+VRWRET++WFA +GV ++YE+GSGKVLTGLA+RIDK+++ +S++
Sbjct: 241 GADEIASLLVEQVTGQVRWRETVEWFAGNGVTTLYELGSGKVLTGLARRIDKTINGISVN 300

Query: 301 KVEDIDLALRSI 312
              DID A+ ++
Sbjct: 301 GPADIDAAVAAL 312


>gi|260892845|ref|YP_003238942.1| malonyl CoA-acyl carrier protein transacylase [Ammonifex degensii
           KC4]
 gi|260864986|gb|ACX52092.1| malonyl CoA-acyl carrier protein transacylase [Ammonifex degensii
           KC4]
          Length = 314

 Score =  207 bits (525), Expect = 2e-51,   Method: Composition-based stats.
 Identities = 131/312 (41%), Positives = 183/312 (58%), Gaps = 3/312 (0%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M+    FPGQGSQ +GMG+DLY+ +PEAR VF E D  L   LS L + G    L+ T N
Sbjct: 1   MTLACVFPGQGSQYVGMGKDLYERYPEAREVFAEADAVLGFPLSQLCFEGPASLLSQTMN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
            QPA+  VS+A  RV    G    R  S VAGHSLGE++AL AA A      +RLVR RG
Sbjct: 61  TQPAVLTVSVACWRVYLTQG---GRKPSAVAGHSLGEFSALVAAGALDFPTALRLVRRRG 117

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           + MQEAVP G G M+A++GL    ++ +     + G+ E+AN N  GQ+V+SG   A++ 
Sbjct: 118 ELMQEAVPLGEGGMLALLGLPTEKLERVLEAGKQAGVVEVANYNCPGQIVLSGHMPALEA 177

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           AA     +GAK+ V L VS PFHSSLM   +++    L+ VT + PV+P++ N  A    
Sbjct: 178 AAQAARAEGAKKTVLLAVSGPFHSSLMRRAAELFAQELEQVTIKKPVLPVVLNCTAEYAY 237

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
              EI + L+ Q+T  VRW E+++     GV++  E+G GKVLTGL +RI    + +++ 
Sbjct: 238 RASEIKKALMRQMTSPVRWEESVRRLVKDGVETFVEIGPGKVLTGLIRRIHALATCLNVE 297

Query: 301 KVEDIDLALRSI 312
               +   LR +
Sbjct: 298 DEASLRHTLRVL 309


>gi|303231098|ref|ZP_07317838.1| [acyl-carrier-protein] S-malonyltransferase [Veillonella atypica
           ACS-049-V-Sch6]
 gi|302514229|gb|EFL56231.1| [acyl-carrier-protein] S-malonyltransferase [Veillonella atypica
           ACS-049-V-Sch6]
          Length = 313

 Score =  207 bits (525), Expect = 2e-51,   Method: Composition-based stats.
 Identities = 124/315 (39%), Positives = 172/315 (54%), Gaps = 5/315 (1%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M T   FPGQGSQ +GM +DLY+++P  +  FEE D  L  ++S L + G   EL  T N
Sbjct: 1   MKTAFVFPGQGSQKVGMLQDLYNAYPIVKQRFEEADEALGYSISKLCFEGPDTELVKTAN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
            QPA+   S+A   V+++ G         V GHSLGEY+AL AA      D + +V  RG
Sbjct: 61  TQPAILTASVACYEVLKEQGFT----PDIVGGHSLGEYSALVAAGVLDFKDAVYVVHKRG 116

Query: 121 KSMQEAVPPGLGSMVAIIGLD-DCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVK 179
           + MQEAVP G G+M AI+ L  + VV+        VG  +  N N  GQ+VI+G   AV+
Sbjct: 117 EYMQEAVPLGKGAMAAILALPREQVVEICQQVNDTVGSVQAVNFNCPGQIVIAGETAAVE 176

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            AA+     GAKRAV LPVSAPFHS LM P +  +K  LD +   D  +P++ N     +
Sbjct: 177 TAAEKMKEAGAKRAVMLPVSAPFHSRLMEPAALRLKEELDKIQVNDAKIPVVANVTGKIL 236

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
           ++  +I   LV Q    V W + +    N GV    EVG GKVLTG  K+I+K +   ++
Sbjct: 237 TNASDIKESLVTQAANPVLWEDCVAEMVNFGVTRFVEVGPGKVLTGFTKKINKEMELANV 296

Query: 300 SKVEDIDLALRSIVG 314
             +  ++  L  + G
Sbjct: 297 EDIPSLEKTLEFLKG 311


>gi|303229656|ref|ZP_07316444.1| [acyl-carrier-protein] S-malonyltransferase [Veillonella atypica
           ACS-134-V-Col7a]
 gi|302515781|gb|EFL57735.1| [acyl-carrier-protein] S-malonyltransferase [Veillonella atypica
           ACS-134-V-Col7a]
          Length = 313

 Score =  207 bits (525), Expect = 2e-51,   Method: Composition-based stats.
 Identities = 124/315 (39%), Positives = 172/315 (54%), Gaps = 5/315 (1%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M T   FPGQGSQ +GM +DLY+++P  +  FEE D  L  ++S L + G   EL  T N
Sbjct: 1   MKTAFVFPGQGSQKVGMLQDLYNAYPIVKQRFEEADEALGYSISKLCFEGPDTELVKTAN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
            QPA+   S+A   V+++ G         V GHSLGEY+AL AA      D + +V  RG
Sbjct: 61  TQPAILTASVACYEVLKEQGFI----PDIVGGHSLGEYSALVAAGVLDFKDAVYVVHKRG 116

Query: 121 KSMQEAVPPGLGSMVAIIGLD-DCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVK 179
           + MQEAVP G G+M AI+ L  + VV+        VG  +  N N  GQ+VI+G   AV+
Sbjct: 117 EYMQEAVPLGKGAMAAILALPREQVVEICQQVNDTVGSVQAVNFNCPGQIVIAGETAAVE 176

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            AA+     GAKRAV LPVSAPFHS LM P +  +K  LD +   D  +P++ N     +
Sbjct: 177 TAAEKMKEAGAKRAVMLPVSAPFHSRLMEPAALRLKEELDKIQVNDAKIPVVANVTGKIL 236

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
           ++  +I   LV Q    V W + +    N GV    EVG GKVLTG  K+I+K +   ++
Sbjct: 237 TNASDIKESLVTQAANPVLWEDCVAEMVNFGVTRFVEVGPGKVLTGFTKKINKEMELANV 296

Query: 300 SKVEDIDLALRSIVG 314
             +  ++  L  + G
Sbjct: 297 EDIPSLEKTLEFLKG 311


>gi|320108660|ref|YP_004184250.1| malonyl CoA-acyl carrier protein transacylase [Terriglobus
           saanensis SP1PR4]
 gi|319927181|gb|ADV84256.1| malonyl CoA-acyl carrier protein transacylase [Terriglobus
           saanensis SP1PR4]
          Length = 328

 Score =  207 bits (525), Expect = 2e-51,   Method: Composition-based stats.
 Identities = 131/313 (41%), Positives = 182/313 (58%), Gaps = 6/313 (1%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
                FPGQGSQ +GMG DL D FP A+  F E D  L  +LSDL +NG +E+L  T + 
Sbjct: 18  KIAFLFPGQGSQTVGMGHDLADRFPVAKDTFAEADEALGFSLSDLCFNGPEEQLKQTEHT 77

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPA+  VS+A  RV+ ++G+      +  AGHSLGEY+A  AA   S +D +R VR+RG+
Sbjct: 78  QPAILTVSVAVARVLAEHGISA----AMTAGHSLGEYSAYVAAGTISFADAVRTVRSRGQ 133

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIAND--NGGGQVVISGLQDAVK 179
            MQ+AVP G G+M AI+GL    +  +CAQAS      +A    N   Q VISG   AV+
Sbjct: 134 FMQQAVPAGQGTMAAILGLSVERISDMCAQASSETSAVVAPANLNSPDQTVISGATAAVE 193

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            AA+ C   GAKRAV LPVSAPFH  LM P +  +   L++V+  DP  P+  N  A  +
Sbjct: 194 RAAELCKESGAKRAVMLPVSAPFHCQLMAPAAHQLTTTLEAVSLVDPAFPVASNVDARLI 253

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
           +   ++   L+ QVTG VRW E I+     G     E G GKVL GL ++ID++ + +++
Sbjct: 254 TRQGDVRDTLIRQVTGAVRWVECIELLKTSGATHFIEAGPGKVLCGLMRQIDRTQTCLNV 313

Query: 300 SKVEDIDLALRSI 312
                ++  L ++
Sbjct: 314 EDSASLEKTLAAL 326


>gi|144899047|emb|CAM75911.1| malonyl CoA-acyl carrier protein transacylase [Magnetospirillum
           gryphiswaldense MSR-1]
          Length = 313

 Score =  206 bits (524), Expect = 3e-51,   Method: Composition-based stats.
 Identities = 163/313 (52%), Positives = 212/313 (67%), Gaps = 1/313 (0%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           MS    FPGQGSQ +GMGR+L ++F EAR VF+EVD  L+QNLS LM+ G ++ LT T N
Sbjct: 1   MSRAFVFPGQGSQAVGMGRELAEAFAEARHVFQEVDEALSQNLSKLMFEGPEDTLTLTEN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRD-ISYVAGHSLGEYTALCAAKAFSLSDTIRLVRAR 119
           AQPAL A+S+A +RV+E  G        S+VAGHSLGEY+AL A   FSL+DT RL++ R
Sbjct: 61  AQPALMAMSVAVVRVLEGQGKMDLAKTASFVAGHSLGEYSALAAVGTFSLADTARLLKLR 120

Query: 120 GKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVK 179
           G+SMQ+AVP G+G+M A++G +      I A A+   +CE ANDNG GQVV+SG ++AV+
Sbjct: 121 GQSMQKAVPVGVGAMAALLGSEYEQAKEIAALAAEGQVCEAANDNGAGQVVVSGHKEAVE 180

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            A      KG KRAV LPVSAPFH +LM P +  M   L +VT   P VP++ N  AS V
Sbjct: 181 RAMKIAAEKGIKRAVLLPVSAPFHCALMQPAADAMAEALSNVTMNAPKVPLVANVVASAV 240

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
           +  + I  LLV+QVTG VRWRE + +    GV  + E+G+GKVL+GLAKRIDK LS +++
Sbjct: 241 TDPEVIRDLLVKQVTGTVRWREGVLYMKEQGVSQLVELGAGKVLSGLAKRIDKELSGLAV 300

Query: 300 SKVEDIDLALRSI 312
               DID  L S+
Sbjct: 301 GNPADIDAFLASL 313


>gi|329113436|ref|ZP_08242217.1| Malonyl CoA-acyl carrier protein transacylase [Acetobacter pomorum
           DM001]
 gi|326697261|gb|EGE48921.1| Malonyl CoA-acyl carrier protein transacylase [Acetobacter pomorum
           DM001]
          Length = 317

 Score =  206 bits (524), Expect = 3e-51,   Method: Composition-based stats.
 Identities = 151/317 (47%), Positives = 203/317 (64%), Gaps = 5/317 (1%)

Query: 1   MST----VLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELT 56
           MS        FPGQGSQ +GMG++L ++FP AR VFEEVD  L + LS +++ G  E LT
Sbjct: 1   MSIMAVYAFVFPGQGSQSVGMGQELAEAFPAARSVFEEVDDALGEKLSKIIFEGPIESLT 60

Query: 57  ATCNAQPALTAVSMAFIRVMEKNGLCVKR-DISYVAGHSLGEYTALCAAKAFSLSDTIRL 115
           +T NAQPAL AVSMA +RV+E++G       ++ +AGHSLGEY+AL A +AF +++  RL
Sbjct: 61  STENAQPALMAVSMAVLRVLEQDGGLDLAGKVTLLAGHSLGEYSALAAGRAFGVAEAARL 120

Query: 116 VRARGKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQ 175
           +R RG++MQ+AVP G G M A+IG+     + IC +AS  G  EIANDNGGGQ+VISG  
Sbjct: 121 LRLRGQAMQKAVPAGEGGMAALIGVTLAQAEDICTKASAKGDVEIANDNGGGQIVISGKI 180

Query: 176 DAVKCAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFC 235
             +  A         KRA+ LPVSAPFHSSLM P   VM   L       P+VP++ N  
Sbjct: 181 AGIDEAIAIAKELKIKRALKLPVSAPFHSSLMKPAEDVMAEALAKADITAPIVPVIANVT 240

Query: 236 ASPVSSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLS 295
           A   +  D I + LV QVTGRVRWRE++      GV +  E+G+GKVL+GL +RID  +S
Sbjct: 241 AERETDTDTIRQNLVRQVTGRVRWRESVAAMVGMGVDTFVEIGAGKVLSGLVRRIDAEVS 300

Query: 296 AVSISKVEDIDLALRSI 312
            +S+    DI+  L+++
Sbjct: 301 GLSVGTPADIESFLKTL 317


>gi|317129242|ref|YP_004095524.1| malonyl CoA-acyl carrier protein transacylase [Bacillus
           cellulosilyticus DSM 2522]
 gi|315474190|gb|ADU30793.1| malonyl CoA-acyl carrier protein transacylase [Bacillus
           cellulosilyticus DSM 2522]
          Length = 315

 Score =  206 bits (524), Expect = 3e-51,   Method: Composition-based stats.
 Identities = 125/314 (39%), Positives = 187/314 (59%), Gaps = 5/314 (1%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
              L FPGQGSQ +GMG++L+D + + + ++ E D  L ++LS L+++G +EEL  T N 
Sbjct: 3   KIALLFPGQGSQQVGMGKELFDLYEQTKNIYNEADDVLGESLSSLIFSGDEEELKKTENT 62

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPAL   S++   V++  G+    +  Y AGHSLGEY+AL AA A S  D    VR RG+
Sbjct: 63  QPALLTTSISIWEVLKSKGV----NPDYAAGHSLGEYSALVAAGAMSFQDACVAVRKRGQ 118

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRV-GICEIANDNGGGQVVISGLQDAVKC 180
            M++AVP G G+M A++G+    +  +  +A++   I E AN N  GQ+VISG  + V+ 
Sbjct: 119 WMEQAVPKGKGTMAAVLGMKRDELTELTIEATKASNIVEPANFNCPGQIVISGTVEGVQA 178

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A +    KGAKR + L VS PFHSSLM P ++ MK  LDS+    P + ++ N  A  V 
Sbjct: 179 ATELAKEKGAKRVIPLSVSGPFHSSLMKPAAEKMKEHLDSIQIHAPQIQVVANVTADVVK 238

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
             + I +LL EQ+   V W +T+    N GV +  EVG GKVL+GL K++ +  + + + 
Sbjct: 239 DSEMIRQLLFEQIYSPVLWEDTLHRLVNDGVDTFIEVGPGKVLSGLVKKVSRRATVLPVF 298

Query: 301 KVEDIDLALRSIVG 314
             E ++ AL ++ G
Sbjct: 299 DQETLEKALTTLGG 312


>gi|114328876|ref|YP_746033.1| malonyl-CoA-[acyl-carrier-protein] transacylase [Granulibacter
           bethesdensis CGDNIH1]
 gi|114317050|gb|ABI63110.1| malonyl-CoA-[acyl-carrier-protein] transacylase [Granulibacter
           bethesdensis CGDNIH1]
          Length = 323

 Score =  206 bits (523), Expect = 4e-51,   Method: Composition-based stats.
 Identities = 155/319 (48%), Positives = 201/319 (63%), Gaps = 8/319 (2%)

Query: 1   MST-VLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATC 59
           M+     FPGQGSQ +GMGRDL D+FP AR VFEEVD TL Q LS LM++G  E+LT T 
Sbjct: 4   MTVRAFLFPGQGSQFVGMGRDLADAFPIAREVFEEVDDTLGQKLSRLMFDGPAEDLTLTE 63

Query: 60  NAQPALTAVSMAFIRVMEKNGLCVKR-DISYVAGHSLGEYTALCAAKAFSLSDTIRLVRA 118
           N QPAL A+SMA +RV+EK G  +     + VAGHSLGEY+AL AA A S+++   L+R 
Sbjct: 64  NTQPALMAMSMAVLRVLEKEGGFILPARAAVVAGHSLGEYSALSAANALSVAEAALLLRL 123

Query: 119 RGKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGI------CEIANDNGGGQVVIS 172
           RG++MQ AVPPG G M A+IG+D     SIC +A+           + ANDNGGGQVVIS
Sbjct: 124 RGQAMQNAVPPGEGGMAALIGVDMDQAASICEEATTDPETGRHEVIQPANDNGGGQVVIS 183

Query: 173 GLQDAVKCAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILP 232
           G + A+  A +    +G KRAV LPVSAPFHS+LM P + VM   L       P+VP++ 
Sbjct: 184 GHRGAIDRAIEVARARGVKRAVLLPVSAPFHSALMAPAADVMAQALAEHPLHAPLVPVIA 243

Query: 233 NFCASPVSSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDK 292
           N  A+  +   E+  LLV QVTG VRWRE +      GV +  E+G+GKVL GL +RI  
Sbjct: 244 NVTAAKATDPAELRDLLVRQVTGTVRWRECVATMLELGVDTFVELGAGKVLGGLIRRIAP 303

Query: 293 SLSAVSISKVEDIDLALRS 311
             + +S     +I+  L++
Sbjct: 304 DATTLSAGTPAEIEALLKT 322


>gi|269792708|ref|YP_003317612.1| malonyl CoA-acyl carrier protein transacylase [Thermanaerovibrio
           acidaminovorans DSM 6589]
 gi|269100343|gb|ACZ19330.1| malonyl CoA-acyl carrier protein transacylase [Thermanaerovibrio
           acidaminovorans DSM 6589]
          Length = 316

 Score =  206 bits (523), Expect = 4e-51,   Method: Composition-based stats.
 Identities = 137/311 (44%), Positives = 193/311 (62%), Gaps = 1/311 (0%)

Query: 4   VLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQP 63
            L FPGQG+Q +GMGRD Y+++P AR VFEE +  L+ +L+ +++ G +EEL  T   QP
Sbjct: 5   ALVFPGQGAQEVGMGRDFYEAYPAARRVFEEANRALDFDLTKVIFEGPEEELKKTAITQP 64

Query: 64  ALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSM 123
           A+  VS+A +    ++   +  +  +VAGHSLGEYTAL AA A S++D +RLV  RG  M
Sbjct: 65  AILTVSVAILSAARED-AGIPLEPMFVAGHSLGEYTALAAAGAISVADAVRLVHLRGSRM 123

Query: 124 QEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAAD 183
           Q+AVP G+G+M A++GL+   +  IC +AS  G+CE+AN N  GQ+VISG   AV+ AA+
Sbjct: 124 QDAVPLGVGAMAAVMGLEGEAIREICQRASTKGVCEMANYNAPGQIVISGEAPAVEAAAE 183

Query: 184 TCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSID 243
                GA + + L VSAPFH SLM PV+  ++    SV   +   P++ N  A P   + 
Sbjct: 184 MLKEAGASKVIPLKVSAPFHCSLMRPVADHLREAFTSVRWGELSCPLVSNVDAKPRRDMG 243

Query: 244 EISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVE 303
           EI   L+EQ    V W ++++  A+ GV +  E G G VLTGLAKR  K   A S+SKV 
Sbjct: 244 EIRERLLEQTYSPVLWLDSMRAMADSGVDAFIEFGPGNVLTGLAKRCVKGKRAKSVSKVS 303

Query: 304 DIDLALRSIVG 314
           D++  L  I G
Sbjct: 304 DLEGLLDFIKG 314


>gi|92113724|ref|YP_573652.1| [Acyl-carrier-protein] S-malonyltransferase [Chromohalobacter
           salexigens DSM 3043]
 gi|91796814|gb|ABE58953.1| [Acyl-carrier-protein] S-malonyltransferase [Chromohalobacter
           salexigens DSM 3043]
          Length = 319

 Score =  205 bits (522), Expect = 5e-51,   Method: Composition-based stats.
 Identities = 114/309 (36%), Positives = 170/309 (55%), Gaps = 3/309 (0%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
           S  L FPGQGSQ +GM R+L + +   R  F+E    L  +L  ++  G +  L  T   
Sbjct: 4   SLALVFPGQGSQQVGMLRELAERYSVVRTTFDEASGALGYDLWKVVQEGPESTLNTTACT 63

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPAL   S+A  RV ++           +AGHSLGEY+A+  A     ++ +RLVR RG+
Sbjct: 64  QPALLTSSVAIWRVWQE---LEGPRPLVMAGHSLGEYSAMVCAGVIGFAEGVRLVRLRGE 120

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCA 181
           +MQ AVP G G+M A++GLDD  V++ C  A++  +    N N  GQVVI+G + AV+ A
Sbjct: 121 AMQAAVPEGQGAMAAVLGLDDETVETACRDAAQGEVVSAVNYNAPGQVVIAGNKSAVERA 180

Query: 182 ADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSS 241
              C   GAKRA+ LPVS P H +LM P ++ +   +  +  + P   ++ N  A     
Sbjct: 181 ISLCQEAGAKRALPLPVSVPSHCALMQPAAERLAEEIGGLDLKTPRYTVVQNVDARAHDD 240

Query: 242 IDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISK 301
           +D +S+ LVEQ+   VRW + +      G +   E G GKVLTGL KRI +    ++++ 
Sbjct: 241 VDTLSQRLVEQLYRPVRWTDCVNAMHERGARVFIECGPGKVLTGLNKRIQRQAKGLAVND 300

Query: 302 VEDIDLALR 310
            + ++ AL 
Sbjct: 301 PDSLESALE 309


>gi|255523977|ref|ZP_05390939.1| malonyl CoA-acyl carrier protein transacylase [Clostridium
           carboxidivorans P7]
 gi|296186838|ref|ZP_06855239.1| malonyl CoA-acyl carrier protein transacylase [Clostridium
           carboxidivorans P7]
 gi|255512264|gb|EET88542.1| malonyl CoA-acyl carrier protein transacylase [Clostridium
           carboxidivorans P7]
 gi|296048552|gb|EFG87985.1| malonyl CoA-acyl carrier protein transacylase [Clostridium
           carboxidivorans P7]
          Length = 313

 Score =  205 bits (522), Expect = 5e-51,   Method: Composition-based stats.
 Identities = 111/312 (35%), Positives = 183/312 (58%), Gaps = 4/312 (1%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
                F GQG+Q +GMG++LYD+F   + +F   D  L  ++S + + G +EEL  T N 
Sbjct: 3   KVAFLFSGQGAQYVGMGKELYDNFDVCKNIFNNADEALGFSISSMCFEGPEEELNKTENT 62

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPA+   S+A +R+++ NG+         AG SLGEY+AL A+     ++ + LV+ RGK
Sbjct: 63  QPAILTTSIAALRILQSNGI----KADVTAGLSLGEYSALVASGVLEFTEAVSLVKKRGK 118

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCA 181
            MQEAVP G+G+M AIIGLD+  +  +C     +GI EIAN N  GQVVI+G    ++ A
Sbjct: 119 YMQEAVPEGVGAMAAIIGLDEDNIRKVCDDCKSIGIVEIANLNCPGQVVIAGEAKPLEIA 178

Query: 182 ADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSS 241
            +     GA++A+ L VS PFH+S++ P ++ ++  L  V+  +  +P++ N     V +
Sbjct: 179 CEKLKEAGARKAIMLSVSGPFHTSMLKPAAEKLEKELQDVSIGNFSIPVITNVTGEVVDN 238

Query: 242 IDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISK 301
            DE+   L +QV   V + ++I+   + GV +  E+G GKVL+G  K+ID+  + +++  
Sbjct: 239 KDEVKGYLKKQVMSTVFFEKSIRRMIDMGVDTFIEIGPGKVLSGFVKKIDRKATILNVQD 298

Query: 302 VEDIDLALRSIV 313
           V+ ++  +  + 
Sbjct: 299 VKSLESTIEKLK 310


>gi|313892761|ref|ZP_07826342.1| [acyl-carrier-protein] S-malonyltransferase [Veillonella sp. oral
           taxon 158 str. F0412]
 gi|313442692|gb|EFR61103.1| [acyl-carrier-protein] S-malonyltransferase [Veillonella sp. oral
           taxon 158 str. F0412]
          Length = 313

 Score =  205 bits (521), Expect = 7e-51,   Method: Composition-based stats.
 Identities = 125/315 (39%), Positives = 175/315 (55%), Gaps = 5/315 (1%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M T   FPGQGSQ +GM +DLY+++P  +  FEE D  L  +++ L + G   EL  T N
Sbjct: 1   MKTAFVFPGQGSQKVGMLQDLYNAYPIVKQRFEEADDALGYSITKLCFEGPDTELVKTAN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
            QPA+   S+A   V+++ G         V GHSLGEY+AL AA   +  D + +V  RG
Sbjct: 61  TQPAILTASVACYEVLKEQGFT----PDIVGGHSLGEYSALVAAGVLNFKDAVYVVHKRG 116

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQAS-RVGICEIANDNGGGQVVISGLQDAVK 179
           + MQEAVP G G+M AI+ L    V  IC + S  VG  +  N N  GQ+VI+G   AV+
Sbjct: 117 QYMQEAVPLGKGAMAAILALPREQVVEICEEVSASVGSVQAVNFNCPGQIVIAGETAAVE 176

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            AA+     GAKRAV LPVSAPFHS LM P +  +K  LD +   D  +P++ N     +
Sbjct: 177 AAAEKMKEAGAKRAVMLPVSAPFHSRLMEPAALRLKEELDKIQVNDAQIPVVANVTGKIL 236

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
           ++ ++I   LV Q    V W + +    N GV    EVG GKVLTG  K+I+K +   ++
Sbjct: 237 TNANDIKESLVTQAANPVLWEDCVAEMVNFGVTCFVEVGPGKVLTGFTKKINKDMELANV 296

Query: 300 SKVEDIDLALRSIVG 314
             +  ++  L  + G
Sbjct: 297 EDIASLEKTLEFLKG 311


>gi|83311204|ref|YP_421468.1| S-malonyltransferase [Magnetospirillum magneticum AMB-1]
 gi|82946045|dbj|BAE50909.1| S-malonyltransferase [Magnetospirillum magneticum AMB-1]
          Length = 313

 Score =  205 bits (520), Expect = 9e-51,   Method: Composition-based stats.
 Identities = 159/313 (50%), Positives = 212/313 (67%), Gaps = 1/313 (0%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M+    FPGQGSQ +GMGR+L ++FP AR +F+EVD  L+QNLS LM+ G +++LT T N
Sbjct: 1   MTRAFVFPGQGSQAVGMGRELAEAFPVARQLFQEVDDALSQNLSALMFEGPEDQLTLTEN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRD-ISYVAGHSLGEYTALCAAKAFSLSDTIRLVRAR 119
           AQPAL AVS+A +RV+E  G        ++VAGHSLGEY+AL AA  FS++DT RL++ R
Sbjct: 61  AQPALMAVSLAVVRVLEAEGTFELAKAATFVAGHSLGEYSALAAAGTFSVADTARLLKIR 120

Query: 120 GKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVK 179
           G++MQ+AVP G+G+M A++G +      I A A+   +CE ANDNGG QVV+SG + AV 
Sbjct: 121 GQAMQKAVPVGVGAMAALLGSELEQAREIAALAAEGEVCEAANDNGGSQVVLSGHKAAVD 180

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            A      KG KRA+ LPVSAPFH +LM P +  M+  L  V  + P VP++ N  A+ V
Sbjct: 181 RAIKIAAEKGIKRAIPLPVSAPFHCALMQPAADAMQDALAEVVMKAPRVPLVANVTAAKV 240

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
           +   +I  LLV QVTG VRWRE++ +    GV S+ E+GSGKVL GLAKRIDK LS  S+
Sbjct: 241 TDPADIRDLLVRQVTGTVRWRESVLFMKAEGVASLVELGSGKVLGGLAKRIDKELSGSSV 300

Query: 300 SKVEDIDLALRSI 312
               DI+  L+S+
Sbjct: 301 GAPADIEAFLKSL 313


>gi|94971599|ref|YP_593647.1| [Acyl-carrier-protein] S-malonyltransferase [Candidatus Koribacter
           versatilis Ellin345]
 gi|94553649|gb|ABF43573.1| [Acyl-carrier-protein] S-malonyltransferase [Candidatus Koribacter
           versatilis Ellin345]
          Length = 321

 Score =  204 bits (519), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 125/311 (40%), Positives = 183/311 (58%), Gaps = 4/311 (1%)

Query: 3   TVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQ 62
               FPGQGSQ +GMG++L   +P A+  F+E D  L   LS L W G +++L  T   Q
Sbjct: 8   IAFLFPGQGSQSVGMGKELAALYPVAQETFDEADAALGYRLSQLCWEGPEDQLKMTEITQ 67

Query: 63  PALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKS 122
           PA+   S+A  RV++  G+    +  YVAGHSLGEY+A  AA      D +R VR RGK 
Sbjct: 68  PAILTASVAVWRVLQSKGI----NPQYVAGHSLGEYSAHVAAGTLDFKDAVRTVRNRGKY 123

Query: 123 MQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAA 182
           MQEAVP G+G+M A++ L    V  +C +A++  +C+ AN N   Q VISG + AV+ AA
Sbjct: 124 MQEAVPVGVGAMAAVLMLPADEVKKVCEEAAQGEVCQAANLNSPNQTVISGSKAAVERAA 183

Query: 183 DTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSI 242
           +    +GAKRAV LPVSAPFH +LM P    +   L ++   +P VP+L N   + +++ 
Sbjct: 184 ELAKKRGAKRAVMLPVSAPFHCALMQPAQDRLATDLATLAFHNPEVPVLCNVDVALITTA 243

Query: 243 DEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKV 302
           D     L  QVTG V+W  +++     GVK+  EVG G VL+GL K+I+K+ +  ++   
Sbjct: 244 DAARDTLTRQVTGAVQWDASMRKLIELGVKTFVEVGPGTVLSGLMKQIEKTQTCFNVENE 303

Query: 303 EDIDLALRSIV 313
           + +  A+  ++
Sbjct: 304 DSLQKAMNGLL 314


>gi|311068111|ref|YP_003973034.1| malonyl CoA-acyl carrier protein transacylase [Bacillus atrophaeus
           1942]
 gi|310868628|gb|ADP32103.1| malonyl CoA-acyl carrier protein transacylase [Bacillus atrophaeus
           1942]
          Length = 318

 Score =  204 bits (518), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 126/313 (40%), Positives = 188/313 (60%), Gaps = 5/313 (1%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
                FPGQGSQ IGMG++LY+    ++ +F+E D  L   LS L++ G  EELT T NA
Sbjct: 3   KVAFLFPGQGSQFIGMGKELYERESVSKRIFDEADEALETKLSSLIFEGDAEELTLTYNA 62

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPAL   S+A +   ++ G+       + AGHSLGEY+AL AA A S  D +  VR RG+
Sbjct: 63  QPALLTTSIAILEKFKEAGIT----PDFTAGHSLGEYSALVAAGAISFKDAVYAVRKRGE 118

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQAS-RVGICEIANDNGGGQVVISGLQDAVKC 180
            M EAVP G G+M AI+G+D   +  +  + +    + ++AN N  GQ+VISG    V+ 
Sbjct: 119 FMNEAVPAGEGAMAAILGMDAEALQQVTDKVTEEGNLVQLANLNCPGQIVISGTAKGVEL 178

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A++     GAKRA+ L VS PFHS LM P ++ +  +LD+   +D  VP++ N  A  ++
Sbjct: 179 ASEQAKENGAKRAIPLEVSGPFHSELMKPAAEKLAEVLDACELKDTNVPVISNVSADVMT 238

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
             ++I   L+EQ+   VR+ ETI    + GV    E+G GKVL+GL K++++ L  +++S
Sbjct: 239 EKEDIKAKLIEQLYSPVRFEETINKLIDEGVTVFIEIGPGKVLSGLVKKVNRRLKTIAVS 298

Query: 301 KVEDIDLALRSIV 313
             E I+LAL+++ 
Sbjct: 299 DPETIELALQTLK 311


>gi|258542270|ref|YP_003187703.1| malonyl-CoA-[acyl-carrier-protein (ACP)] transacylase [Acetobacter
           pasteurianus IFO 3283-01]
 gi|256633348|dbj|BAH99323.1| malonyl-CoA-[acyl-carrier-protein (ACP)] transacylase [Acetobacter
           pasteurianus IFO 3283-01]
 gi|256636407|dbj|BAI02376.1| malonyl-CoA-[acyl-carrier-protein (ACP)] transacylase [Acetobacter
           pasteurianus IFO 3283-03]
 gi|256639460|dbj|BAI05422.1| malonyl-CoA-[acyl-carrier-protein (ACP)] transacylase [Acetobacter
           pasteurianus IFO 3283-07]
 gi|256642516|dbj|BAI08471.1| malonyl-CoA-[acyl-carrier-protein (ACP)] transacylase [Acetobacter
           pasteurianus IFO 3283-22]
 gi|256645571|dbj|BAI11519.1| malonyl-CoA-[acyl-carrier-protein (ACP)] transacylase [Acetobacter
           pasteurianus IFO 3283-26]
 gi|256648624|dbj|BAI14565.1| malonyl-CoA-[acyl-carrier-protein (ACP)] transacylase [Acetobacter
           pasteurianus IFO 3283-32]
 gi|256651677|dbj|BAI17611.1| malonyl-CoA-[acyl-carrier-protein (ACP)] transacylase [Acetobacter
           pasteurianus IFO 3283-01-42C]
 gi|256654668|dbj|BAI20595.1| malonyl-CoA-[acyl-carrier-protein (ACP)] transacylase [Acetobacter
           pasteurianus IFO 3283-12]
          Length = 314

 Score =  204 bits (518), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 149/314 (47%), Positives = 203/314 (64%), Gaps = 2/314 (0%)

Query: 1   MST-VLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATC 59
           M+     FPGQGSQ +GMG++L ++FP AR VFEEVD  L + LS +++ G  E LT+T 
Sbjct: 1   MAVYAFIFPGQGSQSVGMGQELAEAFPAARSVFEEVDDALGEKLSKIIFEGPMESLTSTE 60

Query: 60  NAQPALTAVSMAFIRVMEKNGLCVKR-DISYVAGHSLGEYTALCAAKAFSLSDTIRLVRA 118
           NAQPAL AVSMA +RV+E++G       ++ +AGHSLGEY+AL A +AF +++  RL+R 
Sbjct: 61  NAQPALMAVSMAVLRVLEQDGGLDLAGKVTLLAGHSLGEYSALAAGRAFGVAEAARLLRL 120

Query: 119 RGKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAV 178
           RG++MQ+AVP G G M A+IG+     + IC +AS  G  EIANDNGGGQ+VISG    +
Sbjct: 121 RGQAMQKAVPAGEGGMAALIGVTLVQAEDICTKASAKGDVEIANDNGGGQIVISGKSAGI 180

Query: 179 KCAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASP 238
             A         KRA+ LPVSAPFHSSLM P   VM   L       P+VP++ N  A  
Sbjct: 181 DEAIAIAKEMKIKRALKLPVSAPFHSSLMKPAEDVMAEALAKAEITAPIVPVIANVTAER 240

Query: 239 VSSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVS 298
            +  D I + LV QVTGRVRWRE++      GV +  E+G+GKVL+GL +RID  ++ +S
Sbjct: 241 ETDADTIRQNLVRQVTGRVRWRESVAAMVGMGVDTFVEIGAGKVLSGLVRRIDSEVTGLS 300

Query: 299 ISKVEDIDLALRSI 312
           +    DI+  L+++
Sbjct: 301 VGTPADIESFLKTL 314


>gi|284048729|ref|YP_003399068.1| malonyl CoA-acyl carrier protein transacylase [Acidaminococcus
           fermentans DSM 20731]
 gi|283952950|gb|ADB47753.1| malonyl CoA-acyl carrier protein transacylase [Acidaminococcus
           fermentans DSM 20731]
          Length = 315

 Score =  204 bits (518), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 126/314 (40%), Positives = 185/314 (58%), Gaps = 6/314 (1%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
                FPGQGSQ +GM ++LYD++   R VF+E D  L  +++DL + G +++L  T N 
Sbjct: 3   KIAFVFPGQGSQTVGMMKELYDNYACVREVFKEADEALGFSMTDLCFKGPEDQLRLTYNT 62

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPA+   S+A ++V+ +NG+         AGHSLGEY+AL  A +   +D +R VR RG+
Sbjct: 63  QPAILTCSIAAMKVLNENGVF----PDVAAGHSLGEYSALVCAGSLKFADAVRTVRKRGQ 118

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGG--QVVISGLQDAVK 179
            MQEAVP G G+M AII LD   +  ICA+        +   N     QVVI+G  +AVK
Sbjct: 119 FMQEAVPVGQGAMAAIIALDTARIREICAEIQERRGEAVQPVNFNCPGQVVIAGATEAVK 178

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            A D     GAKRA+ LPVSAPFHS+LM P +  +K +LD +   D  +P++ N  A P 
Sbjct: 179 EACDALKAAGAKRAILLPVSAPFHSTLMQPAADRLKEVLDGIEVADAKIPVIANVTARPE 238

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
              DEI ++LV+Q    V W +++++   +GV +  EVG GKVLTG  K+ID+S +  ++
Sbjct: 239 QKGDEIRQVLVKQAASPVLWEDSVRYMMENGVDTFIEVGPGKVLTGFVKKIDRSYTGQNV 298

Query: 300 SKVEDIDLALRSIV 313
             +  ++  L  + 
Sbjct: 299 EDLASLEKTLAYLK 312


>gi|149203966|ref|ZP_01880934.1| acyl-carrier-protein S-malonyltransferase [Roseovarius sp. TM1035]
 gi|149142408|gb|EDM30453.1| acyl-carrier-protein S-malonyltransferase [Roseovarius sp. TM1035]
          Length = 315

 Score =  204 bits (518), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 154/312 (49%), Positives = 213/312 (68%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           MS    FPGQG+QVIGMG DL  S+P AR VF+EVD  L Q LS L+W G+Q+ELT T N
Sbjct: 1   MSRAFVFPGQGAQVIGMGADLAASYPAARAVFDEVDEALGQKLSALIWEGAQDELTLTEN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
           AQPAL A S+A +R +E  G+ + +  S+VAGHSLGEY+AL AA A S++DT RL+R RG
Sbjct: 61  AQPALMATSIAALRALEAEGVNLAKAASHVAGHSLGEYSALAAAGAISVADTARLLRIRG 120

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           ++MQ+AVP G+G+M A++GLD     ++  +A++  +C+ ANDN   QVV+SG + AV+ 
Sbjct: 121 QAMQQAVPVGVGAMAALLGLDFETARAVAQEAAQGEVCQAANDNDPAQVVVSGHKSAVER 180

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A +    +GAKRA+ LPVSAPFH +LM P ++VM   L  V    P VP++ N  A  V+
Sbjct: 181 AVELAKARGAKRAMLLPVSAPFHCALMAPAAEVMAKALSEVAIHAPAVPLVANVRAQAVT 240

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
              EI  LLVEQVTG VRWRE++Q+    GV  ++E+G+GK L+G+ +RI + LS  +I 
Sbjct: 241 DPAEIRALLVEQVTGSVRWRESVQYMEAQGVTEIWEIGAGKALSGMVRRIARDLSCRTIG 300

Query: 301 KVEDIDLALRSI 312
             +++  A  S+
Sbjct: 301 TPDEVTAAAASL 312


>gi|27262212|gb|AAN87387.1| Malonyl-CoA-[acyl-carrier-protein] transacylase [Heliobacillus
           mobilis]
          Length = 308

 Score =  204 bits (518), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 143/312 (45%), Positives = 192/312 (61%), Gaps = 5/312 (1%)

Query: 1   MS-TVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATC 59
           M+     FPGQ SQ +GMG DL   FP A+ VF+E D  L  +LS L + G +EEL  T 
Sbjct: 1   MTQIAFMFPGQCSQFVGMGADLAAQFPLAKAVFDEADEALGFSLSKLCFEGPEEELRLTA 60

Query: 60  NAQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRAR 119
           N QPAL A ++A  RV+  NG        +VAGHSLGEY+AL AA + +L + IRLVR R
Sbjct: 61  NTQPALLATAVAVYRVLAANGF----RPDWVAGHSLGEYSALVAAGSLTLVEGIRLVRQR 116

Query: 120 GKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVK 179
           G  MQ+AVP G G+M AI+GL+   V+++C  AS  G+ E AN NG GQVVI+G   AV+
Sbjct: 117 GLFMQDAVPAGRGTMAAIMGLEAEAVEALCRDASTAGVVEPANFNGAGQVVIAGEVAAVE 176

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            A       GAKR+V L VSAPFH SLM P ++ M  +L +    DP +P++ N  A P 
Sbjct: 177 QAVALAKAAGAKRSVMLNVSAPFHCSLMKPAAERMTEVLQAANISDPTIPLVANVTAQPA 236

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
           +S + + + L+ QV   VRW +++++ A+ GV+   EVG GKVLTGLA++I K     +I
Sbjct: 237 TSGEAVRKNLILQVDHPVRWEQSVKFLADAGVQRFIEVGPGKVLTGLARKIVKGSETAAI 296

Query: 300 SKVEDIDLALRS 311
             V+ I   L S
Sbjct: 297 GDVDTIQKVLAS 308


>gi|282856660|ref|ZP_06265928.1| [acyl-carrier-protein] S-malonyltransferase [Pyramidobacter
           piscolens W5455]
 gi|282585509|gb|EFB90809.1| [acyl-carrier-protein] S-malonyltransferase [Pyramidobacter
           piscolens W5455]
          Length = 316

 Score =  203 bits (517), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 131/305 (42%), Positives = 186/305 (60%), Gaps = 2/305 (0%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M   + FPGQGSQ +GMG++L      A+  F E D  L  +LSD+++NG +++L  T  
Sbjct: 1   MKYAIVFPGQGSQAVGMGKELCGVSRAAKETFAEADEALGFSLSDIIFNGPEDKLVLTAY 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
            QPA+ A+S+A  R +++ G+ +  D ++VAGHSLGEYTAL A+   SL+D +RLV  RG
Sbjct: 61  TQPAILAMSIAVFRALQEKGMTL--DPAFVAGHSLGEYTALVASGVLSLADGVRLVHKRG 118

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
             MQEAVP G+G+M AI+GL+   V +ICA+A++  +CE AN N   Q VISG   AV+ 
Sbjct: 119 SFMQEAVPQGVGAMAAILGLEADAVRAICAEAAQEEVCEAANYNTPVQTVISGHTAAVER 178

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A      KGAKR+V L VSAPFH SLM PV+  +   ++         P++ N  A PVS
Sbjct: 179 AVALASAKGAKRSVMLNVSAPFHCSLMRPVADRLAAEMEKCVWSTGRCPLVANVSARPVS 238

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
            +  I   L  Q    VRW E++Q  A+ GV+   E+G GKVL G  K+ID+    +++ 
Sbjct: 239 DVSAIRDGLYAQTYSPVRWVESVQTMASRGVEGFIEMGPGKVLAGTIKKIDRHAPTLNVE 298

Query: 301 KVEDI 305
           +  D+
Sbjct: 299 QPADL 303


>gi|309789632|ref|ZP_07684213.1| malonyl CoA-acyl carrier protein transacylase [Oscillochloris
           trichoides DG6]
 gi|308228368|gb|EFO82015.1| malonyl CoA-acyl carrier protein transacylase [Oscillochloris
           trichoides DG6]
          Length = 330

 Score =  203 bits (517), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 124/312 (39%), Positives = 165/312 (52%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M+    FPGQGSQ +GMG DLY   P AR +FE+ D  L   LS L + G +  LTAT N
Sbjct: 19  MNAAWVFPGQGSQTVGMGHDLYVHSPTARAIFEQADEVLGFALSHLCFEGPETALTATEN 78

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
           AQPAL  VS+A +RV+E+ G         VAGHSLGEY+AL A  A   +  +RLVR RG
Sbjct: 79  AQPALLTVSIALVRVLEEIGGAALVRPLAVAGHSLGEYSALVAGGALDFATALRLVRRRG 138

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           + M  A    + +++ +   D   +          G   IAN N   Q+VISG   AV  
Sbjct: 139 ELMAAAHEGSMAAVIGLAQPDLEQICEQVNSGDHGGTVVIANYNAPDQLVISGSAAAVAQ 198

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A       GAKR + L VSA FHS LM   ++ M   +     +D  VP++ N  A P+ 
Sbjct: 199 AGQIAKEHGAKRVLGLKVSAAFHSPLMQAAAEGMAHEIAQAEVRDLEVPLIANVSAEPLR 258

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
           S DE+ R +V QVT  VRW  + +    HG  +  E+G GKVLTGL +RI      V++S
Sbjct: 259 SADEVRREVVTQVTAPVRWIASTEAMLAHGCTTFVEIGPGKVLTGLVRRIAPQARLVTLS 318

Query: 301 KVEDIDLALRSI 312
              D+   +  +
Sbjct: 319 SWADVQAFVAQL 330


>gi|163746683|ref|ZP_02154040.1| malonyl CoA-acyl carrier protein transacylase [Oceanibulbus
           indolifex HEL-45]
 gi|161379797|gb|EDQ04209.1| malonyl CoA-acyl carrier protein transacylase [Oceanibulbus
           indolifex HEL-45]
          Length = 310

 Score =  203 bits (517), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 160/308 (51%), Positives = 207/308 (67%), Gaps = 1/308 (0%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           MS    FPGQG+Q IGMGRDL D++PEAR VF+EVD  L + LS+L+W G  E LT T N
Sbjct: 1   MSIAFVFPGQGAQTIGMGRDLADAYPEARAVFDEVDAALGEKLSELIWEGDIETLTLTQN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
           AQPAL A SMA +  ++  G+ V    +YVAGHSLGEY+ALCAA + SLSDT RL+R RG
Sbjct: 61  AQPALMATSMAAMAALKAEGITVD-KAAYVAGHSLGEYSALCAAGSLSLSDTARLLRIRG 119

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           K+MQ AVP G G+M AI+GL     + +   A+   +C++AN+N   Q V+SG + AV+ 
Sbjct: 120 KAMQAAVPVGEGAMAAILGLGIEETEKLAEAAAEGEVCQVANENDPSQNVLSGHKAAVER 179

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A     + GAKRA+ LPVSAPFH  LM P ++ M   L  VT  DP VP++ N  A  VS
Sbjct: 180 AVAMAKDAGAKRALLLPVSAPFHCPLMGPAAEEMAKALGEVTFNDPTVPLVANVTAEAVS 239

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
              +IS LLVEQVTGRVRWR +++W A  GV  V+E+G+GK LTG+ +RIDKSL   +I 
Sbjct: 240 DAQKISDLLVEQVTGRVRWRSSVEWMAAQGVTEVWEIGAGKALTGMIRRIDKSLVTRNIG 299

Query: 301 KVEDIDLA 308
             +++  A
Sbjct: 300 TPDEVKAA 307


>gi|115377148|ref|ZP_01464362.1| malonyl CoA-acyl carrier protein transacylase [Stigmatella
           aurantiaca DW4/3-1]
 gi|310822855|ref|YP_003955213.1| malonyl CoA-acyl carrier protein transacylase [Stigmatella
           aurantiaca DW4/3-1]
 gi|115365857|gb|EAU64878.1| malonyl CoA-acyl carrier protein transacylase [Stigmatella
           aurantiaca DW4/3-1]
 gi|309395927|gb|ADO73386.1| Malonyl CoA-acyl carrier protein transacylase [Stigmatella
           aurantiaca DW4/3-1]
          Length = 312

 Score =  203 bits (516), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 132/311 (42%), Positives = 179/311 (57%), Gaps = 4/311 (1%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
                FPGQGSQ +GMG+DL++ FPEAR VFE VD  L   LS   ++G ++EL  T N 
Sbjct: 3   KVAFVFPGQGSQKVGMGKDLFEKFPEARAVFEAVDDVLGDKLSARCFDGPEDELKLTANT 62

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPA+  +S+A   V  + G       ++VAGHSLGEY+AL AA A +L D  + VR RG 
Sbjct: 63  QPAILTMSLAVHAVFSQRG----PAPAFVAGHSLGEYSALVAAGALALGDAAQAVRKRGT 118

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCA 181
            MQEAVP G G+M A++GL+   V ++C   +   +   AN N   Q VI+G   AVK A
Sbjct: 119 FMQEAVPVGTGAMAAVLGLEPGQVKAVCDAVAEGEVLAPANYNSPEQTVIAGHTAAVKRA 178

Query: 182 ADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSS 241
                  GAKR + LPVSAPFH +LM PV  ++  +L  +    P +P++ N  A P S 
Sbjct: 179 EAKLKEAGAKRVMHLPVSAPFHCTLMDPVKPLLLDVLGKMKVSAPRIPVVSNVEARPNSE 238

Query: 242 IDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISK 301
              +  LLVEQV+  VRW E ++     GV  V E+G GKVL GL KRI+K +   +I  
Sbjct: 239 AARVVPLLVEQVSAPVRWLECVEALHAEGVTRVVELGPGKVLAGLVKRINKGIETFNIED 298

Query: 302 VEDIDLALRSI 312
              ++  L ++
Sbjct: 299 SASLEKTLAAL 309


>gi|218671380|ref|ZP_03521050.1| [acyl-carrier-protein] S-malonyltransferase protein [Rhizobium etli
           GR56]
          Length = 314

 Score =  203 bits (515), Expect = 3e-50,   Method: Composition-based stats.
 Identities = 180/312 (57%), Positives = 242/312 (77%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M+   TFPGQGSQ +GMG+DL ++F EAR VFEEVD  L + LSD+M++G ++ LT T N
Sbjct: 1   MTIAFTFPGQGSQAVGMGKDLAENFAEARAVFEEVDEALGEKLSDVMFSGPEDTLTLTAN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
           AQPAL AVS+A +RV++  GL +K  +++VAGHSLGEY+ALCAA  FSL+DT RL+R RG
Sbjct: 61  AQPALMAVSIAVVRVLQAKGLDLKSKVAFVAGHSLGEYSALCAAGTFSLADTARLLRIRG 120

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
            +MQ AVP G+G+M AIIGL+   V ++C +A+  G C+IANDNGGGQ+VISG + AV+ 
Sbjct: 121 NAMQAAVPVGVGAMAAIIGLEHADVIAVCEEAAVTGACQIANDNGGGQIVISGEKAAVEK 180

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           AA    +KGAKRA+ LPVSAPFHS LM P ++ M+  L +V K DP+VP++ N  A+PV+
Sbjct: 181 AAGLATDKGAKRAILLPVSAPFHSKLMAPAAEAMRAALATVAKSDPLVPLIANVRAAPVT 240

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
             DEI+ LLVEQVTG+VRWRET++WFA +GV ++YE+GSGKVLTGLA+RIDK+++ +S+ 
Sbjct: 241 DADEIANLLVEQVTGQVRWRETVEWFAGNGVTTLYELGSGKVLTGLARRIDKTVNGISVG 300

Query: 301 KVEDIDLALRSI 312
              DID A+ ++
Sbjct: 301 GPADIDAAVAAL 312


>gi|1502420|gb|AAC44306.1| malonyl-CoA:Acyl carrier protein transacylase [Bacillus subtilis
           subsp. subtilis str. 168]
          Length = 318

 Score =  203 bits (515), Expect = 4e-50,   Method: Composition-based stats.
 Identities = 121/314 (38%), Positives = 179/314 (57%), Gaps = 6/314 (1%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
                FPGQGSQ IGMG++LY+  P A+ +F+E D TL   LS L++ G  EELT T NA
Sbjct: 3   KIAFLFPGQGSQFIGMGKELYEQVPAAKRLFDEADETLETKLSSLIFEGDAEELTLTYNA 62

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPAL   S+A +   +++G+       + AGHSLGEY+AL AA A S  D +  VR RG+
Sbjct: 63  QPALLTTSIAVLEKFKESGIT----PDFTAGHSLGEYSALVAAGALSFKDAVYTVRKRGE 118

Query: 122 SMQEAVPPGLGSMVAII--GLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVK 179
            M EA         A I     + +            + ++AN N  GQ+VISG    V+
Sbjct: 119 FMNEAGCRLAKEQWAAILGMDAEALKQVTDKVTEEGNLVQLANLNCPGQIVISGTAKGVE 178

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            A++     GAKRA+ L VS PFHS LM P ++ +K +LD+   +D  VP++ N  A  +
Sbjct: 179 LASELAKENGAKRAIPLEVSGPFHSELMKPAAEKLKEVLDACDIKDADVPVISNVSADVM 238

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
           +   +I   L+EQ+   VR+ E+I      GV +  E+G GKVL+GL K++++ L  +++
Sbjct: 239 TEKADIKEKLIEQLYSPVRFEESINKLIAEGVTTFIEIGPGKVLSGLVKKVNRRLKTIAV 298

Query: 300 SKVEDIDLALRSIV 313
           S  E I+LA++++ 
Sbjct: 299 SDPETIELAIQTLK 312


>gi|300114116|ref|YP_003760691.1| malonyl CoA-acyl carrier protein transacylase [Nitrosococcus
           watsonii C-113]
 gi|299540053|gb|ADJ28370.1| malonyl CoA-acyl carrier protein transacylase [Nitrosococcus
           watsonii C-113]
          Length = 315

 Score =  202 bits (514), Expect = 4e-50,   Method: Composition-based stats.
 Identities = 130/313 (41%), Positives = 167/313 (53%), Gaps = 3/313 (0%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
                FPGQGSQ IGM  D Y+ +P+ R  F++    +  +L  L+  G +E+L  T   
Sbjct: 3   KLAFVFPGQGSQTIGMLADFYEPYPQVRETFDQASAAVRYDLWKLVQEGPEEKLNRTDYT 62

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPA+ A  +A  R+         R   ++AGHSLGEYTAL  A A      I LV  RG+
Sbjct: 63  QPAMLAAGVAVWRIWCA---AEGRSPDFMAGHSLGEYTALVCAGALEFVSAIGLVADRGR 119

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCA 181
            M EAV    G+M AI+GL D VV SIC Q+S   I E  N N  GQVVI+G  DA+  A
Sbjct: 120 YMLEAVSEPEGAMAAILGLPDDVVKSICEQSSEGQIVEAVNFNAPGQVVIAGHTDAIHRA 179

Query: 182 ADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSS 241
                  GAKRAVFLPVS P H  LM P +K ++  L     + P +P++ N   +    
Sbjct: 180 VSKAKEMGAKRAVFLPVSVPSHCQLMGPAAKQLRQRLSEYMIETPSIPVVNNVDVTVNED 239

Query: 242 IDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISK 301
              I   L  QV   VRW ETI W  + GV  + E G GKVLTGL +RIDKS++ + IS 
Sbjct: 240 PHTICDALARQVNHPVRWVETITWLKSQGVDVLIECGPGKVLTGLIRRIDKSMTVLPISD 299

Query: 302 VEDIDLALRSIVG 314
              ++ AL    G
Sbjct: 300 PAGLEKALNITAG 312


>gi|88607175|ref|YP_504720.1| malonyl CoA-acyl carrier protein transacylase [Anaplasma
           phagocytophilum HZ]
 gi|88598238|gb|ABD43708.1| malonyl CoA-acyl carrier protein transacylase [Anaplasma
           phagocytophilum HZ]
          Length = 319

 Score =  202 bits (513), Expect = 5e-50,   Method: Composition-based stats.
 Identities = 136/313 (43%), Positives = 197/313 (62%), Gaps = 5/313 (1%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           MSTV  FPGQGSQ +GMG+++Y++F  AR VF EVD TL +NLSD+++NG +E LT+TCN
Sbjct: 1   MSTVFMFPGQGSQFVGMGKEVYENFAVAREVFHEVDETLGRNLSDIIFNGPEEVLTSTCN 60

Query: 61  AQPALTAVSMAFIRVMEK-NGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRAR 119
           AQ AL  VS+A +R +E   G+ + R   YV GHS+GEYTALCAA    L   +R++  R
Sbjct: 61  AQLALMTVSIAVVRAVEHVVGMPLDRYARYVIGHSVGEYTALCAAGVIDLPTAVRILDVR 120

Query: 120 GKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVK 179
            ++M +A     G M A+IG     V+++   AS+ G+CEIANDN  GQ+V+SG  +A++
Sbjct: 121 SRAMGKASEMCQGGMSALIGGCVEDVEAVVQAASKFGVCEIANDNCNGQIVVSGTNEALE 180

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
              +  +    +R + L VS PFHSSLM P  + ++  + ++  + P + I+ N  AS  
Sbjct: 181 ALPELVVGTAVRRVIRLRVSGPFHSSLMHPAYEELRDFVSTLELKAPKIGIVYNVSASEH 240

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
              D I  L+  QV  RVRWRE+I++   HG     E G G+VLTGL +RID+++  VS+
Sbjct: 241 EDCDVIKDLMARQVVSRVRWRESIEYLLGHGCSEFVEAGPGEVLTGLLRRIDRTVRCVSV 300

Query: 300 SKVEDIDLALRSI 312
             V+    A+R +
Sbjct: 301 CAVD----AMREL 309


>gi|288958516|ref|YP_003448857.1| [acyl-carrier-protein] S-malonyltransferase [Azospirillum sp. B510]
 gi|288910824|dbj|BAI72313.1| [acyl-carrier-protein] S-malonyltransferase [Azospirillum sp. B510]
          Length = 313

 Score =  202 bits (513), Expect = 5e-50,   Method: Composition-based stats.
 Identities = 167/313 (53%), Positives = 211/313 (67%), Gaps = 1/313 (0%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M+    FPGQGSQ +GMGR+L ++F  AR  FEEVD  LNQ LS LM  G + +LT T N
Sbjct: 1   MTRAFVFPGQGSQAVGMGRELAEAFEVARHTFEEVDDALNQRLSRLMVEGPEADLTLTEN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDI-SYVAGHSLGEYTALCAAKAFSLSDTIRLVRAR 119
           AQPAL AVS+A +RV+   G        S+VAGHSLGEY+ALCAA AFSL+DT RL++ R
Sbjct: 61  AQPALMAVSVAVMRVLASEGGVDLSRHASFVAGHSLGEYSALCAAGAFSLADTARLLKLR 120

Query: 120 GKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVK 179
           G++MQ+AVP G G+M A++G D     +I A A++  +C IANDN  GQVVISG  DA+ 
Sbjct: 121 GQAMQKAVPVGKGAMAALLGADLEQARAIAADAAQGEVCSIANDNSVGQVVISGGADAID 180

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            A      +G KR+V LPVSAPFH +LM P +  M   L +VT   PVVP++ N  AS V
Sbjct: 181 RAIVLAAERGLKRSVRLPVSAPFHCALMQPAADAMAEALGNVTISAPVVPVVANVTASAV 240

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
           S  + I RLLVEQVTG VRWRE +      GV+ + EVGSGKVL GLAKRIDK L+AVS+
Sbjct: 241 SDPNAIRRLLVEQVTGMVRWRECVLSMKEQGVERLVEVGSGKVLAGLAKRIDKDLAAVSV 300

Query: 300 SKVEDIDLALRSI 312
               D++  L+++
Sbjct: 301 GTPADVESFLKTL 313


>gi|254559143|ref|YP_003066238.1| malonyl-CoA-[acyl-carrier-protein] transacylase [Methylobacterium
           extorquens DM4]
 gi|254266421|emb|CAX22185.1| malonyl-CoA-[acyl-carrier-protein] transacylase [Methylobacterium
           extorquens DM4]
          Length = 310

 Score =  202 bits (513), Expect = 5e-50,   Method: Composition-based stats.
 Identities = 154/308 (50%), Positives = 206/308 (66%), Gaps = 1/308 (0%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M+    FPGQGSQ +GMG+ L ++FP AR VFEEVD  L QNLS LM+ G  +ELT T N
Sbjct: 1   MTRAFIFPGQGSQAVGMGKALSEAFPAARQVFEEVDAALGQNLSRLMFEGPSDELTLTAN 60

Query: 61  AQPALTAVSMAFIRVME-KNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRAR 119
           AQPAL A S+A +R +E + GL + RD ++VAGHSLGEY+AL AA  FS+SDT RL+R R
Sbjct: 61  AQPALMAASLAVLRTLEAERGLDLARDAAFVAGHSLGEYSALAAAGTFSISDTARLLRIR 120

Query: 120 GKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVK 179
           G++MQ AV PG+G+M A+IG D      I  +A+   +C++ANDNGGGQVV+SG ++AV+
Sbjct: 121 GEAMQRAVAPGIGAMAALIGPDLATARDIGGEAAEGLVCDVANDNGGGQVVLSGHREAVE 180

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            A     ++G +RAV L VSAPFH +LM P ++ M+  L  V    P VP+  N  A P+
Sbjct: 181 RAMALAQSRGVRRAVLLNVSAPFHCALMAPAAEAMRRALAEVPMHAPAVPVYANVTAGPL 240

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
           +  D I   L+ QVTG VRW E++   A  GV   +E+G+GKVLTGL KRI  S +A ++
Sbjct: 241 TEPDAIRNALITQVTGTVRWSESVAAMAEAGVDRFFELGAGKVLTGLVKRIAPSATASAV 300

Query: 300 SKVEDIDL 307
              +D+  
Sbjct: 301 GTPDDVAA 308


>gi|86357080|ref|YP_468972.1| [acyl-carrier protein] S-malonyltransferase protein [Rhizobium etli
           CFN 42]
 gi|86281182|gb|ABC90245.1| [acyl-carrier protein] S-malonyltransferase protein [Rhizobium etli
           CFN 42]
          Length = 316

 Score =  202 bits (513), Expect = 5e-50,   Method: Composition-based stats.
 Identities = 183/312 (58%), Positives = 241/312 (77%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M+   TFPGQGSQ +GMG+DL ++F EAR V EEVD  L + LSD+M+NG ++ LT T N
Sbjct: 3   MTIAFTFPGQGSQAVGMGKDLAENFAEARAVLEEVDEALGEKLSDVMFNGPEDTLTLTAN 62

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
           AQPAL AVS+A IRV++  GL +K  ++YVAGHSLGEY+ALCAA  FSL+DT RL+R RG
Sbjct: 63  AQPALMAVSIAVIRVLQAKGLDLKSKVAYVAGHSLGEYSALCAAGTFSLADTARLLRIRG 122

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
            +MQ AVP G+G+M AIIGL+   V ++C +A+  G C+IANDNGGGQ+VISG + AV+ 
Sbjct: 123 NAMQAAVPVGVGAMAAIIGLEHADVVAVCEEAAATGACQIANDNGGGQIVISGEKAAVEK 182

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           AA    ++GAKRA+ LPVSAPFHS LM P ++ M+  L +V K DPVVP++ N  A+PVS
Sbjct: 183 AAGLATDRGAKRAILLPVSAPFHSKLMAPAAEAMRAALATVAKSDPVVPLIANVRAAPVS 242

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
             DEI+ LLVEQVTG+VRWRET++WFA +GV ++YE+GSGKVLTGLA+RIDK+++ +S+ 
Sbjct: 243 GADEIASLLVEQVTGQVRWRETVEWFAGNGVTTLYELGSGKVLTGLARRIDKTVNGISVG 302

Query: 301 KVEDIDLALRSI 312
              DID A+ ++
Sbjct: 303 GPADIDAAVAAL 314


>gi|190891124|ref|YP_001977666.1| [acyl-carrier-protein] S-malonyltransferase [Rhizobium etli CIAT
           652]
 gi|190696403|gb|ACE90488.1| [acyl-carrier-protein] S-malonyltransferase protein [Rhizobium etli
           CIAT 652]
          Length = 314

 Score =  202 bits (513), Expect = 6e-50,   Method: Composition-based stats.
 Identities = 182/312 (58%), Positives = 240/312 (76%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M+   TFPGQGSQ +GMG+DL ++F EAR VFEEVD  L + LSD+M+NG ++ LT T N
Sbjct: 1   MTIAFTFPGQGSQAVGMGKDLAENFAEARAVFEEVDEALGEKLSDVMFNGPEDTLTLTAN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
           AQPAL AVS+A +RV++  GL +K  ++YVAGHSLGEY+ALCAA  FSL+DT RL+R RG
Sbjct: 61  AQPALMAVSIAVVRVLQAKGLDLKAKVAYVAGHSLGEYSALCAAGTFSLADTARLLRIRG 120

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
            +MQ AVP G+G+M AIIGL+   V +IC +A+  G C+IANDNGGGQ+VISG + AV+ 
Sbjct: 121 NAMQAAVPVGVGAMAAIIGLEHADVVAICEEAAATGACQIANDNGGGQIVISGEKAAVEK 180

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           AA    +KGAKRA+ LPVSAPFHS LM P ++ M+  L +V K DPVVP++ N  A+PV+
Sbjct: 181 AAGLATDKGAKRAILLPVSAPFHSKLMAPAAEAMRAALATVAKSDPVVPLIANVRAAPVT 240

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
              EI+ LLVEQVTG+VRWRET++WFA +GV ++YE+GSGKVLTGLA+RIDK+++ +S+ 
Sbjct: 241 DAGEIATLLVEQVTGQVRWRETVEWFAGNGVTTLYELGSGKVLTGLARRIDKTVNGISVG 300

Query: 301 KVEDIDLALRSI 312
              DID  + ++
Sbjct: 301 GPADIDAVVAAL 312


>gi|326203622|ref|ZP_08193486.1| malonyl CoA-acyl carrier protein transacylase [Clostridium
           papyrosolvens DSM 2782]
 gi|325986442|gb|EGD47274.1| malonyl CoA-acyl carrier protein transacylase [Clostridium
           papyrosolvens DSM 2782]
          Length = 310

 Score =  202 bits (512), Expect = 7e-50,   Method: Composition-based stats.
 Identities = 122/312 (39%), Positives = 186/312 (59%), Gaps = 4/312 (1%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
                FPGQG+Q +GMG+++ D +  A  +F+E    L  ++ ++++N   E L  T N 
Sbjct: 3   KVAFLFPGQGAQYVGMGKEIADEYKSAGKIFDEATEALGFDVREMIFNSDDETLKITENT 62

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QP +   S+A ++ + + G+       +VAG SLGEY A  AA   S  D + LV+ RGK
Sbjct: 63  QPTIVTTSIACMQPLLEKGI----KPDFVAGLSLGEYAAHVAAGTVSFKDAVSLVKKRGK 118

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCA 181
            MQEAVP G+G+M AIIGL++  V   C +AS +GI E AN N  GQ+V++G   AV+ A
Sbjct: 119 YMQEAVPLGVGAMAAIIGLENDDVIECCKEASEIGIVEPANFNCPGQIVVAGETAAVEKA 178

Query: 182 ADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSS 241
           A+ C  KGAKRA+ LPVSAPFH SL+ P  + +   L+ V+ +D  +P++ N     V+ 
Sbjct: 179 AELCKTKGAKRAMLLPVSAPFHCSLLKPAGEKLAAELEKVSFKDMKIPVVSNVTGDAVTD 238

Query: 242 IDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISK 301
              +  LL+ QV+  V W + I    + GV +  E+G GKVL+G  K+IDK+++ ++I  
Sbjct: 239 KSMVKELLIRQVSTSVLWEKCISTMLDKGVNTFVEIGPGKVLSGFVKKIDKNVTVINIEN 298

Query: 302 VEDIDLALRSIV 313
           +E ++ AL  + 
Sbjct: 299 LETLNKALEVLA 310


>gi|222148140|ref|YP_002549097.1| malonyl CoA-acyl carrier protein transacylase [Agrobacterium vitis
           S4]
 gi|221735128|gb|ACM36091.1| malonyl CoA-acyl carrier protein transacylase [Agrobacterium vitis
           S4]
          Length = 314

 Score =  202 bits (512), Expect = 8e-50,   Method: Composition-based stats.
 Identities = 181/312 (58%), Positives = 234/312 (75%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M    TFPGQGSQV+GMG+DL ++FPEAR VFEEVD  L + LSD+MWNGS E+LT T N
Sbjct: 1   MGVAFTFPGQGSQVVGMGKDLAEAFPEARTVFEEVDDALGEKLSDVMWNGSVEDLTLTAN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
           AQPAL AVS+A +RVME  G  + R +SYVAGHSLGEY+ALCAA  FSL+DT RL+R RG
Sbjct: 61  AQPALMAVSIAVLRVMEARGFSLARKVSYVAGHSLGEYSALCAAGTFSLADTARLLRIRG 120

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
            +MQ AVP G G+M AI+GL+   V+ +C  AS  G  +IANDNGGGQ+VISG + AV+ 
Sbjct: 121 NAMQAAVPVGAGAMAAILGLEHGDVEKVCKAASSDGPVQIANDNGGGQLVISGAKAAVEK 180

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A+   + KGAKRA+ LPVSAPFHS+LM P +  M   L +V  + PVVP++ N  A PVS
Sbjct: 181 ASVLAMEKGAKRAIMLPVSAPFHSTLMGPAADAMAQALATVEMKAPVVPLIANVVAVPVS 240

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
             +EI RLLVEQVTG+VRWRET++WF+++ V  +YE+G+GKVL+GL +RIDK+++  ++ 
Sbjct: 241 DPNEIRRLLVEQVTGQVRWRETVEWFSHNAVSVLYEIGAGKVLSGLVRRIDKNITGTAVG 300

Query: 301 KVEDIDLALRSI 312
              DI+ AL ++
Sbjct: 301 SPADIEAALTAL 312


>gi|188579795|ref|YP_001923240.1| malonyl CoA-acyl carrier protein transacylase [Methylobacterium
           populi BJ001]
 gi|179343293|gb|ACB78705.1| malonyl CoA-acyl carrier protein transacylase [Methylobacterium
           populi BJ001]
          Length = 310

 Score =  202 bits (512), Expect = 8e-50,   Method: Composition-based stats.
 Identities = 152/308 (49%), Positives = 206/308 (66%), Gaps = 1/308 (0%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M+    FPGQGSQ +GMG+ L ++ P AR VFEEVD  L QNLS LM+ G  +ELT T N
Sbjct: 1   MTRAFIFPGQGSQAVGMGKALSEASPAARQVFEEVDAALGQNLSQLMFEGPSDELTLTAN 60

Query: 61  AQPALTAVSMAFIRVME-KNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRAR 119
           AQPAL A S+A +R +E + GL + RD ++VAGHSLGEY+AL AA  FS+SD  RL+R R
Sbjct: 61  AQPALMAASLAVLRTLEAERGLDLARDAAFVAGHSLGEYSALAAAGTFSISDAARLLRIR 120

Query: 120 GKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVK 179
           G++MQ AV PG+G+M A++G D      I  +A++  +C++ANDNG GQVV+SG ++AV+
Sbjct: 121 GEAMQRAVAPGVGAMAALLGPDLATARDIAEEAAQGMVCDVANDNGAGQVVLSGHREAVE 180

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            A      +G +RAV L VSAPFH +LM P ++ M+  L  VT + PVVP+  N  A P+
Sbjct: 181 RAMALAQGRGVRRAVLLNVSAPFHCALMAPAAEAMRRALAEVTMRAPVVPVYANVTAGPL 240

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
           +  D I   LV QVTG VRW E++   A  GV   +E+G+GKVLTGL KRI  + +A ++
Sbjct: 241 TEPDAIRDALVSQVTGTVRWAESVAAMAEAGVDRFHELGAGKVLTGLVKRIAPNATAGAV 300

Query: 300 SKVEDIDL 307
              +D+  
Sbjct: 301 GTPDDVAA 308


>gi|16078653|ref|NP_389472.1| malonyl CoA:acyl carrier protein transacylase [Bacillus subtilis
           subsp. subtilis str. 168]
 gi|221309465|ref|ZP_03591312.1| acyl-carrier-protein S-malonyltransferase [Bacillus subtilis subsp.
           subtilis str. 168]
 gi|221313790|ref|ZP_03595595.1| acyl-carrier-protein S-malonyltransferase [Bacillus subtilis subsp.
           subtilis str. NCIB 3610]
 gi|221318714|ref|ZP_03600008.1| acyl-carrier-protein S-malonyltransferase [Bacillus subtilis subsp.
           subtilis str. JH642]
 gi|221322985|ref|ZP_03604279.1| acyl-carrier-protein S-malonyltransferase [Bacillus subtilis subsp.
           subtilis str. SMY]
 gi|321315356|ref|YP_004207643.1| malonyl CoA:acyl carrier protein transacylase [Bacillus subtilis
           BSn5]
 gi|7404378|sp|P71019|FABD_BACSU RecName: Full=Malonyl CoA-acyl carrier protein transacylase;
           Short=MCT
 gi|2337819|emb|CAA74249.1| putative FabD protein [Bacillus subtilis subsp. subtilis str. 168]
 gi|2633962|emb|CAB13463.1| malonyl CoA:acyl carrier protein transacylase [Bacillus subtilis
           subsp. subtilis str. 168]
 gi|320021630|gb|ADV96616.1| malonyl CoA:acyl carrier protein transacylase [Bacillus subtilis
           BSn5]
          Length = 317

 Score =  201 bits (511), Expect = 9e-50,   Method: Composition-based stats.
 Identities = 128/313 (40%), Positives = 191/313 (61%), Gaps = 5/313 (1%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
                FPGQGSQ IGMG++LY+  P A+ +F+E D TL   LS L++ G  EELT T NA
Sbjct: 3   KIAFLFPGQGSQFIGMGKELYEQVPAAKRLFDEADETLETKLSSLIFEGDAEELTLTYNA 62

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPAL   S+A +   +++G+       + AGHSLGEY+AL AA A S  D +  VR RG+
Sbjct: 63  QPALLTTSIAVLEKFKESGIT----PDFTAGHSLGEYSALVAAGALSFKDAVYTVRKRGE 118

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQAS-RVGICEIANDNGGGQVVISGLQDAVKC 180
            M EAVP G G+M AI+G+D   +  +  + +    + ++AN N  GQ+VISG    V+ 
Sbjct: 119 FMNEAVPAGEGAMAAILGMDAEALKQVTDKVTEEGNLVQLANLNCPGQIVISGTAKGVEL 178

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A++     GAKRA+ L VS PFHS LM P ++ +K +LD+   +D  VP++ N  A  ++
Sbjct: 179 ASELAKENGAKRAIPLEVSGPFHSELMKPAAEKLKEVLDACDIKDADVPVISNVSADVMT 238

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
              +I   L+EQ+   VR+ E+I      GV +  E+G GKVL+GL K++++ L  +++S
Sbjct: 239 EKADIKEKLIEQLYSPVRFEESINKLIAEGVTTFIEIGPGKVLSGLVKKVNRRLKTIAVS 298

Query: 301 KVEDIDLALRSIV 313
             E I+LA++++ 
Sbjct: 299 DPETIELAIQTLK 311


>gi|209964873|ref|YP_002297788.1| malonyl CoA-acyl carrier protein transacylase [Rhodospirillum
           centenum SW]
 gi|209958339|gb|ACI98975.1| malonyl CoA-acyl carrier protein transacylase [Rhodospirillum
           centenum SW]
          Length = 311

 Score =  201 bits (511), Expect = 9e-50,   Method: Composition-based stats.
 Identities = 155/311 (49%), Positives = 205/311 (65%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M+    FPGQGSQ +GMGR+L  +F  AR  F+EVD  L Q LS LM+ G +++LT T N
Sbjct: 1   MTRAFVFPGQGSQAVGMGRELAGAFEIARDTFQEVDEALGQKLSALMFEGPEDQLTLTEN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
           AQPAL AVS+A +RV+E  G+ + R  ++VAGHSLGEY+ALCAA   SL+DT RL++ RG
Sbjct: 61  AQPALMAVSVAVLRVLEAGGVDLARSAAFVAGHSLGEYSALCAAGTLSLADTARLLKLRG 120

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           +SMQ+AVP G+G+M AI+G D      I A A+   +C  ANDN  GQVV+SG + AV+ 
Sbjct: 121 RSMQKAVPVGVGAMAAILGADLEAAQEIAAAAAEGEVCTTANDNAPGQVVVSGHKGAVER 180

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A      +G KRAV LPVSAPFH  LM P +  M   L  VT + P VP++ N  A+ V+
Sbjct: 181 AIRLAAERGFKRAVLLPVSAPFHCPLMQPAADAMAEALAGVTLKAPRVPLVANVTAAAVT 240

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
             + I  LLV+QVTG VRWRE++ +    GV    E+G+GKVL GL KRIDK ++A S+ 
Sbjct: 241 DPEAIRGLLVQQVTGMVRWRESVAYMKQQGVTEAVELGAGKVLAGLVKRIDKEIAATSVG 300

Query: 301 KVEDIDLALRS 311
              D++  L +
Sbjct: 301 TPADVETFLNA 311


>gi|225873529|ref|YP_002754988.1| malonyl CoA-acyl carrier protein transacylase [Acidobacterium
           capsulatum ATCC 51196]
 gi|225792154|gb|ACO32244.1| malonyl CoA-acyl carrier protein transacylase [Acidobacterium
           capsulatum ATCC 51196]
          Length = 315

 Score =  201 bits (511), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 122/317 (38%), Positives = 180/317 (56%), Gaps = 9/317 (2%)

Query: 1   MST---VLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTA 57
           MST   V  FPGQ SQ +GMGRDLY+ FP AR  FEE D  L  ++S L + G +++L  
Sbjct: 1   MSTPTLVFLFPGQNSQSVGMGRDLYEQFPVARRTFEEADEALGFSVSKLCFEGPEDQLKL 60

Query: 58  TCNAQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVR 117
           T   QPA+  VS+A +RV+++ G+       +VAGHSLGEY A  AA + + +D +R VR
Sbjct: 61  TEFQQPAICTVSVAALRVLQERGI----QPGFVAGHSLGEYAANVAAGSLAFADAVRTVR 116

Query: 118 ARGKSMQEAVP--PGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQ 175
            RG  MQ+AVP   G  + +  I  +        A   +  I   AN N   Q VISG  
Sbjct: 117 HRGAYMQQAVPAGKGAMAAILGISSEAAAEACAAAALEKGSIVSAANFNSPEQTVISGEA 176

Query: 176 DAVKCAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFC 235
            AV+ A + C  +GAKR V L VSAPFH +LM P    +  +L  +T  D  +P++ N  
Sbjct: 177 AAVERACELCKERGAKRVVPLQVSAPFHCALMQPAQDQLAKLLHELTFADANMPVVVNVD 236

Query: 236 ASPVSSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLS 295
           A+ V++ + +   L+ QVTG VRW E+++   +       EVG G+VL+GL ++ID++ S
Sbjct: 237 AAMVTTANVLRDALIRQVTGTVRWVESVRNLIDKQPAHFVEVGPGRVLSGLMRQIDRAQS 296

Query: 296 AVSISKVEDIDLALRSI 312
            +++     ++  L ++
Sbjct: 297 CLNVEDKASLEKTLAAL 313


>gi|226330534|ref|ZP_03806052.1| hypothetical protein PROPEN_04452 [Proteus penneri ATCC 35198]
 gi|225201329|gb|EEG83683.1| hypothetical protein PROPEN_04452 [Proteus penneri ATCC 35198]
          Length = 310

 Score =  201 bits (511), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 121/310 (39%), Positives = 176/310 (56%), Gaps = 4/310 (1%)

Query: 1   MS-TVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATC 59
           M+   + FPGQGSQ +GM  +L + +P     F +    L  +L DL+ NG +EEL  T 
Sbjct: 1   MTDFAMVFPGQGSQSVGMLAELAEQYPIVTETFAQASDVLGYSLWDLVQNGPEEELNKTW 60

Query: 60  NAQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRAR 119
             QPAL A S+A  RV ++      +    +AGHSLGEY+AL  A     +  I+LV  R
Sbjct: 61  KTQPALLAASVAIWRVWQEKQG---KMPQMMAGHSLGEYSALVCAGVIDFAAAIKLVELR 117

Query: 120 GKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVK 179
           G+ MQEAVP G G+M AIIGLD+  +   C +A++  +    N N  GQVVI+G ++AV+
Sbjct: 118 GQLMQEAVPAGTGAMYAIIGLDNDAIAKACEEAAQGQVVSPVNFNSPGQVVIAGNKEAVE 177

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            A   C   GAKRA+ L VS P H +LM P +  +   L  +  + P + ++ N      
Sbjct: 178 RAGVLCKEAGAKRALPLAVSVPSHCALMKPAADKLAVALQEIEFKQPEIQVVNNVDVKAQ 237

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
           +  + I   LV Q+   VRW ET+++ A  G+  + E+G GKVLTGL KRI K ++A ++
Sbjct: 238 TDANAIRDALVRQLYNPVRWTETVEFIAEKGITQLLEIGPGKVLTGLTKRISKEMNAAAV 297

Query: 300 SKVEDIDLAL 309
           + +  +D AL
Sbjct: 298 NDIASLDAAL 307


>gi|157692270|ref|YP_001486732.1| [Acyl-carrier-protein] S-malonyltransferase [Bacillus pumilus
           SAFR-032]
 gi|157681028|gb|ABV62172.1| [Acyl-carrier-protein] S-malonyltransferase [Bacillus pumilus
           SAFR-032]
          Length = 314

 Score =  201 bits (511), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 133/314 (42%), Positives = 191/314 (60%), Gaps = 5/314 (1%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
                FPGQGSQ IGMG+DL+D    ++ VFEE D TL  +LS +++ G  EELT T NA
Sbjct: 3   KIAFLFPGQGSQKIGMGKDLFDQEAVSKAVFEEADKTLGFDLSSMIFEGEAEELTLTYNA 62

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPAL   S+A ++  E++G+       Y AGHSLGEYTAL AA A S  D +  V  RG+
Sbjct: 63  QPALLTTSIAILKKFEESGI----KADYAAGHSLGEYTALVAAGALSFQDAVYAVSKRGE 118

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQASR-VGICEIANDNGGGQVVISGLQDAVKC 180
            M EAVP G G+M AI+GLD   +  +  + +    + E+AN N  GQ+VISG    V+ 
Sbjct: 119 LMNEAVPAGEGAMAAILGLDQTALLEVTKEVTESGHLVELANLNCPGQIVISGTAKGVEL 178

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A++    KGAKRA+ L VS PFHS+LM P ++    +L  +   D   P++ N  A  V+
Sbjct: 179 ASEKAKEKGAKRAIALEVSGPFHSALMKPAAEKFTDVLSKLDISDAKTPVISNVTADIVT 238

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
           S D I   L+EQ+   VR+ E+++   + GV +  E+G GKVL+GL K++++ L+ +S+S
Sbjct: 239 SRDAIETKLIEQLYSPVRFEESVERLIDLGVTTFIEIGPGKVLSGLVKKVNRRLTTISVS 298

Query: 301 KVEDIDLALRSIVG 314
             E I+ A+ ++ G
Sbjct: 299 DQETIEAAIETLKG 312


>gi|218528538|ref|YP_002419354.1| malonyl CoA-acyl carrier protein transacylase [Methylobacterium
           chloromethanicum CM4]
 gi|218520841|gb|ACK81426.1| malonyl CoA-acyl carrier protein transacylase [Methylobacterium
           chloromethanicum CM4]
          Length = 310

 Score =  201 bits (511), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 154/308 (50%), Positives = 206/308 (66%), Gaps = 1/308 (0%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M+    FPGQGSQ +GMG+ L ++FP AR VFEEVD  L QNLS LM+ G  +ELT T N
Sbjct: 1   MTRAFIFPGQGSQAVGMGKALSEAFPAARQVFEEVDAALGQNLSRLMFEGPSDELTLTAN 60

Query: 61  AQPALTAVSMAFIRVME-KNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRAR 119
           AQPAL A S+A +R +E + GL + RD ++VAGHSLGEY+AL AA  FS+SDT RL+R R
Sbjct: 61  AQPALMAASLAVLRTLEAERGLDLARDAAFVAGHSLGEYSALAAAGTFSISDTARLLRIR 120

Query: 120 GKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVK 179
           G++MQ AV PG+G+M A+IG D      I  +A+   +C++ANDNGGGQVV+SG ++AV+
Sbjct: 121 GEAMQRAVAPGIGAMAALIGPDLATARDIAGEAAEGLVCDVANDNGGGQVVLSGHREAVE 180

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            A     ++G +RAV L VSAPFH +LM P ++ M+  L  V    P VP+  N  A P+
Sbjct: 181 RAMALAQSRGVRRAVLLNVSAPFHCALMAPAAEAMRRALAEVPMNAPAVPVFANVTAGPL 240

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
           +  D I   L+ QVTG VRW E++   A  GV   +E+G+GKVLTGL KRI  S +A ++
Sbjct: 241 TEPDAIRNALITQVTGTVRWSESVAAMAEAGVDRFFELGAGKVLTGLVKRIAPSATASAV 300

Query: 300 SKVEDIDL 307
              +D+  
Sbjct: 301 GTPDDVAA 308


>gi|255659794|ref|ZP_05405203.1| malonyl CoA-acyl carrier protein transacylase [Mitsuokella
           multacida DSM 20544]
 gi|260847865|gb|EEX67872.1| malonyl CoA-acyl carrier protein transacylase [Mitsuokella
           multacida DSM 20544]
          Length = 314

 Score =  201 bits (511), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 117/313 (37%), Positives = 173/313 (55%), Gaps = 5/313 (1%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
                FPGQG+Q +GMG+DL++ +  A+ +F E D  L  ++ D+ + G  ++L  T N 
Sbjct: 3   KLAFVFPGQGAQAVGMGKDLFEQYDVAKRLFAEADEALGYSIKDMCFEGPADDLKLTANT 62

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPA+  VS+    +++++G+          GHSLGEY+AL AA   S  D + LV  RG+
Sbjct: 63  QPAILTVSVIVNEILKEHGV----QPDVAGGHSLGEYSALVAAGVLSFKDAVALVHKRGQ 118

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRV-GICEIANDNGGGQVVISGLQDAVKC 180
            MQEAVP G G M AIIGLDD  + + C +A++  G  +  N N  GQ VI+G    V+ 
Sbjct: 119 YMQEAVPVGEGGMAAIIGLDDEAIAAACEKATKEAGEVQPVNFNCPGQTVIAGTTHGVEK 178

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A +     GAK+AV LPVSAPFHS+LM P ++ +   LD V   D   P++ NF     +
Sbjct: 179 AVEELKAAGAKKAVVLPVSAPFHSTLMKPAAEKLAAELDKVAIHDAAFPVVSNFTGELET 238

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
             +EI   LV Q    VRW   ++     G  +  E G GK L G  +RID+S+ ++++ 
Sbjct: 239 KAEEIKANLVAQADHPVRWIACVKTMQAFGADTFVEAGPGKTLCGFNRRIDRSIKSLNVE 298

Query: 301 KVEDIDLALRSIV 313
            +E +   L  + 
Sbjct: 299 NLESLQKTLDYLK 311


>gi|118580163|ref|YP_901413.1| malonyl CoA-acyl carrier protein transacylase [Pelobacter
           propionicus DSM 2379]
 gi|118502873|gb|ABK99355.1| [Acyl-carrier-protein] S-malonyltransferase [Pelobacter propionicus
           DSM 2379]
          Length = 306

 Score =  201 bits (510), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 123/307 (40%), Positives = 175/307 (57%), Gaps = 3/307 (0%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
            T   FPGQGSQ  GMG++L+D++  +R VFEE D  L   LS L + G ++EL  T N 
Sbjct: 3   KTAFVFPGQGSQYPGMGKELFDTYRVSREVFEEADEALGLKLSTLCFEGGEDELKLTANT 62

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPA+   S+A    ++           YVAGHSLGE++AL      SL+D +R VR+RG 
Sbjct: 63  QPAILTTSIAI---LKALLQETGLKPDYVAGHSLGEFSALVCTGTLSLADAVRTVRSRGF 119

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCA 181
            MQ+AVP G G+M AI+ +   V+D IC +A++  I   AN N  GQVVI+G   AV  A
Sbjct: 120 FMQDAVPVGTGAMAAILSVSAEVLDEICQEAAQGEIVAPANFNSPGQVVIAGHSGAVHRA 179

Query: 182 ADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSS 241
                 +G K+A+ LPVSAPFH +LM P ++ +  +L+ V      VP + N  A P ++
Sbjct: 180 ITIAKERGFKKALMLPVSAPFHCALMQPAAERLAEVLERVKFAHVKVPYVANADAEPNTN 239

Query: 242 IDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISK 301
              I  LL+ QV   V W ++++  A+ GV+   E+G GKVL+GL KRI K     ++  
Sbjct: 240 RTRIKPLLITQVCAPVLWEQSVRKMASLGVERFVEIGPGKVLSGLVKRIAKESLVDNVEN 299

Query: 302 VEDIDLA 308
           +  +   
Sbjct: 300 IATLKAL 306


>gi|320529293|ref|ZP_08030383.1| malonyl CoA-acyl carrier protein transacylase [Selenomonas
           artemidis F0399]
 gi|320138467|gb|EFW30359.1| malonyl CoA-acyl carrier protein transacylase [Selenomonas
           artemidis F0399]
          Length = 326

 Score =  200 bits (509), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 121/312 (38%), Positives = 172/312 (55%), Gaps = 4/312 (1%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
                FPGQG+QV+GMG+DL+D +  A+  F E D  L  ++S L + G  E+L  T + 
Sbjct: 18  KLAFIFPGQGAQVVGMGKDLFDRYDLAKQRFAEADAALGYSISTLCFEGPAEKLQLTEHT 77

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPA+  V +    ++ + G+          GHSLGEY AL  A   S  D + LV  RG 
Sbjct: 78  QPAILTVEVIAAELLREAGVA----PEVAGGHSLGEYGALVLAGVMSFQDAVLLVHKRGA 133

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCA 181
            MQEAVP G G+M A+IGLDD  + ++CA+AS  G  +  N N  GQ VI+G    V+ A
Sbjct: 134 YMQEAVPVGEGAMAAVIGLDDERIVAVCAEASSAGAVQAVNFNCPGQTVIAGTVRGVERA 193

Query: 182 ADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSS 241
            +    +GAK+AV LPVSAPFHS+LM P ++ +   LD V  +D   P++ N+      S
Sbjct: 194 VELLKEQGAKKAVILPVSAPFHSTLMAPAAQKLAAELDKVEIRDAAFPVVSNYTGKLQQS 253

Query: 242 IDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISK 301
             EI + L+ Q    VRW   ++     G  +  E G GK L G  KRIDKSL ++++  
Sbjct: 254 AAEIKKNLIAQADHPVRWIACVETMKEFGADTYVECGPGKTLAGFNKRIDKSLVSMNVEN 313

Query: 302 VEDIDLALRSIV 313
           V+ +   L ++ 
Sbjct: 314 VDSLQKTLDTLK 325


>gi|313896313|ref|ZP_07829866.1| [acyl-carrier-protein] S-malonyltransferase [Selenomonas sp. oral
           taxon 137 str. F0430]
 gi|312975112|gb|EFR40574.1| [acyl-carrier-protein] S-malonyltransferase [Selenomonas sp. oral
           taxon 137 str. F0430]
          Length = 311

 Score =  200 bits (509), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 121/312 (38%), Positives = 172/312 (55%), Gaps = 4/312 (1%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
                FPGQG+QV+GMG+DL+D +  A+  F E D  L  ++S L + G  E+L  T + 
Sbjct: 3   KLAFIFPGQGAQVVGMGKDLFDRYDLAKQRFAEADAALGYSISTLCFEGPAEKLQLTEHT 62

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPA+  V +    ++ + G+          GHSLGEY AL  A   S  D + LV  RG 
Sbjct: 63  QPAILTVEVIAAELLREAGVA----PEVAGGHSLGEYGALVLAGVMSFQDAVLLVHKRGA 118

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCA 181
            MQEAVP G G+M A+IGLDD  + ++CA+AS  G  +  N N  GQ VI+G    V+ A
Sbjct: 119 YMQEAVPVGEGAMAAVIGLDDERIVAVCAEASSAGAVQAVNFNCPGQTVIAGTVRGVERA 178

Query: 182 ADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSS 241
            +    +GAK+AV LPVSAPFHS+LM P ++ +   LD V  +D   P++ N+      S
Sbjct: 179 VELLKEQGAKKAVILPVSAPFHSTLMAPAAQKLAAELDKVEIRDAAFPVVSNYTGKLQQS 238

Query: 242 IDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISK 301
             EI + L+ Q    VRW   ++     G  +  E G GK L G  KRIDKSL ++++  
Sbjct: 239 AAEIKKNLIAQADHPVRWIACVETMKEFGADTYVECGPGKTLAGFNKRIDKSLVSMNVEN 298

Query: 302 VEDIDLALRSIV 313
           V+ +   L ++ 
Sbjct: 299 VDSLQKTLDTLK 310


>gi|327188003|gb|EGE55233.1| [acyl-carrier-protein] S-malonyltransferase protein [Rhizobium etli
           CNPAF512]
          Length = 314

 Score =  200 bits (509), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 182/312 (58%), Positives = 241/312 (77%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M+   TFPGQGSQ +GMG+DL ++F EAR VFEEVD  L + LSD+M+NG ++ LT T N
Sbjct: 1   MTIAFTFPGQGSQAVGMGKDLAENFAEARAVFEEVDEALGEKLSDVMFNGPEDTLTLTAN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
           AQPAL AVS+A +RV++  GL +K  ++YVAGHSLGEY+ALCAA  FSL+DT RL+R RG
Sbjct: 61  AQPALMAVSIAVVRVLQAKGLDLKAKVAYVAGHSLGEYSALCAAGTFSLADTARLLRIRG 120

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
            +MQ AVP G+G+M AIIGL+   V ++C +A+  G C+IANDNGGGQ+VISG + AV+ 
Sbjct: 121 NAMQAAVPVGVGAMAAIIGLEHADVAAVCEEAAATGACQIANDNGGGQIVISGEKAAVEK 180

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           AA    +KGAKRA+ LPVSAPFHS LM P ++ M+  L +V K DPVVP++ N  A+PV+
Sbjct: 181 AAGLATDKGAKRAILLPVSAPFHSKLMAPAAEAMRAALATVAKSDPVVPLIANVRAAPVT 240

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
             DEI+ LLVEQVTG+VRWRET++WFA +GV ++YE+GSGKVLTGLA+RIDK+++ +S+ 
Sbjct: 241 DADEIATLLVEQVTGQVRWRETVEWFAGNGVTTLYELGSGKVLTGLARRIDKTVNGISVG 300

Query: 301 KVEDIDLALRSI 312
              DID  + ++
Sbjct: 301 GPADIDAVVAAL 312


>gi|291484141|dbj|BAI85216.1| acyl-carrier-protein S-malonyltransferase [Bacillus subtilis subsp.
           natto BEST195]
          Length = 317

 Score =  200 bits (509), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 127/313 (40%), Positives = 192/313 (61%), Gaps = 5/313 (1%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
                FPGQGSQ IGMG++LY+  P A+ +F+E D TL   LS L++ G+ EELT T NA
Sbjct: 3   KIAFLFPGQGSQFIGMGKELYEQVPAAKRLFDEADETLETKLSSLIFEGAAEELTLTYNA 62

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPAL   S+A +   +++G+       + AGHSLGEY+AL AA A S  D +  VR RG+
Sbjct: 63  QPALLTTSIAVLEKFKESGIT----PDFTAGHSLGEYSALVAAGALSFKDAVYTVRKRGE 118

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQAS-RVGICEIANDNGGGQVVISGLQDAVKC 180
            M EAVP G G+M AI+G+D   +  +  + +    + ++AN N  GQ+VISG    V+ 
Sbjct: 119 FMNEAVPAGEGAMAAILGMDAEALKQVTDKVTEEGNLVQLANLNCPGQIVISGTAKGVEL 178

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A++     GAKRA+ L VS PFHS LM P ++ +K +LD+   +D  +P++ N  A  ++
Sbjct: 179 ASELAKENGAKRAIPLEVSGPFHSELMKPAAEKLKEVLDACDIKDADIPVISNVSADVMT 238

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
              +I   L+EQ+   VR+ E+I      GV +  E+G GKVL+GL K++++ L  +++S
Sbjct: 239 EKADIKEKLIEQLYSPVRFEESINKLIAEGVTTFIEIGPGKVLSGLVKKVNRRLKTIAVS 298

Query: 301 KVEDIDLALRSIV 313
             E I+LA++++ 
Sbjct: 299 DPETIELAIQTLK 311


>gi|163849999|ref|YP_001638042.1| malonyl CoA-acyl carrier protein transacylase [Methylobacterium
           extorquens PA1]
 gi|163661604|gb|ABY28971.1| malonyl CoA-acyl carrier protein transacylase [Methylobacterium
           extorquens PA1]
          Length = 310

 Score =  200 bits (509), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 152/308 (49%), Positives = 205/308 (66%), Gaps = 1/308 (0%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M+    FPGQGSQ +GMG+ L ++FP AR VFEEVD  L QNLS LM+ G  + LT T N
Sbjct: 1   MTRAFIFPGQGSQAVGMGKALSEAFPAARQVFEEVDAALGQNLSRLMFEGPSDALTLTAN 60

Query: 61  AQPALTAVSMAFIRVME-KNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRAR 119
           AQPAL A S+A +R +E + GL + RD ++VAGHSLGEY+AL AA  FS++DT RL+R R
Sbjct: 61  AQPALMAASLAVLRTLEAERGLDLARDAAFVAGHSLGEYSALAAAGTFSIADTARLLRIR 120

Query: 120 GKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVK 179
           G++MQ AV PG+G+M A+IG D      I  +A+   +C++ANDNGGGQVV+SG ++AV+
Sbjct: 121 GEAMQRAVAPGIGAMAALIGPDLATARDIAGEAAEGLVCDVANDNGGGQVVLSGHREAVE 180

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            A     ++G +RAV L VSAPFH +LM P ++ M+  L  V    P VP+  N  A P+
Sbjct: 181 RAMALAQSRGVRRAVLLNVSAPFHCALMAPAAEAMRRALAEVPMNAPAVPVFANITAGPL 240

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
           +  D I   L+ QVTG VRW E++   A  GV   +E+G+GKVLTGL KRI  S +A ++
Sbjct: 241 TEPDAIRNALITQVTGTVRWSESVAAMAEAGVDRFFELGAGKVLTGLVKRIAPSATASAV 300

Query: 300 SKVEDIDL 307
              +D+  
Sbjct: 301 GTPDDVAA 308


>gi|153007915|ref|YP_001369130.1| malonyl CoA-acyl carrier protein transacylase [Ochrobactrum
           anthropi ATCC 49188]
 gi|151559803|gb|ABS13301.1| malonyl CoA-acyl carrier protein transacylase [Ochrobactrum
           anthropi ATCC 49188]
          Length = 314

 Score =  200 bits (508), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 178/312 (57%), Positives = 232/312 (74%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M+   TFPGQGSQ +GMG+ L + F EAR VF+EVD  L + LS  M+ G ++ LT T N
Sbjct: 1   MAVAFTFPGQGSQAVGMGKALAEQFAEARAVFDEVDAALGEKLSATMFEGPEDVLTLTAN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
           AQPAL AVSMA +RVME  G  +K  +SYVAGHSLGEY+ALCAA+ FSL+DT RL+R RG
Sbjct: 61  AQPALMAVSMAVLRVMEARGFSLKDRVSYVAGHSLGEYSALCAARTFSLADTARLLRIRG 120

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
            +MQ+AVP G G+M AIIGL+   V+++C +A   G  +IANDNGGGQ+VISG + AV+ 
Sbjct: 121 NAMQKAVPAGEGAMAAIIGLEHGDVEAVCTEAKASGSVQIANDNGGGQLVISGSKAAVEL 180

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           AA     KGAKRA+ LPVSAPFHS+LM P  + M+  L SV K +P+VP++ N  A+PV+
Sbjct: 181 AARLASEKGAKRAIMLPVSAPFHSTLMGPAGEAMREALASVEKHNPIVPLIANVRAAPVT 240

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
             +EI+ LLVEQVTG+VRWRET++WFA +GV ++YEVGSGKVLTGLA+RI K ++  ++ 
Sbjct: 241 DANEIADLLVEQVTGQVRWRETVEWFAANGVTTLYEVGSGKVLTGLARRISKDVTGAAVG 300

Query: 301 KVEDIDLALRSI 312
             E+I+ AL  +
Sbjct: 301 SAEEIEAALAVL 312


>gi|261408037|ref|YP_003244278.1| malonyl CoA-acyl carrier protein transacylase [Paenibacillus sp.
           Y412MC10]
 gi|261284500|gb|ACX66471.1| malonyl CoA-acyl carrier protein transacylase [Paenibacillus sp.
           Y412MC10]
          Length = 310

 Score =  200 bits (508), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 125/308 (40%), Positives = 180/308 (58%), Gaps = 5/308 (1%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
            T   FPGQG+Q +GMG+D YD+ P AR +F   D  L   LS +++NG  E+L  T N 
Sbjct: 3   KTAFIFPGQGAQSVGMGKDAYDAVPSARDLFLTADAQLGFPLSSIIFNGPDEDLKQTVNT 62

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPAL A SMA++  +   G+       YVAGHSLGEY+AL  A   S  + + +VRARG+
Sbjct: 63  QPALLATSMAYLEAIRGKGIV----PDYVAGHSLGEYSALVCAGVLSFEEAVSIVRARGE 118

Query: 122 SMQEAVPPGLGSMVAIIGLD-DCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
            M+ AVP G G+M A++G D + + +     ++   + E+AN N  GQ+VISG    V  
Sbjct: 119 YMEAAVPGGQGAMAAVLGADREALAELCKGISAEGHVVELANMNCPGQIVISGSAQGVAA 178

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           AA+     G KRA+ L VS PFHSSLM   ++ +   L+  +   P VP++ N  A PV 
Sbjct: 179 AAERVKEAGGKRAIPLEVSGPFHSSLMKEAAERLAGKLEQASFNAPSVPVVANVTARPVE 238

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
               I  LLVEQV   V W ++++W    GV +  E+G G VL+GL K+IDKS+  ++++
Sbjct: 239 DAAAIRGLLVEQVYSPVLWHDSVEWMIAQGVDTFVEIGPGSVLSGLIKKIDKSVKVINVN 298

Query: 301 KVEDIDLA 308
            +E ++  
Sbjct: 299 SLESVNSL 306


>gi|197123243|ref|YP_002135194.1| malonyl CoA-acyl carrier protein transacylase [Anaeromyxobacter sp.
           K]
 gi|196173092|gb|ACG74065.1| malonyl CoA-acyl carrier protein transacylase [Anaeromyxobacter sp.
           K]
          Length = 313

 Score =  200 bits (508), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 138/315 (43%), Positives = 185/315 (58%), Gaps = 6/315 (1%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
                FPGQGSQ +GMG+DL+D+FPEAR +F+EVD  L + LS L + G +++L  T N 
Sbjct: 3   KLAFVFPGQGSQAVGMGKDLHDAFPEAREIFQEVDEALGEKLSALCFGGPEDQLKLTANT 62

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QP++  VS A   V+   GL       YVAGHSLGEY+AL A  A   ++  R VRARG 
Sbjct: 63  QPSILTVSSAAAAVLANQGLV----PDYVAGHSLGEYSALVAVGACGAAEAARAVRARGT 118

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSIC--AQASRVGICEIANDNGGGQVVISGLQDAVK 179
            MQEAVP G G+M A++GLD   V  IC    A    +   AN N   Q VI+G   AV+
Sbjct: 119 FMQEAVPAGQGAMSAVLGLDPARVREICAAVAAETGQVVSPANYNEPAQTVIAGAAGAVE 178

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            A       GAKR + LPVSAPFHS+LM PV   ++ +L ++  + P+ P++ N  A P 
Sbjct: 179 QAGARLKEAGAKRVLPLPVSAPFHSALMAPVKARLEPVLRAMPWRAPLRPVVTNVEAKPN 238

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
                +  LLVEQVT  VRW E ++     GV  V EVG GKVL+GL +RID+S+ A ++
Sbjct: 239 QDASRVVPLLVEQVTAPVRWIECVEELVRLGVTRVVEVGPGKVLSGLVRRIDRSVEAFNV 298

Query: 300 SKVEDIDLALRSIVG 314
                ++  L ++ G
Sbjct: 299 EDRASLEKTLAALKG 313


>gi|254475062|ref|ZP_05088448.1| malonyl CoA-acyl carrier protein transacylase [Ruegeria sp. R11]
 gi|214029305|gb|EEB70140.1| malonyl CoA-acyl carrier protein transacylase [Ruegeria sp. R11]
          Length = 311

 Score =  200 bits (507), Expect = 3e-49,   Method: Composition-based stats.
 Identities = 154/308 (50%), Positives = 207/308 (67%), Gaps = 1/308 (0%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M+    FPGQG+Q IGMG+ L +++P A+ VF+EVD  L + LS L+W G  E LT T N
Sbjct: 1   MTIAFVFPGQGAQTIGMGKALAEAYPAAKAVFDEVDTALGEALSQLIWEGDIETLTLTQN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
           AQPAL A S+A +R +E  G+ +     YVAGHSLGEY+AL AA A S++DT RL+R RG
Sbjct: 61  AQPALMATSLAAMRALEAEGVSID-KAGYVAGHSLGEYSALAAAGAISVADTARLLRTRG 119

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           ++MQ AVP G G+M AI+GLD   V ++  +A++  +C+ ANDN   QVV+SG + AV+ 
Sbjct: 120 QAMQSAVPVGEGAMAAILGLDLEAVRAVAEEAAQGEVCQAANDNDPTQVVVSGAKAAVER 179

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           AA+    KGAKRAV LPVSAPFH +LM P + VM   L  V  + P VP++ N  A  VS
Sbjct: 180 AAEIAKAKGAKRAVMLPVSAPFHCALMQPAADVMAEALAGVDIKSPAVPLIANVRADAVS 239

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
              EI +LLVEQVTG VRWRE++Q  A  GV   +E+G+GK L+G+ ++ID+SL+   + 
Sbjct: 240 DPAEIRQLLVEQVTGSVRWRESVQTMAAKGVSEFWEIGAGKALSGMIRKIDRSLTCRQVG 299

Query: 301 KVEDIDLA 308
             ED+  A
Sbjct: 300 TPEDVAAA 307


>gi|134299919|ref|YP_001113415.1| malonyl CoA-acyl carrier protein transacylase [Desulfotomaculum
           reducens MI-1]
 gi|134052619|gb|ABO50590.1| [Acyl-carrier-protein] S-malonyltransferase [Desulfotomaculum
           reducens MI-1]
          Length = 314

 Score =  200 bits (507), Expect = 3e-49,   Method: Composition-based stats.
 Identities = 131/309 (42%), Positives = 190/309 (61%), Gaps = 3/309 (0%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
                FPGQGSQ +GMGR+LY++F   R   EE D +L   L+ L + G  EEL +T N 
Sbjct: 3   KVAFVFPGQGSQYVGMGRELYNNFQVVRETMEEADDSLGFGLTKLCFEGPVEELNSTVNT 62

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPAL AVS+A +RV+++    +    S +AGHSLGEY+AL AA +   SD +++VR RG 
Sbjct: 63  QPALLAVSVAALRVLQQECGIL---PSVLAGHSLGEYSALVAAGSVHFSDAVKVVRQRGL 119

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCA 181
            MQEA P G G M A++GL    V + C +AS  G+ E  N N  GQVVI+G Q+A++ A
Sbjct: 120 FMQEAAPVGSGGMAAVLGLAREKVVACCLEASSHGVVEPVNFNCPGQVVIAGEQEALQQA 179

Query: 182 ADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSS 241
            + C   GAKRA+ L VS PFHSSLM P  + +  +L+ +   DP +P++ N  A  V +
Sbjct: 180 MELCRAAGAKRAIALAVSGPFHSSLMRPAGERLAPILEEIEICDPAIPVIANVSADYVRT 239

Query: 242 IDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISK 301
           + E+ + L +QV+G V W ++IQ  A  G+ ++ E+G GKVL GL K+I K ++  ++  
Sbjct: 240 VQEVKQSLAKQVSGAVLWEDSIQRMATEGINTLVELGPGKVLCGLVKKISKEITTSNLED 299

Query: 302 VEDIDLALR 310
           +  ++  L 
Sbjct: 300 LASLEKVLA 308


>gi|254467339|ref|ZP_05080750.1| malonyl CoA-acyl carrier protein transacylase [Rhodobacterales
           bacterium Y4I]
 gi|206688247|gb|EDZ48729.1| malonyl CoA-acyl carrier protein transacylase [Rhodobacterales
           bacterium Y4I]
          Length = 312

 Score =  200 bits (507), Expect = 3e-49,   Method: Composition-based stats.
 Identities = 154/313 (49%), Positives = 208/313 (66%), Gaps = 1/313 (0%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M+    FPGQG+Q IGMG+ L D++P A+ +F+EVD  L ++LS L+W G  E LT T N
Sbjct: 1   MTIAFVFPGQGAQTIGMGKALADAYPAAKAIFDEVDEALGESLSQLIWAGDIETLTLTQN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
           AQPAL A SMA +R +E  G+ +    ++VAGHSLGEY+AL AA A S++DT RL+R RG
Sbjct: 61  AQPALMATSMAAMRALEAEGVTIG-KAAFVAGHSLGEYSALAAAGAVSVTDTARLLRTRG 119

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
            +MQ AVP G G+M AI+GLD   V ++  +A++  +C+ ANDN   QVV+SG + AV+ 
Sbjct: 120 LAMQSAVPVGEGAMAAILGLDLDAVRAVAEEAAQGEVCQAANDNDPTQVVVSGAKAAVER 179

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           AA+    KGAKRAV LPVSAPFH +LM P +  M   L  V  + P VP++ N  A  V+
Sbjct: 180 AAEIAKEKGAKRAVMLPVSAPFHCALMQPAADAMAEALAGVEIKSPAVPLIANVRADAVT 239

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
           S DEI  LLVEQVTG VRWRE++Q  A  GV   +E+G+GK L+G+ ++ID++L+   + 
Sbjct: 240 SPDEIRALLVEQVTGSVRWRESVQAMAAKGVTEFWEIGAGKALSGMIRKIDRNLACRQVG 299

Query: 301 KVEDIDLALRSIV 313
             ED   A  S  
Sbjct: 300 TPEDAKAAAESEA 312


>gi|302036167|ref|YP_003796489.1| malonyl-CoA-(acyl-carrier-protein) transacylase [Candidatus
           Nitrospira defluvii]
 gi|300604231|emb|CBK40563.1| Malonyl-CoA-(acyl-carrier-protein) transacylase [Candidatus
           Nitrospira defluvii]
          Length = 316

 Score =  200 bits (507), Expect = 3e-49,   Method: Composition-based stats.
 Identities = 119/308 (38%), Positives = 175/308 (56%), Gaps = 4/308 (1%)

Query: 5   LTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPA 64
             FPGQGSQ +GMGR  Y++ P  + V++E    L  +++ L + G  E L  T N QPA
Sbjct: 7   FLFPGQGSQSVGMGRGFYEASPAVKAVYDEASSILGYDVAQLCFEGPAERLNLTENTQPA 66

Query: 65  LTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQ 124
           L   S A ++ +E  G         VAGHSLGEY+A+ AA   S  D + LV+ RG+ M 
Sbjct: 67  LLVSSAAALKALEPAG----LKPLAVAGHSLGEYSAVYAAGGVSFRDAVALVQKRGRYMS 122

Query: 125 EAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAADT 184
           EAVPPG G + A++GL   VV ++C +A+ VG+   AN N  GQVVI+G + AV+ A + 
Sbjct: 123 EAVPPGTGLVAALLGLTADVVKAVCQEAASVGVVAAANFNSPGQVVIAGEKAAVERAIEI 182

Query: 185 CLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSIDE 244
              KG K+A+ LPVS P H+ LM   +  +      V  +D  VP++ N  A+ +   ++
Sbjct: 183 AKTKGCKKAIPLPVSVPVHTPLMQRAADRLAAEFGGVAWRDLAVPLVNNAEATALQRSED 242

Query: 245 ISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVED 304
           I   LV Q+   VRW E++Q  A  GV +  E+G G VLTGL KRI  +    +++  + 
Sbjct: 243 IRASLVRQLPSSVRWEESVQTMARLGVTTFVEIGPGSVLTGLVKRILPAAVTANVNDPKS 302

Query: 305 IDLALRSI 312
           ++  L ++
Sbjct: 303 LEATLTTL 310


>gi|261419388|ref|YP_003253070.1| malonyl CoA-acyl carrier protein transacylase [Geobacillus sp.
           Y412MC61]
 gi|319766203|ref|YP_004131704.1| malonyl CoA-acyl carrier protein transacylase [Geobacillus sp.
           Y412MC52]
 gi|261375845|gb|ACX78588.1| malonyl CoA-acyl carrier protein transacylase [Geobacillus sp.
           Y412MC61]
 gi|317111069|gb|ADU93561.1| malonyl CoA-acyl carrier protein transacylase [Geobacillus sp.
           Y412MC52]
          Length = 313

 Score =  200 bits (507), Expect = 3e-49,   Method: Composition-based stats.
 Identities = 132/314 (42%), Positives = 196/314 (62%), Gaps = 5/314 (1%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
                FPGQGSQ +GM +D  +    AR V  E D  L   LS LM+NG QEELT T NA
Sbjct: 3   KIAFLFPGQGSQTVGMAKDAAEHDARARAVIAEADERLGFALSKLMFNGPQEELTLTYNA 62

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPAL   S+A +++++  G        YVAGHSLGEYTAL AA A S +D +  VR RG+
Sbjct: 63  QPALLTASIALLQLVDGAG----LKADYVAGHSLGEYTALVAAGAMSFADAVYAVRRRGE 118

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQ-ASRVGICEIANDNGGGQVVISGLQDAVKC 180
            M EAVP G G+M A++G+D   ++++  + A++    E AN N  GQ+VISG +  V+ 
Sbjct: 119 LMDEAVPAGEGTMAAVLGMDADALEAVTNEIAAQGDPVEPANFNCPGQIVISGSKAGVEK 178

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           AA     +GAKR + L VS PFHS+LM P ++ +K +LDS+  +D V+P++ N  A PV+
Sbjct: 179 AAQLLKERGAKRVIPLEVSGPFHSALMKPAAEKLKAVLDSLVIRDAVIPVVANVTAEPVT 238

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
             ++I+RLL+EQ+   VRW ++++   + GV +  E+G GKVL+GL K+ID++    +++
Sbjct: 239 KKEDIARLLIEQLYSPVRWEQSVRTLLSLGVDTFVEIGPGKVLSGLVKKIDRNARVYAVN 298

Query: 301 KVEDIDLALRSIVG 314
            +   +  + ++ G
Sbjct: 299 DLASFEATVAALKG 312


>gi|242239026|ref|YP_002987207.1| malonyl CoA-acyl carrier protein transacylase [Dickeya dadantii
           Ech703]
 gi|242131083|gb|ACS85385.1| malonyl CoA-acyl carrier protein transacylase [Dickeya dadantii
           Ech703]
          Length = 309

 Score =  199 bits (506), Expect = 4e-49,   Method: Composition-based stats.
 Identities = 124/312 (39%), Positives = 175/312 (56%), Gaps = 4/312 (1%)

Query: 1   MS-TVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATC 59
           M+   + FPGQGSQ +GM  +L + FP  +  F+E    L  +L  L   G  EEL  T 
Sbjct: 1   MTQFAMVFPGQGSQSVGMLAELAEKFPLVKETFDEASSVLGYDLWQLSQQGPAEELNKTW 60

Query: 60  NAQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRAR 119
             QPAL   S+A  RV ++ G       + ++GHSLGEY+AL  A        + LV  R
Sbjct: 61  QTQPALLTASVAIWRVWQQQGG---ERPALLSGHSLGEYSALVCAGVLDFKQAVSLVELR 117

Query: 120 GKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVK 179
           G+ MQEAVP G G+M AIIGLD+  +   CA+ ++  +    N N  GQVVI+G + AV+
Sbjct: 118 GRLMQEAVPEGSGAMYAIIGLDNDAITKACAETAQGQVVSPVNFNSPGQVVIAGDKAAVE 177

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            A   C   GAKRA+ LPVS P H +LM P +  ++  L ++T   P +P++ N      
Sbjct: 178 RAGAACKAAGAKRALPLPVSVPSHCALMEPAAFRLEEALKAITFNAPQIPVVNNVDVRTE 237

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
           ++ + I   LV Q+   VRW E +++ A+ GV+ + EVG GKVLTGL KRI  SL+A +I
Sbjct: 238 TTPEAIRSALVRQLYNPVRWTECVEFMASQGVEHLIEVGPGKVLTGLIKRIVDSLTATAI 297

Query: 300 SKVEDIDLALRS 311
           +    +  AL  
Sbjct: 298 NDPASLSTALEQ 309


>gi|163736665|ref|ZP_02144084.1| malonyl CoA-acyl carrier protein transacylase [Phaeobacter
           gallaeciensis BS107]
 gi|161390535|gb|EDQ14885.1| malonyl CoA-acyl carrier protein transacylase [Phaeobacter
           gallaeciensis BS107]
          Length = 310

 Score =  199 bits (506), Expect = 4e-49,   Method: Composition-based stats.
 Identities = 151/307 (49%), Positives = 208/307 (67%), Gaps = 1/307 (0%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M+    FPGQG+Q IGMG+ L +++P A+ VF+EVD  L + LS L+W G  E LT T N
Sbjct: 1   MTIAFVFPGQGAQTIGMGKALAEAYPAAKAVFDEVDAALGEALSQLIWEGDIETLTLTQN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
           AQPAL A S+A +R +E  G+ +    ++VAGHSLGEY+AL AA A S++DT RL+R RG
Sbjct: 61  AQPALMATSLAAMRALEAEGVSID-KPAFVAGHSLGEYSALAAAGAISVADTARLLRTRG 119

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           ++MQ AVP G G+M AI+GLD   V ++  +A++  +C+ ANDN   QVV+SG + AV+ 
Sbjct: 120 QAMQSAVPVGEGAMAAILGLDLEAVRAVAEEAAQGEVCQAANDNDPTQVVVSGAKAAVER 179

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           AA+    KGAKRAV LPVSAPFH +LM P + VM   L  V    P VP++ N  A  V+
Sbjct: 180 AAEIAKEKGAKRAVMLPVSAPFHCALMQPAADVMAEALADVAITSPAVPLIANVRADAVT 239

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
             DEI +LLVEQVTG VRWRE++Q  A  GV   +E+G+GK L+G+ ++ID++L++  + 
Sbjct: 240 DPDEIRKLLVEQVTGSVRWRESVQSMAAKGVTEFWEIGAGKALSGMIRKIDRNLTSRQVG 299

Query: 301 KVEDIDL 307
             ED+  
Sbjct: 300 TAEDVAA 306


>gi|77919038|ref|YP_356853.1| malonyl CoA-acyl carrier protein transacylase [Pelobacter
           carbinolicus DSM 2380]
 gi|77545121|gb|ABA88683.1| [Acyl-carrier-protein] S-malonyltransferase [Pelobacter
           carbinolicus DSM 2380]
          Length = 304

 Score =  199 bits (506), Expect = 4e-49,   Method: Composition-based stats.
 Identities = 137/306 (44%), Positives = 188/306 (61%), Gaps = 3/306 (0%)

Query: 3   TVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQ 62
               FPGQGSQ  GMG+DL ++F +A+LVFEE +  L  +LS L + G ++EL  T N Q
Sbjct: 2   IAFVFPGQGSQYAGMGKDLAENFGQAKLVFEEANDVLGIDLSKLCFEGPEDELKLTANTQ 61

Query: 63  PALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKS 122
           PA+ A S+A +RV++     V     +VAGHSLGEY AL  A   S +D ++ VR RG  
Sbjct: 62  PAIVATSIAALRVLQSETGLV---PDFVAGHSLGEYAALVCAGGLSFADAVQTVRKRGTF 118

Query: 123 MQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAA 182
           MQ+AVP G+G+M AIIGLD  VVD +CA+ +   +   AN N  GQ+VI+G   AV+ A 
Sbjct: 119 MQDAVPVGVGTMAAIIGLDAPVVDEVCAEVASGDVVAPANYNSPGQIVIAGHIAAVERAM 178

Query: 183 DTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSI 242
                +GAKRA+ LPVSAPFH SLM P ++ +  +L  V+ +    P++ N  AS  S  
Sbjct: 179 ALAKERGAKRALPLPVSAPFHCSLMEPAARQLDEVLAGVSVETLACPVVSNVEASANSDA 238

Query: 243 DEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKV 302
             +  LLV+QV   VRW E++   ++ GV    E+G GKVL+GL KRI K +S  ++ KV
Sbjct: 239 KAVRELLVKQVYSPVRWEESVSAMSDEGVDRFVEIGPGKVLSGLIKRIVKGVSLQNMGKV 298

Query: 303 EDIDLA 308
           ED+   
Sbjct: 299 EDLKGF 304


>gi|197284745|ref|YP_002150617.1| malonyl CoA-acyl carrier protein transacylase [Proteus mirabilis
           HI4320]
 gi|194682232|emb|CAR41952.1| malonyl CoA-acyl carrier protein transacylase [Proteus mirabilis
           HI4320]
          Length = 310

 Score =  199 bits (506), Expect = 4e-49,   Method: Composition-based stats.
 Identities = 122/310 (39%), Positives = 175/310 (56%), Gaps = 4/310 (1%)

Query: 1   MS-TVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATC 59
           M+   + FPGQGSQ IGM  +L + +P     F +    L  +L DL+ NG +EEL  T 
Sbjct: 1   MTDFAMVFPGQGSQAIGMLAELAEHYPIVTETFAQASDVLGYSLWDLVQNGPEEELNKTW 60

Query: 60  NAQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRAR 119
             QPAL A S+A  RV ++      +    +AGHSLGEY+AL  A     +  I+LV  R
Sbjct: 61  KTQPALLAASVAIWRVWQEKQG---KMPQMMAGHSLGEYSALVCAGVIDFAAAIKLVELR 117

Query: 120 GKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVK 179
           G+ MQEAVP G G+M AIIGLD+  +   C  A++  +    N N  GQVVI+G ++AV+
Sbjct: 118 GQLMQEAVPAGTGAMYAIIGLDNDAIAKACEDAAQGQVVSPVNFNSPGQVVIAGNKEAVE 177

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            A   C   GAKRA+ L VS P H +LM P +  +   L  +  + P + ++ N      
Sbjct: 178 RAGALCKEAGAKRALPLAVSVPSHCALMKPAADKLAVALQEIEFKQPEIQVVNNVDVKAQ 237

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
           +  + I   LV Q+   VRW ET+++ A  G+  + E+G GKVLTGL KRI K ++A ++
Sbjct: 238 TDANAIRDALVRQLYNPVRWTETVEFIAGKGITQLLEIGPGKVLTGLTKRISKEMNAAAV 297

Query: 300 SKVEDIDLAL 309
           + +  +D AL
Sbjct: 298 NDIASLDAAL 307


>gi|56419724|ref|YP_147042.1| acyl-carrier-protein S-malonyltransferase [Geobacillus kaustophilus
           HTA426]
 gi|56379566|dbj|BAD75474.1| malonyl CoA-acyl carrier protein transacylase [Geobacillus
           kaustophilus HTA426]
          Length = 313

 Score =  199 bits (506), Expect = 4e-49,   Method: Composition-based stats.
 Identities = 132/314 (42%), Positives = 196/314 (62%), Gaps = 5/314 (1%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
                FPGQGSQ +GM +D  +    AR V  E D  L   LS LM+NG QEELT T NA
Sbjct: 3   KIAFLFPGQGSQTVGMAKDAAEHDDRARAVIAEADERLGFALSKLMFNGPQEELTLTYNA 62

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPAL   S+A +++++  G        YVAGHSLGEYTAL AA A S +D +  VR RG+
Sbjct: 63  QPALLTASIALLQLVDGAG----LKADYVAGHSLGEYTALVAAGAMSFADAVYAVRRRGE 118

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQ-ASRVGICEIANDNGGGQVVISGLQDAVKC 180
            M EAVP G G+M A++G+D   ++++  + A++    E AN N  GQ+VISG +  V+ 
Sbjct: 119 LMDEAVPAGEGTMAAVLGMDADALEAVTNEIAAQGDPVEPANFNCPGQIVISGSKAGVEK 178

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           AA     +GAKR + L VS PFHS+LM P ++ +K +LDS+  +D V+P++ N  A PV+
Sbjct: 179 AAQLLKERGAKRVIPLEVSGPFHSALMKPAAEKLKAVLDSLVIRDAVIPVVANVTAEPVT 238

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
             ++I+RLL+EQ+   VRW ++++   + GV +  E+G GKVL+GL K+ID++    +++
Sbjct: 239 KKEDIARLLIEQLYSPVRWEQSVRTLLSLGVDTFVEIGPGKVLSGLVKKIDRNARVYAVN 298

Query: 301 KVEDIDLALRSIVG 314
            +   +  + ++ G
Sbjct: 299 DLASFEATVAALKG 312


>gi|329929600|ref|ZP_08283307.1| [acyl-carrier-protein] S-malonyltransferase [Paenibacillus sp.
           HGF5]
 gi|328936245|gb|EGG32697.1| [acyl-carrier-protein] S-malonyltransferase [Paenibacillus sp.
           HGF5]
          Length = 310

 Score =  199 bits (506), Expect = 4e-49,   Method: Composition-based stats.
 Identities = 124/308 (40%), Positives = 178/308 (57%), Gaps = 5/308 (1%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
            T   FPGQG+Q +GMG+D YD+ P AR +F   D  L   LS +++NG  E+L  T N 
Sbjct: 3   KTAFIFPGQGAQSVGMGKDAYDAVPSARDLFLTADAQLGFPLSSIIFNGPDEDLKQTVNT 62

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPAL A SMA++  +   G+       YVAGHSLGEY+AL  A   S  + + +VR RG+
Sbjct: 63  QPALLATSMAYLEAVRGKGIV----PDYVAGHSLGEYSALVCAGVLSFEEAVSIVRTRGE 118

Query: 122 SMQEAVPPGLGSMVAIIGLD-DCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
            M+ AVP G G+M A++G D + + +     ++   + E+AN N  GQ+VISG    V  
Sbjct: 119 YMEAAVPGGQGAMAAVLGADREALAELCKGISAEGHVVELANMNCPGQIVISGSAQGVAA 178

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           AA+     G KRA+ L VS PFHSSLM   ++ +   L   +   P VP++ N  A PV 
Sbjct: 179 AAERVKEAGGKRAIPLEVSGPFHSSLMKEAAERLAGKLAQASFNAPSVPVVANVTARPVE 238

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
               I  LLVEQV   V W ++++W    GV +  E+G G VL+GL K+IDKS+  ++++
Sbjct: 239 DAAAIRGLLVEQVYSPVLWHDSVEWMIAQGVDTFVEIGPGSVLSGLIKKIDKSVKVMNVN 298

Query: 301 KVEDIDLA 308
            +E ++  
Sbjct: 299 SLESVNSL 306


>gi|154253797|ref|YP_001414621.1| malonyl CoA-acyl carrier protein transacylase [Parvibaculum
           lavamentivorans DS-1]
 gi|154157747|gb|ABS64964.1| malonyl CoA-acyl carrier protein transacylase [Parvibaculum
           lavamentivorans DS-1]
          Length = 313

 Score =  199 bits (505), Expect = 4e-49,   Method: Composition-based stats.
 Identities = 156/313 (49%), Positives = 211/313 (67%), Gaps = 1/313 (0%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           MS   TFPGQGSQ +GMGR+L ++F  AR VF+EV+  L +NLS LMW G QEELT T N
Sbjct: 1   MSRAFTFPGQGSQAVGMGRELAEAFAPAREVFDEVNDALGENLSKLMWEGPQEELTLTEN 60

Query: 61  AQPALTAVSMAFIRVM-EKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRAR 119
           AQPA+ AVS+A IR +  + G  +    ++VAGHSLGEY+AL AA AF+L+DT RL++ R
Sbjct: 61  AQPAIMAVSLAVIRTLEREGGFSLAGKAAFVAGHSLGEYSALAAAGAFTLADTARLLKRR 120

Query: 120 GKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVK 179
           G +MQ AVP G G+M A++GL+      + A+A++  +C  ANDNGGGQVV+SG + AV+
Sbjct: 121 GLAMQRAVPVGEGAMAALLGLEFEQAAEVAAEAAQGEVCAAANDNGGGQVVVSGAKAAVE 180

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            A +    KGAKR++ LPVSAPFH SLM P +  M   L +V  + P VP++ N  AS V
Sbjct: 181 RAIEIAKTKGAKRSMLLPVSAPFHCSLMQPAADEMAEALAAVDIKAPSVPLVANVTASRV 240

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
           +    I  LLV+QVTG VRWRE++ +    GV +  EVG+GK L+G+ KRI K    VS+
Sbjct: 241 ADPATIRDLLVQQVTGMVRWRESVLYMEAQGVVNFVEVGAGKALSGMVKRIVKEADLVSV 300

Query: 300 SKVEDIDLALRSI 312
               D++  L+++
Sbjct: 301 GTPADVEAFLKTL 313


>gi|227357750|ref|ZP_03842099.1| malonyl CoA-acyl carrier protein transacylase [Proteus mirabilis
           ATCC 29906]
 gi|227162079|gb|EEI47093.1| malonyl CoA-acyl carrier protein transacylase [Proteus mirabilis
           ATCC 29906]
          Length = 310

 Score =  199 bits (505), Expect = 5e-49,   Method: Composition-based stats.
 Identities = 122/310 (39%), Positives = 175/310 (56%), Gaps = 4/310 (1%)

Query: 1   MS-TVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATC 59
           M+   + FPGQGSQ IGM  +L + +P     F +    L  +L DL+ NG +EEL  T 
Sbjct: 1   MTDFAMVFPGQGSQAIGMLAELAEHYPIVTETFAQASDVLGYSLWDLVQNGPEEELNKTW 60

Query: 60  NAQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRAR 119
             QPAL A S+A  RV ++      +    +AGHSLGEY+AL  A     +  I+LV  R
Sbjct: 61  KTQPALLAASVAIWRVWQEKQG---KMPQMMAGHSLGEYSALVCAGVIDFAAAIKLVELR 117

Query: 120 GKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVK 179
           G+ MQEAVP G G+M AIIGLD+  +   C  A++  +    N N  GQVVI+G ++AV+
Sbjct: 118 GQLMQEAVPAGTGAMYAIIGLDNDAIAKACEDAAQGQVVSPVNFNSPGQVVIAGNKEAVE 177

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            A   C   GAKRA+ L VS P H +LM P +  +   L  +  + P + ++ N      
Sbjct: 178 RAGALCKEAGAKRALPLAVSVPSHCALMKPAADKLAVALQEIEFKQPEIQVVNNVDVKTQ 237

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
           +  + I   LV Q+   VRW ET+++ A  G+  + E+G GKVLTGL KRI K ++A ++
Sbjct: 238 TDANAIRDALVRQLYNPVRWTETVEFIAGKGITQLLEIGPGKVLTGLTKRISKEMNAAAV 297

Query: 300 SKVEDIDLAL 309
           + +  +D AL
Sbjct: 298 NDIASLDAAL 307


>gi|192359314|ref|YP_001982154.1| malonyl CoA-acyl carrier protein transacylase [Cellvibrio japonicus
           Ueda107]
 gi|190685479|gb|ACE83157.1| malonyl CoA-acyl carrier protein transacylase [Cellvibrio japonicus
           Ueda107]
          Length = 312

 Score =  199 bits (505), Expect = 5e-49,   Method: Composition-based stats.
 Identities = 123/309 (39%), Positives = 178/309 (57%), Gaps = 3/309 (0%)

Query: 4   VLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQP 63
              FPGQGSQ IGM  +L   +P  +  F E    L  +L  L+  GSQEE+  T   QP
Sbjct: 7   AFVFPGQGSQKIGMLAELAAEYPIVQSTFAEASEVLGYDLWALVQTGSQEEINLTERTQP 66

Query: 64  ALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSM 123
            L   S+A  RV  + G       + VAGHSLGE++AL  A        +++V+ RG+ M
Sbjct: 67  LLLTASVAVWRVWNQKGGA---QPALVAGHSLGEWSALVCAGVVDFKAAVKIVQLRGRYM 123

Query: 124 QEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAAD 183
           QEAVP G+G+M AIIGLDD ++   C +A +  +    N N  GQVVI+G   AV+ A+ 
Sbjct: 124 QEAVPAGVGAMAAIIGLDDELIKDACKKAEQGDVVAAVNFNSPGQVVIAGTAAAVERASA 183

Query: 184 TCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSID 243
            C   GAKRA+ LPVSAPFH+ LM P ++ +  ++ +     P +P++ N  A+  S+ +
Sbjct: 184 LCKEAGAKRALPLPVSAPFHTELMRPAAERLADLVSATVFSVPSIPVVHNVTAATESNPE 243

Query: 244 EISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVE 303
           +I  L++EQ+   VRW + +      G  +  E G GKVL+GL KRI   LSA+S+ K E
Sbjct: 244 KIKALMIEQIYSPVRWVDCVNTMVELGATTTIECGPGKVLSGLNKRIAAQLSALSVEKPE 303

Query: 304 DIDLALRSI 312
           ++D+ L ++
Sbjct: 304 ELDVVLAAV 312


>gi|292493116|ref|YP_003528555.1| malonyl CoA-acyl carrier protein transacylase [Nitrosococcus
           halophilus Nc4]
 gi|291581711|gb|ADE16168.1| malonyl CoA-acyl carrier protein transacylase [Nitrosococcus
           halophilus Nc4]
          Length = 313

 Score =  199 bits (505), Expect = 5e-49,   Method: Composition-based stats.
 Identities = 125/313 (39%), Positives = 171/313 (54%), Gaps = 4/313 (1%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
                FPGQGSQ +GM  DL +S P+ R  F +    L  +L  L+  G +E+L  T   
Sbjct: 3   KLAFVFPGQGSQALGMLADLAESQPQVRETFTQASAILGYDLWQLVQAGPEEDLNRTDYT 62

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPA+ A  +A  RV    G       +++AGHSLGEYTA   A A      + LV  RG+
Sbjct: 63  QPAMLAAGVAVWRVWRAAGGQC---PAFMAGHSLGEYTAWVCAGAIEFEAAVGLVADRGR 119

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCA 181
            M EAVP   G+M AI+GL D  V +IC Q ++  + E  N N  GQVVI+G  +AV  A
Sbjct: 120 YMLEAVPQKEGAMAAILGLSDEAVKNICKQTAQGLVIEAVNFNAPGQVVIAGHAEAVNRA 179

Query: 182 ADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSS 241
            +     GAKRAV L VS P H  LM P ++ ++  L     + P +P++ N   +   +
Sbjct: 180 VEEAREVGAKRAVTLSVSVPSHCRLMEPAAERLRQRLSDFAIKTPSIPVVNNVDVAVNQT 239

Query: 242 IDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISK 301
            + I   L  Q+   VRW ETI W  + GV ++ E G GKVLTGL KRIDKS++A+ +  
Sbjct: 240 PEAIGDALTRQLDHPVRWVETIAWLKSQGVSTLVECGPGKVLTGLIKRIDKSMAALPVHD 299

Query: 302 VEDIDLALRSIVG 314
              ++ AL+ IVG
Sbjct: 300 PASLEKALK-IVG 311


>gi|220918032|ref|YP_002493336.1| malonyl CoA-acyl carrier protein transacylase [Anaeromyxobacter
           dehalogenans 2CP-1]
 gi|219955886|gb|ACL66270.1| malonyl CoA-acyl carrier protein transacylase [Anaeromyxobacter
           dehalogenans 2CP-1]
          Length = 313

 Score =  199 bits (505), Expect = 5e-49,   Method: Composition-based stats.
 Identities = 137/315 (43%), Positives = 185/315 (58%), Gaps = 6/315 (1%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
                FPGQGSQ +GMG++L+D+FPEAR +F+EVD  L + LS L + G +++L  T N 
Sbjct: 3   KLAFVFPGQGSQAVGMGKELHDAFPEAREIFQEVDEALGEKLSALCFGGPEDQLKLTANT 62

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QP++  VS A   V+   GL       YVAGHSLGEY+AL A  A   ++  R VRARG 
Sbjct: 63  QPSILTVSSAAAAVLANQGLV----PDYVAGHSLGEYSALVAVGACGAAEAARAVRARGT 118

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSIC--AQASRVGICEIANDNGGGQVVISGLQDAVK 179
            MQEAVP G G+M A++GLD   V  IC    A    +   AN N   Q VI+G   AV+
Sbjct: 119 FMQEAVPAGQGAMSAVLGLDPARVREICAAVAAETGQVVSPANYNEPAQTVIAGAAGAVE 178

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            A       GAKR + LPVSAPFHS+LM PV   ++ +L ++  + P+ P++ N  A P 
Sbjct: 179 QAGARLKEAGAKRVLPLPVSAPFHSALMAPVKARLEPVLRAMPWRAPLRPVVTNVEAKPN 238

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
                +  LLVEQVT  VRW E ++     GV  V EVG GKVL+GL +RID+S+ A ++
Sbjct: 239 QDASRVVPLLVEQVTAPVRWIECVEELVRLGVTRVVEVGPGKVLSGLLRRIDRSVEAFNV 298

Query: 300 SKVEDIDLALRSIVG 314
                ++  L ++ G
Sbjct: 299 EDRASLEKTLAALKG 313


>gi|260433340|ref|ZP_05787311.1| malonyl CoA-acyl carrier protein transacylase [Silicibacter
           lacuscaerulensis ITI-1157]
 gi|260417168|gb|EEX10427.1| malonyl CoA-acyl carrier protein transacylase [Silicibacter
           lacuscaerulensis ITI-1157]
          Length = 334

 Score =  199 bits (505), Expect = 5e-49,   Method: Composition-based stats.
 Identities = 154/313 (49%), Positives = 215/313 (68%), Gaps = 1/313 (0%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M+    FPGQG+Q IGMG+ L D++P A+ VF+EVD  L ++LS L+W+G  E LT T N
Sbjct: 23  MTLAFVFPGQGAQTIGMGKALADAYPAAKAVFDEVDEALGESLSSLIWDGDIETLTLTQN 82

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
           AQPAL A SMA +R +E  G+ V    ++VAGHSLGEY+AL AA A S++DT RL+R RG
Sbjct: 83  AQPALMATSMAAMRALEAEGVDVT-RAAFVAGHSLGEYSALAAAGALSVADTARLLRTRG 141

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           ++MQ AVP G G+M AI+GLD   V  +  +A++  +C+ ANDN   QVV+SG + AV+ 
Sbjct: 142 QAMQSAVPVGEGAMAAILGLDLDAVRDVAEEAAQGEVCQAANDNDPMQVVVSGAKAAVER 201

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           AA+    KGAKRAV LPVSAPFH +LM P ++VM   L SV  + P VP++ N  A  V+
Sbjct: 202 AAEIAKAKGAKRAVMLPVSAPFHCALMQPAAEVMAEALASVEIKAPAVPLVANVRAEAVT 261

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
             D I +LLVEQVTG VRWRE++Q+    GV   +E+G+GK L+G+ ++ID++++  +I 
Sbjct: 262 DPDLIRQLLVEQVTGSVRWRESVQYMVAQGVTEAWEIGAGKALSGMIRKIDRAVACTAIG 321

Query: 301 KVEDIDLALRSIV 313
             ED+  A+++  
Sbjct: 322 SPEDVQKAIQAEA 334


>gi|194014475|ref|ZP_03053092.1| malonyl CoA-acyl carrier protein transacylase [Bacillus pumilus
           ATCC 7061]
 gi|194013501|gb|EDW23066.1| malonyl CoA-acyl carrier protein transacylase [Bacillus pumilus
           ATCC 7061]
          Length = 314

 Score =  198 bits (504), Expect = 6e-49,   Method: Composition-based stats.
 Identities = 133/313 (42%), Positives = 191/313 (61%), Gaps = 5/313 (1%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
                FPGQGSQ IGMG+DL+D    ++ VFEE D TL  +LS +++ G  EELT T NA
Sbjct: 3   KIAFLFPGQGSQKIGMGKDLFDQEEVSKAVFEEADKTLGFDLSSMIFEGDAEELTLTYNA 62

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPAL   S+A ++  E++G+       Y AGHSLGEYTAL AA A S  D +  VR RG+
Sbjct: 63  QPALLTTSIAILKKFEESGI----KADYAAGHSLGEYTALVAAGALSFQDAVYAVRKRGE 118

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQASR-VGICEIANDNGGGQVVISGLQDAVKC 180
            M EAVP G G+M AI+GLD   +  +  + +    + E+AN N  GQ+VISG    V+ 
Sbjct: 119 LMNEAVPAGEGAMAAILGLDQAALLEVTKEVTESGHLVELANLNCPGQIVISGTAKGVEL 178

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A++    KGAKRA+ L VS PFHS+LM P ++    +L  +   D   P++ N  A  V+
Sbjct: 179 ASEKAKEKGAKRAIALEVSGPFHSALMKPAAEKFTDVLSKLNITDAKTPVISNVTADIVT 238

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
           S D I   L+EQ+   VR+ E+++   + GV +  E+G GKVL+GL K++++ L+ +S+S
Sbjct: 239 SRDAIETKLIEQLYSPVRFEESVERLIDLGVTTFIEIGPGKVLSGLVKKVNRRLTTISVS 298

Query: 301 KVEDIDLALRSIV 313
             E I+ A+ ++ 
Sbjct: 299 DQETIEAAIETLK 311


>gi|260654630|ref|ZP_05860120.1| malonyl CoA-acyl carrier protein transacylase [Jonquetella anthropi
           E3_33 E1]
 gi|260630646|gb|EEX48840.1| malonyl CoA-acyl carrier protein transacylase [Jonquetella anthropi
           E3_33 E1]
          Length = 317

 Score =  198 bits (504), Expect = 6e-49,   Method: Composition-based stats.
 Identities = 133/313 (42%), Positives = 182/313 (58%), Gaps = 1/313 (0%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M   L FPGQGSQ +GMG DL  ++P A+  F E D+ L   LSD+++NG +E LT T  
Sbjct: 1   MKYALIFPGQGSQNVGMGSDLCGTYPAAKAAFSEADNALGFKLSDIIFNGPEERLTLTAY 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
            QPA+   S+A  R +      VK     VAGHSLGEYTAL A+   SL+D +RLV +RG
Sbjct: 61  TQPAILVTSIALYRALT-VDCGVKLSPECVAGHSLGEYTALVASGVLSLADGVRLVHSRG 119

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
             MQEA P G G+M AI+G+D   V+ IC++  +  +CE AN N   Q+VISG  +AVK 
Sbjct: 120 SFMQEAAPEGQGAMAAIMGMDPDQVEIICSEVGKASVCEPANYNTPVQLVISGETEAVKR 179

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           AAD    +GA+RAV L VSAPFH SLM PV+  +   + + T      P++ N     VS
Sbjct: 180 AADLATQRGARRAVMLNVSAPFHCSLMRPVADRLAESMKACTWNQGAFPLVANVSGQLVS 239

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
           S+ +I   L EQ    V+W ++++     GV    E+G GKVL+G+ K+I K  S +S+ 
Sbjct: 240 SVSDIRDGLYEQTYSPVQWVKSVRTMCGLGVSRFVEIGPGKVLSGMIKKIQKDASCLSVE 299

Query: 301 KVEDIDLALRSIV 313
              D+      + 
Sbjct: 300 TAGDLSRVAEFVA 312


>gi|158425936|ref|YP_001527228.1| malonyl CoA-acyl carrier protein transacylase [Azorhizobium
           caulinodans ORS 571]
 gi|158332825|dbj|BAF90310.1| malonyl CoA-acyl carrier protein transacylase [Azorhizobium
           caulinodans ORS 571]
          Length = 318

 Score =  198 bits (504), Expect = 6e-49,   Method: Composition-based stats.
 Identities = 159/312 (50%), Positives = 212/312 (67%), Gaps = 1/312 (0%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           MST   FPGQGSQ +GMG+ L ++F  AR VF EVD  L ++L+ +MW G  +ELT T N
Sbjct: 1   MSTAFIFPGQGSQAVGMGKALAENFAAARDVFTEVDAALGEHLTRIMWEGPADELTLTAN 60

Query: 61  AQPALTAVSMAFIRVME-KNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRAR 119
           AQPAL A S+A +RV+E + GL + RD ++VAGHSLGEY+AL AA  F++SD  RL+R R
Sbjct: 61  AQPALMATSLAALRVLEAEAGLNLARDAAFVAGHSLGEYSALAAAGTFTISDAARLLRIR 120

Query: 120 GKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVK 179
           G++MQ+AVP G G+M A++GLD     ++ A+A+   +CE ANDN GGQVV+SG   AV+
Sbjct: 121 GRAMQDAVPAGAGAMAALLGLDYEQAVAVAAEAAGDDVCEAANDNAGGQVVVSGSLKAVE 180

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            A +    KGA RA+ LPVSAPFH  LM P ++ M   L  V  + PVVP++ N  ASPV
Sbjct: 181 RAIEIAKAKGASRAILLPVSAPFHCRLMEPAAEAMAAALAEVEVKAPVVPVISNVRASPV 240

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
           +   EI RLLVEQVTG VRWRE++ + A  GV    EVG+GKVL+GL +RI K +   ++
Sbjct: 241 TDPAEIVRLLVEQVTGTVRWRESVVYMAGAGVSRAVEVGAGKVLSGLVRRIAKEIQVSAV 300

Query: 300 SKVEDIDLALRS 311
              ED+   + +
Sbjct: 301 GTPEDVAAFIAT 312


>gi|323491971|ref|ZP_08097140.1| malonyl CoA-acyl carrier protein transacylase [Vibrio brasiliensis
           LMG 20546]
 gi|323313829|gb|EGA66924.1| malonyl CoA-acyl carrier protein transacylase [Vibrio brasiliensis
           LMG 20546]
          Length = 307

 Score =  198 bits (504), Expect = 6e-49,   Method: Composition-based stats.
 Identities = 124/307 (40%), Positives = 174/307 (56%), Gaps = 3/307 (0%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
              + FPGQGSQ +GM  +L + +   +  F E    L  +L  L+ NG  E+L  T   
Sbjct: 3   KFAIVFPGQGSQAVGMLAELGEQYDVVKQTFAEASDALGYDLWALVQNGPAEDLNQTHRT 62

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPAL A S+A  RV ++ GL      + +AGHSLGEY+AL  A        I+LV+ RG+
Sbjct: 63  QPALLASSVAIWRVWQELGL---EQPANLAGHSLGEYSALVCAGVIDFKQAIKLVQLRGQ 119

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCA 181
            MQEAVP G G+M AIIGLDD  +   C +A++  +    N N  GQVVI+G +DAV+ A
Sbjct: 120 LMQEAVPAGTGAMYAIIGLDDDAIAKACEEAAQGEVVSPVNFNSPGQVVIAGSKDAVERA 179

Query: 182 ADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSS 241
              C   GAKRA+ LPVS P H +LM P +  +   L+ +    P  P++ N   +  + 
Sbjct: 180 GALCKEAGAKRALPLPVSVPSHCALMKPAADKLAVALEEIEFNAPQFPVINNVDVAAETD 239

Query: 242 IDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISK 301
             +I   LV Q+   VRW E++Q  +  GV+ + E+G GKVLTGL KRI K+LS  +++ 
Sbjct: 240 PAKIKDALVRQLYSPVRWTESVQLMSEQGVEKLLELGPGKVLTGLTKRIVKTLSGAAVND 299

Query: 302 VEDIDLA 308
              +D A
Sbjct: 300 AASLDAA 306


>gi|308173553|ref|YP_003920258.1| malonyl CoA:acyl carrier protein transacylase [Bacillus
           amyloliquefaciens DSM 7]
 gi|307606417|emb|CBI42788.1| malonyl CoA:acyl carrier protein transacylase [Bacillus
           amyloliquefaciens DSM 7]
 gi|328553514|gb|AEB24006.1| malonyl CoA:acyl carrier protein transacylase [Bacillus
           amyloliquefaciens TA208]
 gi|328911694|gb|AEB63290.1| malonyl CoA:acyl carrier protein transacylase [Bacillus
           amyloliquefaciens LL3]
          Length = 317

 Score =  198 bits (504), Expect = 7e-49,   Method: Composition-based stats.
 Identities = 127/313 (40%), Positives = 193/313 (61%), Gaps = 5/313 (1%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
                FPGQGSQ IGMG+DLY+    ++ +F+E D TL   LS L++ G  EELT T NA
Sbjct: 3   KIAFLFPGQGSQYIGMGKDLYEREEASKRIFDEADETLETKLSSLIFEGDAEELTLTYNA 62

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPAL   S+A +   +++G+       + AGHSLGEY+AL AA A +  D +  VR RG+
Sbjct: 63  QPALLTTSIAVLEKFKESGIT----PDFTAGHSLGEYSALVAAGAMTFKDAVYTVRKRGE 118

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQAS-RVGICEIANDNGGGQVVISGLQDAVKC 180
            M EAVP G G+M AI+G+D   +  +  Q +    + ++AN N  GQ+VISG    V+ 
Sbjct: 119 FMNEAVPAGEGAMAAILGMDAESLKKVTDQVTENGHLVQLANLNCPGQIVISGTAKGVEL 178

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A++   N GAKRA+ L VS PFHS LM P ++ ++ +L +   ++  VP++ N  A  ++
Sbjct: 179 ASEEAKNNGAKRAIPLEVSGPFHSELMKPAAQKLEDVLSACDVKNAAVPVISNVSADVMT 238

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
             D+I + L+EQ+   VR+ ETI    + GV +  E+G GKVL+GL K++++ L  +++S
Sbjct: 239 DKDDIKKKLIEQLYSPVRFEETINKLIDEGVTTFVEIGPGKVLSGLVKKVNRRLKTIAVS 298

Query: 301 KVEDIDLALRSIV 313
             E I+LA++++ 
Sbjct: 299 DQETIELAIQTLK 311


>gi|163742698|ref|ZP_02150083.1| acyl-carrier-protein S-malonyltransferase [Phaeobacter
           gallaeciensis 2.10]
 gi|161383953|gb|EDQ08337.1| acyl-carrier-protein S-malonyltransferase [Phaeobacter
           gallaeciensis 2.10]
          Length = 310

 Score =  198 bits (504), Expect = 7e-49,   Method: Composition-based stats.
 Identities = 151/307 (49%), Positives = 208/307 (67%), Gaps = 1/307 (0%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M+    FPGQG+Q IGMG+ L +++P A+ VF+EVD  L + LS L+W G  E LT T N
Sbjct: 1   MTIAFVFPGQGAQTIGMGKALAEAYPVAKAVFDEVDAALGEALSQLIWEGDIETLTLTQN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
           AQPAL A S+A +R +E  G+ +    ++VAGHSLGEY+AL AA A S++DT RL+R RG
Sbjct: 61  AQPALMATSLAAMRALEAEGVSID-KAAFVAGHSLGEYSALAAAGAISVADTARLLRTRG 119

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           ++MQ AVP G G+M AI+GLD   V ++  +A++  +C+ ANDN   QVV+SG + AV+ 
Sbjct: 120 QAMQSAVPVGEGAMAAILGLDLEAVRAVAEEAAQGEVCQAANDNDPTQVVVSGAKAAVER 179

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           AA+    KGAKRAV LPVSAPFH +LM P + VM   L  V    P VP++ N  A  V+
Sbjct: 180 AAEIAKEKGAKRAVMLPVSAPFHCALMQPAADVMAEALADVAITSPAVPLIANVRADAVT 239

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
             DEI +LLVEQVTG VRWRE++Q  A  GV   +E+G+GK L+G+ ++ID++L++  + 
Sbjct: 240 DPDEIRKLLVEQVTGSVRWRESVQSMAAKGVTEFWEIGAGKALSGMIRKIDRNLTSRQVG 299

Query: 301 KVEDIDL 307
             ED+  
Sbjct: 300 TAEDVAA 306


>gi|262276048|ref|ZP_06053857.1| malonyl CoA-acyl carrier protein transacylase [Grimontia hollisae
           CIP 101886]
 gi|262219856|gb|EEY71172.1| malonyl CoA-acyl carrier protein transacylase [Grimontia hollisae
           CIP 101886]
          Length = 307

 Score =  198 bits (504), Expect = 7e-49,   Method: Composition-based stats.
 Identities = 127/309 (41%), Positives = 177/309 (57%), Gaps = 4/309 (1%)

Query: 1   MS-TVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATC 59
           MS   + FPGQGSQ +GM  +L + FP  +  F E    L  +L  L+ NG  E+L  T 
Sbjct: 1   MSNFAVVFPGQGSQAVGMLAELAEQFPVVQETFAEASEVLGYDLWALVQNGPAEDLNQTN 60

Query: 60  NAQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRAR 119
             QPAL   S+A  RV ++ G       S +AGHSLGEY+AL  A        ++LV  R
Sbjct: 61  RTQPALLTASVAIWRVWQQEGGA---QPSVMAGHSLGEYSALVCAGVIDFKQAVKLVELR 117

Query: 120 GKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVK 179
           G+ MQEAVP G+G+M AIIGLD+  +   C +A++  +    N N  GQVVI+G ++AV+
Sbjct: 118 GELMQEAVPAGVGAMSAIIGLDNDAIAKACEEAAQGQVVSPVNFNSPGQVVIAGNKEAVE 177

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            A   C   GAKRA+ LPVS P H +LM P +  +   L+ +    P +P++ N   +  
Sbjct: 178 RANALCKAAGAKRALPLPVSVPSHCALMKPAADKLAVALEEIEFSAPSIPVINNADVAIE 237

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
           +    I   LV Q+ G VRW E  +  AN GV+ + E+G GKVLTGLAKRIDK L+A ++
Sbjct: 238 TDPAAIKDALVRQLYGPVRWTEGCEKMANDGVELLLEMGPGKVLTGLAKRIDKRLNAAAV 297

Query: 300 SKVEDIDLA 308
           +    ++ A
Sbjct: 298 NDPASLEAA 306


>gi|86159171|ref|YP_465956.1| [acyl-carrier-protein] S-malonyltransferase [Anaeromyxobacter
           dehalogenans 2CP-C]
 gi|85775682|gb|ABC82519.1| [Acyl-carrier-protein] S-malonyltransferase [Anaeromyxobacter
           dehalogenans 2CP-C]
          Length = 313

 Score =  198 bits (504), Expect = 7e-49,   Method: Composition-based stats.
 Identities = 136/315 (43%), Positives = 184/315 (58%), Gaps = 6/315 (1%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
                FPGQGSQ +GMG+DL+D+FPEAR +FEEVD  L + LS L + G +++L  T N 
Sbjct: 3   KLAFVFPGQGSQAVGMGKDLHDAFPEAREIFEEVDEALGEKLSALCFGGPEDQLKLTANT 62

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QP++  VS A   V+   GL       +VAGHSLGEY+AL A  A   ++  R VRARG 
Sbjct: 63  QPSILTVSSAAAAVLANQGLV----PDFVAGHSLGEYSALVAVGACGAAEAARAVRARGT 118

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIAN--DNGGGQVVISGLQDAVK 179
            MQEAVP G G+M A++GLD   V  ICA  +      ++    N   Q VI+G   AV+
Sbjct: 119 FMQEAVPAGQGAMSAVLGLDPARVREICAAVASETGQVVSPANYNEPAQTVIAGAAGAVE 178

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            A       GAKR + LPVSAPFHS+LM PV   ++ +L  +  + P+ P++ N  A P 
Sbjct: 179 QAGARLKEAGAKRVLPLPVSAPFHSALMAPVKARLEPVLRGIAWKAPLRPVVTNVEAKPN 238

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
                +  LLVEQVT  VRW E ++     GV  V EVG GKVL+GL +RID+S+ A ++
Sbjct: 239 QDAARVVPLLVEQVTAPVRWIECVEELVRLGVTRVVEVGPGKVLSGLIRRIDRSVEAFNV 298

Query: 300 SKVEDIDLALRSIVG 314
                ++  L ++ G
Sbjct: 299 EDRASLEKTLAALKG 313


>gi|15896809|ref|NP_350158.1| acyl-carrier-protein S-malonyltransferase [Clostridium
           acetobutylicum ATCC 824]
 gi|15026671|gb|AAK81498.1|AE007854_5 Malonyl CoA-acyl carrier protein transacylase [Clostridium
           acetobutylicum ATCC 824]
 gi|325510983|gb|ADZ22619.1| acyl-carrier-protein S-malonyltransferase [Clostridium
           acetobutylicum EA 2018]
          Length = 308

 Score =  198 bits (504), Expect = 7e-49,   Method: Composition-based stats.
 Identities = 124/306 (40%), Positives = 183/306 (59%), Gaps = 3/306 (0%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
                F GQGSQ +GMG+DLYD++  A+  F++ D  L   +S+L + G  EEL  T N 
Sbjct: 3   KIAFVFSGQGSQYVGMGKDLYDNYQSAKETFDKADEVLGFKISELCFEGKDEELNLTENT 62

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPA+   S+A +R +E+           VAG SLGEY+A   + +FS  D +RLV+ RG+
Sbjct: 63  QPAVLITSIAALRALEE---EKGIKPDVVAGLSLGEYSAHVCSGSFSFEDAVRLVKKRGR 119

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCA 181
            MQEAVP G+G+M AIIGL+  VV  ICA+ S+ GI E+AN N  GQ+VI+G   AV+ A
Sbjct: 120 YMQEAVPKGIGTMAAIIGLEGDVVRGICAEQSKEGIVEVANYNCPGQIVIAGEVKAVESA 179

Query: 182 ADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSS 241
                  GA+R V L VS PFH+S++   ++ ++  L ++  +D  VP++ N     V  
Sbjct: 180 CTKLKESGARRTVMLSVSGPFHTSMLKSAAEKLEEELKNINIEDMKVPVITNVTGDYVED 239

Query: 242 IDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISK 301
            D+I  LL +QV   VRW +TI+   + GV +  E+G GK L+   K+I++ ++  +I K
Sbjct: 240 KDQIKGLLKKQVMSSVRWEDTIRRMMDDGVDTFIELGPGKTLSSFIKKINRKMTIFNIEK 299

Query: 302 VEDIDL 307
            ED++ 
Sbjct: 300 AEDLNK 305


>gi|28898829|ref|NP_798434.1| acyl carrier protein S-malonyltransferase [Vibrio parahaemolyticus
           RIMD 2210633]
 gi|28807048|dbj|BAC60318.1| malonyl Coa-acyl carrier protein transacylase [Vibrio
           parahaemolyticus RIMD 2210633]
          Length = 307

 Score =  198 bits (503), Expect = 7e-49,   Method: Composition-based stats.
 Identities = 129/307 (42%), Positives = 180/307 (58%), Gaps = 3/307 (0%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
              + FPGQGSQ +GM  DL + +   +  F E    L  +L  L+ NG  E+L  T   
Sbjct: 3   KFAIVFPGQGSQAVGMLADLGEQYDVVKQTFAEASDALGYDLWALVQNGPAEDLNQTFRT 62

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPAL A S+A  RV ++ GL      + +AGHSLGEY+AL  A      + I+LV  RGK
Sbjct: 63  QPALLASSVAIWRVWQELGL---EQPANLAGHSLGEYSALVCAGVIDFKEAIKLVELRGK 119

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCA 181
            MQEAVP G G+M AIIGLDD V+   C +A++  +    N N  GQVVI+G +DAV+ A
Sbjct: 120 LMQEAVPAGTGAMYAIIGLDDDVIAKACEEAAQGDVVSPVNFNSPGQVVIAGSKDAVERA 179

Query: 182 ADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSS 241
              C   GAKRA+ LPVS P H +LM P +  +   L+S+    P +P++ N   +  + 
Sbjct: 180 GALCKEAGAKRALPLPVSVPSHCALMKPAADKLAVALESIEFNTPQLPVINNVDVAAETD 239

Query: 242 IDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISK 301
             +I   LV Q+   VRW E++Q  +  GV+++ E+G GKVLTGL KRI K+LSA +++ 
Sbjct: 240 PAKIKDALVRQLYSPVRWTESVQLMSEQGVENLLELGPGKVLTGLTKRIVKTLSAAAVND 299

Query: 302 VEDIDLA 308
           V  ++ A
Sbjct: 300 VASLEAA 306


>gi|227824527|ref|ZP_03989359.1| malonyl CoA-acyl carrier protein transacylase [Acidaminococcus sp.
           D21]
 gi|226905026|gb|EEH90944.1| malonyl CoA-acyl carrier protein transacylase [Acidaminococcus sp.
           D21]
          Length = 315

 Score =  198 bits (503), Expect = 8e-49,   Method: Composition-based stats.
 Identities = 124/314 (39%), Positives = 180/314 (57%), Gaps = 6/314 (1%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
                FPGQGSQ +GM +DLYD++   + VF+E D  L  +++DL + G +E+L  T N 
Sbjct: 3   KIAFMFPGQGSQKVGMMKDLYDNYSVVKDVFKEADEALGFSMTDLCFKGPEEQLRLTYNT 62

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPA+   S+A ++V+E+N +      S VAGHSLGEY+AL  A A S +D +R VR RG+
Sbjct: 63  QPAILTCSVAAMKVLEENEII----PSVVAGHSLGEYSALVCAGAMSFADAVRTVRKRGQ 118

Query: 122 SMQEAVPPGL--GSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVK 179
            MQEAVP G    + +  +  D                 +  N N  GQ+VI+G  +AV 
Sbjct: 119 FMQEAVPVGEGAMAAIIGLDTDKIKEICAETANMTNQCVQAVNFNCPGQIVIAGATEAVH 178

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            A D     GAKRA+ LPVSAPFHS+LM P +  +K +LDSV   D  +P++ N  A P 
Sbjct: 179 KACDRLKEAGAKRAILLPVSAPFHSTLMQPAADRLKEVLDSVEIVDAKIPVVANVNAKPE 238

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
           +  DEI   LV Q    V W ++++   N GV +  EVG GKVL G  K++D+S + +++
Sbjct: 239 TKADEIRSQLVLQAASPVLWEDSVRRMMNDGVDTFVEVGPGKVLCGFIKKVDRSYAPLNV 298

Query: 300 SKVEDIDLALRSIV 313
             +E ++ +L  + 
Sbjct: 299 EDMESLEKSLAYLK 312


>gi|297530635|ref|YP_003671910.1| malonyl CoA-acyl carrier protein transacylase [Geobacillus sp.
           C56-T3]
 gi|297253887|gb|ADI27333.1| malonyl CoA-acyl carrier protein transacylase [Geobacillus sp.
           C56-T3]
          Length = 313

 Score =  198 bits (503), Expect = 8e-49,   Method: Composition-based stats.
 Identities = 132/314 (42%), Positives = 195/314 (62%), Gaps = 5/314 (1%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
                FPGQGSQ +GM +D  +    AR V  E D  L   LS LM+NG QEELT T NA
Sbjct: 3   KIAFLFPGQGSQTVGMAKDAAEHDARARAVIAEADERLGFALSKLMFNGPQEELTLTYNA 62

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPAL   S+A +++++  G        YVAGHSLGEYTAL AA A S +D +  VR RG+
Sbjct: 63  QPALLTASIALLQLVDGAG----LKADYVAGHSLGEYTALVAAGAMSFADAVYAVRRRGE 118

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQ-ASRVGICEIANDNGGGQVVISGLQDAVKC 180
            M EAVP G G+M A++G+D   ++++  + A++    E AN N  GQ+VISG +  V+ 
Sbjct: 119 LMDEAVPAGEGTMAAVLGMDADALEAVTNEIAAQGDPVEPANFNCPGQIVISGSKAGVEK 178

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           AA     +GAKR + L VS PFHS+LM P ++ +K +LDS+  +D V+P++ N  A PV+
Sbjct: 179 AAQLLKERGAKRVIPLEVSGPFHSALMKPAAEKLKAVLDSLVIRDAVIPVVANVTAEPVT 238

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
             ++I+RLL+EQ+   VRW ++++   + GV    E+G GKVL+GL K+ID++    +++
Sbjct: 239 KKEDIARLLIEQLYSPVRWEQSVRTLLSLGVDMFVEIGPGKVLSGLVKKIDRNARVYAVN 298

Query: 301 KVEDIDLALRSIVG 314
            +   +  + ++ G
Sbjct: 299 DLASFEATVAALKG 312


>gi|239826582|ref|YP_002949206.1| malonyl CoA-acyl carrier protein transacylase [Geobacillus sp.
           WCH70]
 gi|239806875|gb|ACS23940.1| malonyl CoA-acyl carrier protein transacylase [Geobacillus sp.
           WCH70]
          Length = 313

 Score =  198 bits (503), Expect = 9e-49,   Method: Composition-based stats.
 Identities = 125/314 (39%), Positives = 193/314 (61%), Gaps = 5/314 (1%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
                FPGQGSQ +GMG+D+  S      VF+  D  L  +LS L++ G QE LT T NA
Sbjct: 3   KIAFIFPGQGSQTVGMGKDVAQSDANIAAVFQSADERLGFSLSSLIFEGPQETLTLTYNA 62

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPAL   S+A +  +++ G+       YVAGHSLGEYTAL AA A S +D +  VR RG+
Sbjct: 63  QPALLTTSIALLEKVKEAGITAD----YVAGHSLGEYTALVAAGAISFTDAVYAVRKRGE 118

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQA-SRVGICEIANDNGGGQVVISGLQDAVKC 180
            M+EAVP G G+M A++G+D   ++++  +   +    ++AN N  GQ+VISG +  V+ 
Sbjct: 119 FMEEAVPAGEGTMAAVLGMDAAALEAVTKEVSEQGDPVQLANLNCPGQIVISGSKAGVEK 178

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A      +GAKR + L VS PFHSSLM P +  ++ +L+++  +D  +P++ N  A PV 
Sbjct: 179 AGQLAKERGAKRVIPLEVSGPFHSSLMKPAASKLQDVLNTIAIRDAEIPVISNVTAQPVV 238

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
             +EI RLL+EQ+   VRW ++++     GV +  E+G GKVL+GL K+I++++S  +++
Sbjct: 239 KKEEILRLLIEQLYSPVRWEQSVEMMIGLGVDTFIEIGPGKVLSGLVKKINRNVSVYAVN 298

Query: 301 KVEDIDLALRSIVG 314
            +E +   + ++ G
Sbjct: 299 DLESLQATVAALKG 312


>gi|289523233|ref|ZP_06440087.1| malonyl CoA-acyl carrier protein transacylase [Anaerobaculum
           hydrogeniformans ATCC BAA-1850]
 gi|289503776|gb|EFD24940.1| malonyl CoA-acyl carrier protein transacylase [Anaerobaculum
           hydrogeniformans ATCC BAA-1850]
          Length = 317

 Score =  198 bits (503), Expect = 9e-49,   Method: Composition-based stats.
 Identities = 132/315 (41%), Positives = 183/315 (58%), Gaps = 3/315 (0%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M+    FPGQG Q +GMGR+ YD F  +R +F   D  L   LS +++ G +EELT T  
Sbjct: 1   MAYAFVFPGQGVQEVGMGREFYDEFTVSREMFLRADEALGFPLSRVIFEGPEEELTKTEF 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
           AQPA+  VS+A    ++     +  D S+VAGHSLGEYT+L A+ A  L D +RLV  RG
Sbjct: 61  AQPAILTVSIAAFEALKSMRKEL--DPSFVAGHSLGEYTSLVASGALKLEDGVRLVNIRG 118

Query: 121 KSMQEAVPPGLGSMVAIIGLD-DCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVK 179
           K MQ+ VP G+G+M AIIGLD + V +     ++    CE AN N   Q+V+SG  +AV 
Sbjct: 119 KLMQQVVPLGVGAMAAIIGLDKETVEEICSLASTAESFCEPANYNSPQQIVLSGHAEAVN 178

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            A +    + AKRAV L VSAPFHSSLM PV++ +     S   + P  P++ N  A P+
Sbjct: 179 RAIELAKERKAKRAVPLKVSAPFHSSLMRPVAEGLSEAFKSCEWRRPKWPVVANVNAKPL 238

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
            S++EI + L+ Q    V W +++++    G  S  EVG G VLTGL K+I K +   S+
Sbjct: 239 ESVEEIQKALLLQSYSPVLWTQSVEFMRGAGADSFLEVGPGGVLTGLIKKIAKDVKVYSL 298

Query: 300 SKVEDIDLALRSIVG 314
              E +  AL  + G
Sbjct: 299 DSPEKLKGALDFLGG 313


>gi|296331165|ref|ZP_06873639.1| malonyl CoA-acyl carrier protein transacylase [Bacillus subtilis
           subsp. spizizenii ATCC 6633]
 gi|305674321|ref|YP_003865993.1| malonyl CoA:acyl carrier protein transacylase [Bacillus subtilis
           subsp. spizizenii str. W23]
 gi|296151809|gb|EFG92684.1| malonyl CoA-acyl carrier protein transacylase [Bacillus subtilis
           subsp. spizizenii ATCC 6633]
 gi|305412565|gb|ADM37684.1| malonyl CoA:acyl carrier protein transacylase [Bacillus subtilis
           subsp. spizizenii str. W23]
          Length = 317

 Score =  198 bits (503), Expect = 9e-49,   Method: Composition-based stats.
 Identities = 128/313 (40%), Positives = 189/313 (60%), Gaps = 5/313 (1%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
                FPGQGSQ IGMG+DLY+  P A+ +F+E D  L   LS L++ G  +ELT T NA
Sbjct: 3   KIAFLFPGQGSQFIGMGKDLYEQVPAAKRLFDEADEKLETKLSSLIFEGDAKELTLTYNA 62

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPAL   S+A +   +++G+       + AGHSLGEY+AL A+ A S  D +  VR RG+
Sbjct: 63  QPALLTTSIAVLEKFKESGIT----PDFTAGHSLGEYSALVASGALSFKDAVYTVRKRGE 118

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQAS-RVGICEIANDNGGGQVVISGLQDAVKC 180
            M EAVP G G+M AI+G+D   +  +  + +    + ++AN N  GQ+VISG    V+ 
Sbjct: 119 FMNEAVPAGEGAMAAILGMDAEALKKVTDKVTEEGHLVQLANLNCPGQIVISGTAKGVEL 178

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A++     GAKRA+ L VS PFHS LM P ++ +K +LDS   +D  VP++ N  A  ++
Sbjct: 179 ASEQAKENGAKRAIPLEVSGPFHSELMKPAAEKLKEVLDSCDIKDASVPVISNVSADVMT 238

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
              EI   L+EQ+   VR+ E+I      GV    E+G GKVL+GL K++++ L  +++S
Sbjct: 239 EKAEIKEKLIEQLYSPVRFEESINKLIAEGVTIFIEIGPGKVLSGLVKKVNRRLKTIAVS 298

Query: 301 KVEDIDLALRSIV 313
             E I+LA++++ 
Sbjct: 299 DPETIELAIQTLK 311


>gi|315648185|ref|ZP_07901286.1| malonyl CoA-acyl carrier protein transacylase [Paenibacillus vortex
           V453]
 gi|315276831|gb|EFU40174.1| malonyl CoA-acyl carrier protein transacylase [Paenibacillus vortex
           V453]
          Length = 310

 Score =  198 bits (503), Expect = 9e-49,   Method: Composition-based stats.
 Identities = 122/308 (39%), Positives = 180/308 (58%), Gaps = 5/308 (1%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
            T   FPGQG+Q +GMG+D YD+ P  + +F+  D  L  +LS +++NG   EL  T N 
Sbjct: 3   KTAFIFPGQGAQSVGMGKDAYDALPSVQDMFQTADDKLGFSLSSIIFNGPDAELKQTVNT 62

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPAL A S+A++  +   G+    +  YVAGHSLGEY+AL  A   S  + + +VRARG+
Sbjct: 63  QPALLATSLAYLEAIRGKGI----EPDYVAGHSLGEYSALVCAGVLSFEEAVSIVRARGE 118

Query: 122 SMQEAVPPGLGSMVAIIGLD-DCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
            M+ AVP G G+M A++G D D +        +   + E+AN N  GQ+VISG    V  
Sbjct: 119 YMEAAVPGGQGAMAAVLGADRDALTTLCSGITAEGHVVELANMNCPGQIVISGSAQGVAA 178

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           AA+     G KRA+ L VS PFHSSLM   +  +   L+  +   P VP++ N  A PV 
Sbjct: 179 AAERIKEAGGKRAIPLEVSGPFHSSLMKEAANRLADKLEQASFHTPSVPVVANVTARPVD 238

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
               I  LLVEQV   V W+++++W  + GV +  E+G G VL+GL K+IDKS+  ++++
Sbjct: 239 DAAAIRGLLVEQVYSPVLWQDSVEWMISQGVDTFVEIGPGSVLSGLIKKIDKSVKVINVN 298

Query: 301 KVEDIDLA 308
            ++ ++  
Sbjct: 299 SLDSVNSL 306


>gi|291617035|ref|YP_003519777.1| FabD [Pantoea ananatis LMG 20103]
 gi|291152065|gb|ADD76649.1| FabD [Pantoea ananatis LMG 20103]
          Length = 312

 Score =  198 bits (503), Expect = 9e-49,   Method: Composition-based stats.
 Identities = 128/314 (40%), Positives = 174/314 (55%), Gaps = 6/314 (1%)

Query: 1   MS---TVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTA 57
           M        FPGQGSQ +GM  DL  ++P     F E    L  +L  L+  G  EEL  
Sbjct: 1   MKMTQFAFVFPGQGSQTVGMLADLAAAYPAVEATFREASDVLGYDLWQLVSQGPAEELNK 60

Query: 58  TCNAQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVR 117
           T   QPAL A S+A  RV ++ G       + +AGHSLGEY+AL  A   + +D I+LV 
Sbjct: 61  TWQTQPALLAASVAIYRVWQQQGGQ---QPALMAGHSLGEYSALVCAGVLNFADAIKLVE 117

Query: 118 ARGKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDA 177
            RGK MQEAVP G G+M AIIGLDD  +   C ++++  +    N N  GQVVI+G ++A
Sbjct: 118 LRGKLMQEAVPEGTGAMQAIIGLDDAAIAKACEESAQGQVVSPVNFNSPGQVVIAGNKEA 177

Query: 178 VKCAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCAS 237
           V+ A   C   GAKRA+ LPVS P H +LM P +  +   L+++T   P VP++ N    
Sbjct: 178 VERAGAACKAAGAKRALPLPVSVPSHCALMKPAADKLALTLENITFNAPAVPVINNVDVK 237

Query: 238 PVSSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAV 297
             +  D I   L+ Q+   VRW E+++  A  GV  + E+G GKVLTGL KRI   LSA 
Sbjct: 238 AETDADAIRHALIRQLYSPVRWTESVEAMAAQGVTQLIEMGPGKVLTGLTKRIVDGLSAA 297

Query: 298 SISKVEDIDLALRS 311
           +++    +  AL  
Sbjct: 298 AVNDTASLTAALAQ 311


>gi|316933694|ref|YP_004108676.1| malonyl CoA-acyl carrier protein transacylase [Rhodopseudomonas
           palustris DX-1]
 gi|315601408|gb|ADU43943.1| malonyl CoA-acyl carrier protein transacylase [Rhodopseudomonas
           palustris DX-1]
          Length = 319

 Score =  198 bits (502), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 161/314 (51%), Positives = 221/314 (70%), Gaps = 1/314 (0%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M+   TFPGQGSQ +GMG+ L D+FP AR VF+EVD  L + L+ ++W+G  E L  T N
Sbjct: 1   MTAAFTFPGQGSQAVGMGKALADAFPAARAVFDEVDAALGEKLTAIIWDGPAETLQLTEN 60

Query: 61  AQPALTAVSMAFIRVME-KNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRAR 119
           AQPAL AVS+A +RV+E + G+ V +D ++VAGHSLGEY+AL AA + S+SDT RL+R R
Sbjct: 61  AQPALMAVSLATMRVLEAEAGVSVGKDAAFVAGHSLGEYSALAAAGSLSVSDTARLLRIR 120

Query: 120 GKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVK 179
           G++MQ+AVP G+G+M A++GLD     ++ A+A++  +C+ ANDNGGGQVV+SG +DAV+
Sbjct: 121 GQAMQKAVPVGVGAMAALLGLDYDTAVAVAAEAAQGQVCQAANDNGGGQVVVSGHKDAVE 180

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            A +    KGAKRA+ LPVSAPFH SLM P ++ M   L  VT + P  P++ N  ASP+
Sbjct: 181 RAVEIAKGKGAKRAMLLPVSAPFHCSLMQPAAEAMAEALAGVTIKAPAAPLVANVLASPI 240

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
           +  DEI R LVEQVTG VRWRE++ + A+ GV    E+G+GKVL+GL KRI    + +S+
Sbjct: 241 TDPDEIRRRLVEQVTGTVRWRESVAFMASQGVNQFLEIGAGKVLSGLVKRIADGATGISV 300

Query: 300 SKVEDIDLALRSIV 313
               DI  A  ++ 
Sbjct: 301 GGPNDIASAKDALA 314


>gi|189424997|ref|YP_001952174.1| malonyl CoA-acyl carrier protein transacylase [Geobacter lovleyi
           SZ]
 gi|189421256|gb|ACD95654.1| malonyl CoA-acyl carrier protein transacylase [Geobacter lovleyi
           SZ]
          Length = 307

 Score =  198 bits (502), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 128/308 (41%), Positives = 179/308 (58%), Gaps = 3/308 (0%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
            T   FPGQGSQ  GMG+DL ++FP AR  FEE D  L   LS L +NG +E+L  T N 
Sbjct: 3   KTSFLFPGQGSQYAGMGKDLAENFPIARHTFEEADEALGFKLSSLCFNGPEEDLKLTFNT 62

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPA+   S+A    +             VAGHSLGEY+AL    A +L+D +R VR+RG 
Sbjct: 63  QPAILTASVAA---LRVVQQETGLQADCVAGHSLGEYSALVCGGALTLADAVRTVRSRGT 119

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCA 181
            MQEAVP G+G+M A++ ++   + +ICA+A++  +   AN N  GQ+VI+G   AV   
Sbjct: 120 FMQEAVPVGVGAMAAMLSIEAEELAAICAEAAQGEVVAPANFNSPGQIVIAGHATAVNRT 179

Query: 182 ADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSS 241
            +    KG ++A+ LPVSAPFH +LM P +  +K +LD VT     +P++ N  A+    
Sbjct: 180 IELAKAKGFRKAMLLPVSAPFHCALMQPAADRLKEVLDCVTIHPLTLPVVTNVEAAANQD 239

Query: 242 IDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISK 301
              +  LLV QV   VRW +++    N GV    E+G GKVLTGL KRI+K ++ V+I  
Sbjct: 240 AGRVRELLVAQVCAPVRWEQSVHAMINQGVSRFVEIGPGKVLTGLVKRINKEMALVNIED 299

Query: 302 VEDIDLAL 309
              +  A+
Sbjct: 300 TAGVKAAV 307


>gi|83589797|ref|YP_429806.1| [Acyl-carrier-protein] S-malonyltransferase [Moorella thermoacetica
           ATCC 39073]
 gi|83572711|gb|ABC19263.1| [Acyl-carrier-protein] S-malonyltransferase [Moorella thermoacetica
           ATCC 39073]
          Length = 312

 Score =  198 bits (502), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 122/313 (38%), Positives = 175/313 (55%), Gaps = 6/313 (1%)

Query: 1   MS-TVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATC 59
           MS  V  FPGQGSQ +GMG++L   +PEA  VF E    L   +  L++NG  EEL  T 
Sbjct: 1   MSGIVFLFPGQGSQYVGMGQELAQHYPEAAAVFTEASEELGWPVDKLVFNGPAEELVRTE 60

Query: 60  NAQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRAR 119
           N QPA+   S+A  RV+E  G+        VAGHSLGEY+AL AA + S  D +R+V  R
Sbjct: 61  NTQPAVLTTSIACYRVLEARGI----KPRAVAGHSLGEYSALVAAGSLSFKDALRVVVQR 116

Query: 120 GKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVK 179
            + M  AVP G G MVA++GL    V ++C +     + E AN N  GQVV++G +  ++
Sbjct: 117 ARLMANAVPCGQGGMVAVLGLPAERVVALCQEVKEG-VAEAANFNSPGQVVVAGDRAGLE 175

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
                    GAK+ + L VS PFHSSLM PV++ +  +L+ V   DPVVP++ N  A   
Sbjct: 176 AITALAREAGAKKVIPLQVSGPFHSSLMEPVARELATVLNRVPLSDPVVPVVANVTADYT 235

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
            +   +   L+ QV   VRW E+++     G ++  EVG G VL+GL KR+D+ +    +
Sbjct: 236 VTAAAVRENLLRQVASPVRWEESMRRLLADGYRTFVEVGPGNVLSGLIKRLDRQVRIGQV 295

Query: 300 SKVEDIDLALRSI 312
             ++ +   L  +
Sbjct: 296 ENIQTLGKTLALL 308


>gi|304397219|ref|ZP_07379098.1| malonyl CoA-acyl carrier protein transacylase [Pantoea sp. aB]
 gi|304355368|gb|EFM19736.1| malonyl CoA-acyl carrier protein transacylase [Pantoea sp. aB]
          Length = 310

 Score =  198 bits (502), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 127/310 (40%), Positives = 174/310 (56%), Gaps = 4/310 (1%)

Query: 1   MS-TVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATC 59
           M+     FPGQGSQ +GM  +L  ++P     F E    L  +L  L+  G  EEL  T 
Sbjct: 1   MTQIAFVFPGQGSQTVGMLTELAATYPLVEETFREASDALGYDLWQLVSQGPAEELNKTW 60

Query: 60  NAQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRAR 119
             QPAL A S+A  RV ++ G         +AGHSLGEY+AL  A   S +D ++LV  R
Sbjct: 61  QTQPALLAASVAIYRVWQQQGGQ---QPVLMAGHSLGEYSALVCAGVLSFADAVKLVELR 117

Query: 120 GKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVK 179
           GK MQEAVP G G+M AIIGLDD  +   C ++++  +    N N  GQVVI+G ++AV+
Sbjct: 118 GKLMQEAVPEGTGAMQAIIGLDDAAIRKACEESAQGQVVSPVNFNSPGQVVIAGNKEAVE 177

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            A   C   GAKRA+ LPVS P H +LM P +  +   L+++T   P VP++ N      
Sbjct: 178 RAGAACKAAGAKRALPLPVSVPSHCALMKPAADKLAVALENITFAAPAVPVINNVDVKAE 237

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
           +    I   LV Q+   VRW E+++  A  GV  + E+G GKVLTGL KRI  SL+A ++
Sbjct: 238 TDAAAIRHALVRQLYSPVRWTESVEAMAEQGVTQLLEMGPGKVLTGLTKRIVDSLTAAAV 297

Query: 300 SKVEDIDLAL 309
           +    +  AL
Sbjct: 298 NDTASLTAAL 307


>gi|269102262|ref|ZP_06154959.1| malonyl CoA-acyl carrier protein transacylase [Photobacterium
           damselae subsp. damselae CIP 102761]
 gi|268162160|gb|EEZ40656.1| malonyl CoA-acyl carrier protein transacylase [Photobacterium
           damselae subsp. damselae CIP 102761]
          Length = 309

 Score =  198 bits (502), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 124/309 (40%), Positives = 178/309 (57%), Gaps = 3/309 (0%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
              + FPGQGSQ +GM  +L + FP  +  F E    L  +L  L+ NG  E+L  T   
Sbjct: 3   KFAIVFPGQGSQAVGMLAELAEQFPIVQATFAEASEVLGYDLWALVQNGPAEDLNQTHRT 62

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPAL   S+A  RV ++ G       + +AGHSLGEY+AL  A      + ++LV  RG+
Sbjct: 63  QPALLTASVAIWRVWQEKGG---EQPTVLAGHSLGEYSALVCAGVIDFKEAVKLVELRGQ 119

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCA 181
            MQEAVP G+G+M AIIGLD+  +   CA A+   +C   N N  GQVVI+G ++AV  A
Sbjct: 120 LMQEAVPAGVGAMSAIIGLDNDAIAKACADAAEDQVCSPVNFNSPGQVVIAGNKEAVDRA 179

Query: 182 ADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSS 241
              C   GAKRA+ LPVS P H  LM P +  +   L+++T   P +P++ N   +  + 
Sbjct: 180 NTLCKEAGAKRALLLPVSVPSHCELMKPAADKLAVALENMTFNTPAIPVINNADVATETD 239

Query: 242 IDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISK 301
              I   LV+Q+ G VRW E+++  A  G++ + E+G GKVLTGL KRI++SL   +++ 
Sbjct: 240 PAAIKLALVKQLYGPVRWTESVERMAAEGIEELLEMGPGKVLTGLTKRINRSLGGSAVND 299

Query: 302 VEDIDLALR 310
           +  +D AL 
Sbjct: 300 IASLDAALA 308


>gi|156975182|ref|YP_001446089.1| malonyl CoA-acyl carrier protein transacylase [Vibrio harveyi ATCC
           BAA-1116]
 gi|156526776|gb|ABU71862.1| hypothetical protein VIBHAR_02909 [Vibrio harveyi ATCC BAA-1116]
          Length = 324

 Score =  198 bits (502), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 127/307 (41%), Positives = 180/307 (58%), Gaps = 3/307 (0%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
              + FPGQGSQ +GM  DL + +   +  F E    L  +L  L+ NG  E+L  T   
Sbjct: 20  KFAIVFPGQGSQAVGMLADLGEQYDVVKQTFAEASDALGYDLWALVQNGPAEDLNQTFRT 79

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPAL A S+A  RV ++ GL      + +AGHSLGEY+AL  A      + I+LV  RG+
Sbjct: 80  QPALLASSVAIWRVWQELGL---EQPANLAGHSLGEYSALVCAGVIDFKEAIKLVELRGQ 136

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCA 181
            MQEAVP G G+M AIIGLDD  +   C +A++  +    N N  GQVVI+G +DAV+ A
Sbjct: 137 LMQEAVPSGTGAMYAIIGLDDEAIAKACEEAAQGEVVSPVNFNSPGQVVIAGSKDAVERA 196

Query: 182 ADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSS 241
              C   GAKRA+ LPVS P H +LM P ++ +   L+S+    P +P++ N   +  + 
Sbjct: 197 GALCKEAGAKRALPLPVSVPSHCALMKPAAEKLAVALESIEFNAPQLPVINNVDVAAETD 256

Query: 242 IDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISK 301
             +I   LV Q+   VRW E++Q  +  GV+++ E+G GKVLTGL KRI K+LSA +++ 
Sbjct: 257 PAKIKDALVRQLHSPVRWTESVQLMSEQGVENLLELGPGKVLTGLTKRIVKTLSAAAVND 316

Query: 302 VEDIDLA 308
           V  ++ A
Sbjct: 317 VASLEAA 323


>gi|220928134|ref|YP_002505043.1| malonyl CoA-acyl carrier protein transacylase [Clostridium
           cellulolyticum H10]
 gi|219998462|gb|ACL75063.1| malonyl CoA-acyl carrier protein transacylase [Clostridium
           cellulolyticum H10]
          Length = 310

 Score =  197 bits (501), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 125/312 (40%), Positives = 189/312 (60%), Gaps = 4/312 (1%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
                FPGQG+Q +GMG+++ D +  A  VF+E    L  ++ ++++NG  E L  T N 
Sbjct: 3   KVAFLFPGQGAQYVGMGKEIADEYKSASKVFDEATEALGFDVREMIFNGDDETLKITENT 62

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QP +   S+A ++ + + G+       +VAG SLGEY A   A   S  D + LV+ RGK
Sbjct: 63  QPTIVTTSIACMQPLLEKGI----RPDFVAGLSLGEYAAHVTAGTISFKDAVALVKKRGK 118

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCA 181
            MQEAVP G+G+M AIIGL++  V   C +AS+VGI E AN N  GQ+V++G + AV+ A
Sbjct: 119 YMQEAVPIGVGAMAAIIGLENNDVIECCKEASQVGIVEPANFNCPGQIVVAGEKAAVEKA 178

Query: 182 ADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSS 241
           A+ C  KGAKRA+ LPVSAPFH SL+ P  + +   LD V+  D  +P++ N     V++
Sbjct: 179 AELCKAKGAKRAMLLPVSAPFHCSLLKPAGEKLAVELDMVSLNDIKIPVVTNVTGETVTN 238

Query: 242 IDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISK 301
            D +  LLV+QV+  V   ++I+   + GV +  E+G GKVL+G  K+ID+    +++  
Sbjct: 239 KDFVKDLLVKQVSTSVLLEKSIRTMLDAGVDTFVEIGPGKVLSGFVKKIDRDAKVLNVEN 298

Query: 302 VEDIDLALRSIV 313
           +E ++ AL  +V
Sbjct: 299 LETLNKALEVLV 310


>gi|304436764|ref|ZP_07396732.1| malonyl-CoA-[acyl-carrier-protein] transacylase [Selenomonas sp.
           oral taxon 149 str. 67H29BP]
 gi|304370244|gb|EFM23901.1| malonyl-CoA-[acyl-carrier-protein] transacylase [Selenomonas sp.
           oral taxon 149 str. 67H29BP]
          Length = 311

 Score =  197 bits (501), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 124/311 (39%), Positives = 171/311 (54%), Gaps = 4/311 (1%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
                FPGQG+QV+GMGRD YD++  A+  F E D  L  ++S L + G  ++L  T N 
Sbjct: 3   KLAFLFPGQGAQVVGMGRDFYDAYDLAKERFAEADEALGYSISKLCFEGPADQLQLTENT 62

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPA+  VS+   +++++ G+      +   GHSLGEY AL  A A S  D + LV  RG 
Sbjct: 63  QPAILTVSVIAAQLLQERGVS----PAIAGGHSLGEYAALVLAGALSFRDAVVLVHKRGA 118

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCA 181
            MQEAVP G G+M AIIGLDD  +   CA AS  G  +  N N  GQ VI+G +  V  A
Sbjct: 119 YMQEAVPVGEGAMAAIIGLDDATIIDACAAASAQGAVQAVNFNCPGQTVIAGAEKGVSAA 178

Query: 182 ADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSS 241
            +    KGAK+AV LPVSAPFHS+LM P +K +   L+ V   D   P++ N+      +
Sbjct: 179 VELLKEKGAKKAVILPVSAPFHSTLMAPAAKKLAAELNKVALHDAAFPVVSNYTGGLQQT 238

Query: 242 IDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISK 301
             EI   LV Q    VRW   +    + G  +  E G GK L G  KRIDK+L+++++  
Sbjct: 239 AAEIKENLVAQADHPVRWIACVATMRDFGADTYIECGPGKTLAGFNKRIDKTLTSMNVED 298

Query: 302 VEDIDLALRSI 312
              +   L ++
Sbjct: 299 EASLQKTLDTL 309


>gi|110680232|ref|YP_683239.1| malonyl CoA-acyl carrier protein transacylase [Roseobacter
           denitrificans OCh 114]
 gi|109456348|gb|ABG32553.1| malonyl CoA-acyl carrier protein transacylase [Roseobacter
           denitrificans OCh 114]
          Length = 310

 Score =  197 bits (501), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 145/311 (46%), Positives = 201/311 (64%), Gaps = 1/311 (0%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           MS    FPGQG+Q +GMGR L +++P+A+ VF+EVD  L + LS L+W G  E LT T N
Sbjct: 1   MSIAFVFPGQGAQTVGMGRALAEAYPDAQAVFDEVDDALGEKLSALIWEGDIETLTLTQN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
           AQPAL A SMA IR +   G+     +S+VAGHSLGEY+AL AA  FS++DT RL+R RG
Sbjct: 61  AQPALMATSMAAIRALAAEGVG-MERLSFVAGHSLGEYSALAAAGTFSIADTARLLRTRG 119

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
            +MQ AVP G G+M A++GLD      + A+A++  +C+IAN+N   Q V+SG + AV+ 
Sbjct: 120 LAMQRAVPVGEGAMAAVLGLDFDTATDVAARAAQGQVCQIANENDPAQNVVSGEKGAVER 179

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A       GAKRA+ LPVSAPFH +LM P +K M   L+ V    P VP++ N   + V 
Sbjct: 180 AIVLAKEAGAKRALMLPVSAPFHCALMAPAAKEMAQALEEVEMSAPQVPLVANVLGTAVE 239

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
               I  LL++QVTG+VRW+ +++W A  GV   +E+G+GK L+G+ +RI K   + +I 
Sbjct: 240 DPARIKELLIDQVTGQVRWKTSVEWMAAQGVTEFWEIGAGKALSGMIRRIAKDSVSRAIG 299

Query: 301 KVEDIDLALRS 311
             EDI  A+ +
Sbjct: 300 TPEDIKAAVNA 310


>gi|119384507|ref|YP_915563.1| malonyl CoA-acyl carrier protein transacylase [Paracoccus
           denitrificans PD1222]
 gi|119374274|gb|ABL69867.1| [Acyl-carrier-protein] S-malonyltransferase [Paracoccus
           denitrificans PD1222]
          Length = 308

 Score =  197 bits (501), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 163/308 (52%), Positives = 207/308 (67%), Gaps = 2/308 (0%)

Query: 4   VLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQP 63
              FPGQG+QV+GMGR+L +++P AR VF EVD  L ++LSDL+WNG  E LT T NAQP
Sbjct: 3   AFVFPGQGAQVVGMGRELAEAYPAAREVFAEVDEALGESLSDLIWNGDIETLTLTQNAQP 62

Query: 64  ALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSM 123
           AL A S+A  R +E  G  ++ D  +VAGHSLGEY+ALCAA A SL DT RL+R RG++M
Sbjct: 63  ALMATSIAAFRALEAEGFGIQ-DADFVAGHSLGEYSALCAAGALSLGDTARLLRLRGQAM 121

Query: 124 QEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAAD 183
           QEAVP G G+M AI+GLD   VD I   A+   +C+ ANDN   QVVISG + AV+ AA 
Sbjct: 122 QEAVPVGQGAMAAILGLDFAAVDQIARDAAEGEVCQAANDNDPAQVVISGHKAAVERAAA 181

Query: 184 TCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSID 243
               +GAKRA+ LPVSAPFHS+LM P + VM   L +V    P VP++ N  A PV+   
Sbjct: 182 LAKERGAKRALMLPVSAPFHSALMQPAAAVMAEALAAVEIAAPAVPLVANVRAEPVTEPG 241

Query: 244 EISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVE 303
            I RLLVEQVTG VRWRE++ + A  GV   +E+G+GK L+G+ KRI K     +I    
Sbjct: 242 AIRRLLVEQVTGAVRWRESVAFLAGAGVTEFWEIGAGKALSGMIKRIAKDAVVRNIGAPA 301

Query: 304 DIDLALRS 311
           DI  AL++
Sbjct: 302 DI-AALKA 308


>gi|328474612|gb|EGF45417.1| malonyl CoA-acyl carrier protein transacylase [Vibrio
           parahaemolyticus 10329]
          Length = 307

 Score =  197 bits (501), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 128/307 (41%), Positives = 179/307 (58%), Gaps = 3/307 (0%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
              + FPGQGSQ +GM  DL + +   +  F E    L  +L  L+ NG  E+L  T   
Sbjct: 3   KFAIVFPGQGSQAVGMLADLGEQYDVVKQTFAEASDALGYDLWALVQNGPAEDLNQTFRT 62

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPAL A S+A  RV ++ GL      + +AGHSLGEY+AL  A      + I+LV  RGK
Sbjct: 63  QPALLASSVAIWRVWQELGL---EQPANLAGHSLGEYSALVCAGVIDFKEAIKLVELRGK 119

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCA 181
            MQEAVP G G+M AIIGLDD  +   C +A++  +    N N  GQVVI+G +DAV+ A
Sbjct: 120 LMQEAVPAGTGAMYAIIGLDDDAIAKACEEAAQGDVVSPVNFNSPGQVVIAGSKDAVERA 179

Query: 182 ADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSS 241
              C   GAKRA+ LPVS P H +LM P +  +   L+S+    P +P++ N   +  + 
Sbjct: 180 GALCKEAGAKRALPLPVSVPSHCALMKPAADKLAVALESIEFNTPQLPVINNVDVAAETD 239

Query: 242 IDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISK 301
             +I   LV Q+   VRW E++Q  +  GV+++ E+G GKVLTGL KRI K+LSA +++ 
Sbjct: 240 PAKIKDALVRQLYSPVRWTESVQLMSEQGVENLLELGPGKVLTGLTKRIVKTLSAATVND 299

Query: 302 VEDIDLA 308
           V  ++ A
Sbjct: 300 VASLEAA 306


>gi|20807920|ref|NP_623091.1| acyl-carrier-protein S-malonyltransferase [Thermoanaerobacter
           tengcongensis MB4]
 gi|20516488|gb|AAM24695.1| (acyl-carrier-protein) S-malonyltransferase [Thermoanaerobacter
           tengcongensis MB4]
          Length = 309

 Score =  197 bits (501), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 126/312 (40%), Positives = 188/312 (60%), Gaps = 5/312 (1%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M     +PGQG+Q  GMG+++Y+ + EA+ +FE  D  L  N+S L + G +EEL  T N
Sbjct: 1   MKIAFIYPGQGAQYAGMGKEIYEKYEEAKEIFERADEALGFNISKLCFEGPEEELMKTEN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
            QPA+  VS+A  RV++K G+         AG SLGEY++L  A+A    D +RLV+ RG
Sbjct: 61  TQPAILTVSVALTRVLQKRGV----KPDVTAGLSLGEYSSLVLAEALDFEDAVRLVKKRG 116

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           K MQE VP G+G+M AI+GL +  V+ IC  AS VG+ E AN N  GQ+V+SG   AV+ 
Sbjct: 117 KYMQEVVPEGVGTMAAILGLPNEEVEEICRIASEVGVVEPANYNCPGQLVVSGEVKAVER 176

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A +    +GAK+AV L VSAPFH S++    +++   LD V  +D  VP++ N  A    
Sbjct: 177 AVELAKERGAKKAVVLAVSAPFHCSMLKEAGELLAKELDKVEIKDLKVPVISNVTAD-YV 235

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
             D++  LL++QV+  V W ++++     GV +  E+G GK L+G  K+ID+S + ++  
Sbjct: 236 QKDKVKELLIKQVSHPVLWEQSVRKMIEDGVDTFIEIGPGKTLSGFVKKIDRSRTVLNFE 295

Query: 301 KVEDIDLALRSI 312
             E +  AL ++
Sbjct: 296 DEESLMKALSAL 307


>gi|226313213|ref|YP_002773107.1| malonyl CoA-acyl carrier protein transacylase [Brevibacillus brevis
           NBRC 100599]
 gi|226096161|dbj|BAH44603.1| malonyl CoA-acyl carrier protein transacylase [Brevibacillus brevis
           NBRC 100599]
          Length = 316

 Score =  197 bits (501), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 124/311 (39%), Positives = 181/311 (58%), Gaps = 4/311 (1%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
                FPGQGSQ +GMG+ L +    AR +FE+ D  L  +LS L + G +EEL  T N 
Sbjct: 3   KVAFVFPGQGSQFVGMGQALSEQSEAARHIFEQADEALGFSLSGLCFAGPEEELKLTANT 62

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPA+   S+A +  + +         ++VAGHSLGEY+AL AA A S +D ++ VRARG+
Sbjct: 63  QPAILTASIAVMAALNE--KLPDYKPAFVAGHSLGEYSALVAAGALSFADAVKTVRARGQ 120

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQAS-RVGICEIANDNGGGQVVISGLQDAVKC 180
            M+EAVP G G+M A++ +D   + ++C + +      ++AN N  GQ+VISG  + VK 
Sbjct: 121 FMEEAVPAGQGAMAAVLNMDRAALHAVCEEVTASGHPVQLANMNCPGQIVISGSAEGVKL 180

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A +     GAKR + L VS PFHSSLM P +  ++ +L  VT Q+  VP++ N  A PVS
Sbjct: 181 AGEKAKEAGAKRVLPLNVSGPFHSSLMQPAADKLQAVLAGVTVQEAAVPVVANVTARPVS 240

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDK-SLSAVSI 299
               I   LV+QV+  V W +++QW    GV +  E+G GKVL GL K+I     + +S+
Sbjct: 241 EATIIVDQLVQQVSAPVLWEDSVQWMVEAGVTTFVEIGPGKVLAGLIKKIAPADTTIISV 300

Query: 300 SKVEDIDLALR 310
             ++ +   L 
Sbjct: 301 QDMDSLTELLN 311


>gi|295706314|ref|YP_003599389.1| malonyl CoA-acyl carrier protein transacylase [Bacillus megaterium
           DSM 319]
 gi|294803973|gb|ADF41039.1| malonyl CoA-acyl carrier protein transacylase [Bacillus megaterium
           DSM 319]
          Length = 314

 Score =  197 bits (501), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 123/314 (39%), Positives = 186/314 (59%), Gaps = 5/314 (1%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
                FPGQGSQ +GMG+DLYD   EA+ +    D  L  +LS++++ G QEELT T +A
Sbjct: 3   KIAFIFPGQGSQTVGMGKDLYDGTEEAKKLIHTADEALGFSLSNIIFEGPQEELTLTYHA 62

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPAL A S   +   + +G+       +VAGHSLGEY+AL AA+  S  D +  V  RG+
Sbjct: 63  QPALLATSTMLLEAFKTSGIT----PDFVAGHSLGEYSALVAAEVLSFEDAVVAVHKRGR 118

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQAS-RVGICEIANDNGGGQVVISGLQDAVKC 180
            M EAVP G G+M A++G+    ++++ AQ +      ++AN N  GQ+VISG  + V+ 
Sbjct: 119 YMDEAVPAGQGTMAAVLGMSAEDLEAVTAQITSEGDAVQLANINCPGQIVISGTVNGVEK 178

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A      KGAKR + L VS PFHSSLM P ++ ++  L++V   D  VP++ N  A PV+
Sbjct: 179 AGALAKEKGAKRVIPLVVSGPFHSSLMKPAAEKLRDTLETVGFSDAKVPVIANVTAKPVT 238

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
              +I   LVEQ+   VRW ET++     GV +  E+G GKVL+GL K++++  +  +++
Sbjct: 239 DSQDIQNKLVEQLYSPVRWEETVETLLAEGVDTFVEIGPGKVLSGLVKKVNRRAAVYAVN 298

Query: 301 KVEDIDLALRSIVG 314
            +  +   + ++ G
Sbjct: 299 DLTSLKSTIDALKG 312


>gi|146340287|ref|YP_001205335.1| malonyl CoA-acyl carrier protein transacylase [Bradyrhizobium sp.
           ORS278]
 gi|146193093|emb|CAL77104.1| Malonyl CoA-acyl carrier protein transacylase (MCT) [Bradyrhizobium
           sp. ORS278]
          Length = 319

 Score =  197 bits (500), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 156/306 (50%), Positives = 210/306 (68%), Gaps = 1/306 (0%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M+   TFPGQGSQ +GMG+ L D+FP AR VF+EVD  L + L+ ++W G  E L  T N
Sbjct: 1   MTAAFTFPGQGSQAVGMGKALADAFPAARAVFDEVDAALGEKLTTIIWEGPAETLQLTEN 60

Query: 61  AQPALTAVSMAFIRVME-KNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRAR 119
           AQPAL AVSMA +RV+E + G  V +D ++VAGHSLGEY+AL AA + +++DT RL+R R
Sbjct: 61  AQPALMAVSMATLRVLEAEAGFSVGQDAAFVAGHSLGEYSALAAAGSLTIADTARLLRTR 120

Query: 120 GKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVK 179
           G +MQ+AVP G+G+M A++G+D     ++  +A++  +C+ ANDNGGGQVV+SG + AV 
Sbjct: 121 GLAMQKAVPVGVGAMAALLGMDYEAAVAVAEEAAQGEVCQAANDNGGGQVVVSGNKAAVD 180

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            A +    KGAKRA+ LPVSAPFH  LM P + VM   L  VT + P  P++ N  A+P+
Sbjct: 181 RAVEIARAKGAKRAMLLPVSAPFHCQLMQPAADVMADALSKVTIKAPAAPVVSNVLAAPI 240

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
           +  DEI R LVEQVTG VRWRE+I + A  GV   +E+G+GKVL+GL KRI      V++
Sbjct: 241 TDPDEIRRRLVEQVTGTVRWRESIAYMAGQGVTRFFEIGAGKVLSGLVKRIADGAVGVAV 300

Query: 300 SKVEDI 305
               DI
Sbjct: 301 GGPADI 306


>gi|269962041|ref|ZP_06176395.1| acyl carrier protein S-malonyltransferase [Vibrio harveyi 1DA3]
 gi|269833125|gb|EEZ87230.1| acyl carrier protein S-malonyltransferase [Vibrio harveyi 1DA3]
          Length = 307

 Score =  197 bits (500), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 127/307 (41%), Positives = 179/307 (58%), Gaps = 3/307 (0%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
              + FPGQGSQ +GM  DL + +   +  F E    L  +L  L+ NG  E+L  T   
Sbjct: 3   KFAIVFPGQGSQAVGMLADLGEQYDVVKQTFAEASDALGYDLWALVQNGPAEDLNQTFRT 62

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPAL A S+A  RV ++ GL      + +AGHSLGEY+AL  A      + I+LV  RG+
Sbjct: 63  QPALLASSVAIWRVWQELGL---EQPANLAGHSLGEYSALVCAGVIDFKEAIKLVELRGQ 119

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCA 181
            MQEAVP G G+M AIIGLDD  +   C  A++  +    N N  GQVVI+G +DAV+ A
Sbjct: 120 LMQEAVPAGTGAMYAIIGLDDEAIAKACEDAAQGEVVSPVNFNSPGQVVIAGSKDAVERA 179

Query: 182 ADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSS 241
              C   GAKRA+ LPVS P H +LM P ++ +   L+S+    P +P++ N   +  + 
Sbjct: 180 GALCKEAGAKRALPLPVSVPSHCALMKPAAEKLAVALESIEFNTPQLPVVNNVDVAAETD 239

Query: 242 IDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISK 301
             +I   LV Q+   VRW E++Q  +  GV+++ E+G GKVLTGL KRI K+LSA +++ 
Sbjct: 240 PAKIKDALVRQLHSPVRWTESVQLMSEQGVENLLELGPGKVLTGLTKRIVKTLSAAAVND 299

Query: 302 VEDIDLA 308
           V  ++ A
Sbjct: 300 VASLEAA 306


>gi|327393486|dbj|BAK10908.1| malonyl CoA-acyl carrier protein transacylase FabD [Pantoea
           ananatis AJ13355]
          Length = 310

 Score =  197 bits (500), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 128/312 (41%), Positives = 175/312 (56%), Gaps = 4/312 (1%)

Query: 1   MS-TVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATC 59
           M+     FPGQGSQ +GM  DL  ++P     F E    L  +L  L+  G  EEL  T 
Sbjct: 1   MTQFAFVFPGQGSQTVGMLADLAAAYPAVEATFREASDVLGYDLWQLVSQGPAEELNKTW 60

Query: 60  NAQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRAR 119
             QPAL A S+A  RV ++ G       + +AGHSLGEY+AL  A   + +D I+LV  R
Sbjct: 61  QTQPALLAASVAIYRVWQQQGGQ---QPALMAGHSLGEYSALVCAGVLNFADAIKLVELR 117

Query: 120 GKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVK 179
           GK MQEAVP G G+M AIIGLDD  +   C ++++  +    N N  GQVVI+G ++AV+
Sbjct: 118 GKLMQEAVPEGTGAMQAIIGLDDAAIAKACEESAQGQVVSPVNFNSPGQVVIAGNKEAVE 177

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            A   C   GAKRA+ LPVS P H +LM P +  +   L+++T   P VP++ N      
Sbjct: 178 RAGAACKAAGAKRALPLPVSVPSHCALMKPAADKLALTLENITFNAPAVPVINNVDVKAE 237

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
           +  D I   L+ Q+   VRW E+++  A  GV  + E+G GKVLTGL KRI   LSA ++
Sbjct: 238 TDADAIRHALIRQLYSPVRWTESVEAMAAQGVTQLIEMGPGKVLTGLTKRIVDGLSAAAV 297

Query: 300 SKVEDIDLALRS 311
           +    +  AL  
Sbjct: 298 NDTASLTAALAQ 309


>gi|126739368|ref|ZP_01755061.1| malonyl CoA-acyl carrier protein transacylase [Roseobacter sp.
           SK209-2-6]
 gi|126719468|gb|EBA16177.1| malonyl CoA-acyl carrier protein transacylase [Roseobacter sp.
           SK209-2-6]
          Length = 319

 Score =  197 bits (500), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 152/312 (48%), Positives = 207/312 (66%), Gaps = 2/312 (0%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M+    FPGQG+Q IGMG+ L ++FP A+ VFEEVD  L + LSDL+W G  E LT T N
Sbjct: 9   MTIAFVFPGQGAQTIGMGKALAEAFPAAKSVFEEVDDALGEKLSDLIWEGEIETLTLTQN 68

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
           AQPAL A S+A ++ +E  G+ +     +VAGHSLGEY+AL AA A SL+DT RL+R RG
Sbjct: 69  AQPALMATSIAAMKALEAEGITI-EKAGFVAGHSLGEYSALAAAGAISLADTARLLRTRG 127

Query: 121 KSMQEAVPPGLGSMVAIIGLD-DCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVK 179
           ++MQ AVP G+G+M A++GLD   V +     A+   + + ANDN   QVV+SG + AV+
Sbjct: 128 QAMQSAVPVGVGAMAALLGLDFATVKEVAAEAAAEGEVVQAANDNDPTQVVVSGHKAAVE 187

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            AA+   ++GAKRAV LPVSAPFH +LM P + VM   L +V  Q P VP++ N  A  V
Sbjct: 188 RAAEIAKSRGAKRAVMLPVSAPFHCALMQPAADVMAEALTAVEIQAPKVPLIANVRADEV 247

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
           +    I  LLVEQVTG VRWRE++Q  A  GV   +E+G+GK L+G+ ++ID+SL++  +
Sbjct: 248 TDPALIRELLVEQVTGSVRWRESVQAMAAKGVTEFWEIGAGKALSGMIRKIDRSLASRQV 307

Query: 300 SKVEDIDLALRS 311
               D+  AL +
Sbjct: 308 GTDADVKAALEA 319


>gi|294500968|ref|YP_003564668.1| malonyl CoA-acyl carrier protein transacylase [Bacillus megaterium
           QM B1551]
 gi|294350905|gb|ADE71234.1| malonyl CoA-acyl carrier protein transacylase [Bacillus megaterium
           QM B1551]
          Length = 314

 Score =  197 bits (500), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 122/314 (38%), Positives = 185/314 (58%), Gaps = 5/314 (1%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
                FPGQGSQ +GMG+DLYD   EA+ +    D  L  +LS++++ G QEELT T +A
Sbjct: 3   KIAFIFPGQGSQTVGMGKDLYDGTEEAKKLIHTADEALGFSLSNIIFEGPQEELTLTYHA 62

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPAL   S   +   + +G+       +VAGHSLGEY+AL AA+  S  D +  V  RG+
Sbjct: 63  QPALLTTSTMLLEAFKTSGIT----PDFVAGHSLGEYSALVAAEVLSFKDAVVAVHKRGR 118

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQAS-RVGICEIANDNGGGQVVISGLQDAVKC 180
            M EAVP G G+M A++G+    ++++ AQ +      ++AN N  GQ+VISG  + V+ 
Sbjct: 119 YMDEAVPAGQGTMAAVLGMSAEDLEAVTAQITSEGDAVQLANINCPGQIVISGTVNGVEK 178

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A      KGAKR + L VS PFHSSLM P ++ ++  L++V   D  VP++ N  A PV+
Sbjct: 179 AGALAKEKGAKRVIPLVVSGPFHSSLMKPAAEKLRDTLETVGFSDAKVPVIANVTAKPVT 238

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
              +I   LVEQ+   VRW ET++     GV +  E+G GKVL+GL K++++  +  +++
Sbjct: 239 DSQDIQNKLVEQLYSPVRWEETVETLLAEGVDTFVEIGPGKVLSGLVKKVNRRATVYAVN 298

Query: 301 KVEDIDLALRSIVG 314
            +  +   + ++ G
Sbjct: 299 DLTSLKSTIDALKG 312


>gi|84503438|ref|ZP_01001498.1| acyl-carrier-protein S-malonyltransferase [Oceanicola batsensis
           HTCC2597]
 gi|84388225|gb|EAQ01177.1| acyl-carrier-protein S-malonyltransferase [Oceanicola batsensis
           HTCC2597]
          Length = 313

 Score =  197 bits (500), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 155/311 (49%), Positives = 207/311 (66%), Gaps = 1/311 (0%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           MS    FPGQG+Q IGMG+ L +++P AR VF+EVD  L + LS L+W G QE LT T N
Sbjct: 1   MSRAFVFPGQGAQTIGMGKALAEAYPAARAVFDEVDDALGEKLSSLIWEGDQETLTLTRN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
           AQPAL A S+A IR +E  G+ +  D ++VAGHSLGEY+AL AA + S++D  RL+R RG
Sbjct: 61  AQPALMATSLAAIRALEAEGVEIT-DAAFVAGHSLGEYSALAAAGSLSIADAARLLRTRG 119

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
            +MQEAVP G G+M A++GLD     ++  +A++  +C+ ANDN   QVV+SG + AV+ 
Sbjct: 120 AAMQEAVPVGEGAMAALLGLDFDTAQAVAEEAAQGDVCQAANDNDPSQVVVSGHRAAVER 179

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A D    KGAKRA+ LPVSAPFH +LM P + VM   LD V    P VP++ N  A  V 
Sbjct: 180 AVDIAKEKGAKRAMLLPVSAPFHCALMAPAADVMAQALDEVPIAAPAVPLVANVRAEAVD 239

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
               I  LLV+QVTG VRWRE++ W A  GV  V+E+G+GK L+G+ +RIDK+L+  ++ 
Sbjct: 240 DPATIRALLVDQVTGSVRWRESVLWMAGQGVSEVWEIGAGKALSGMIRRIDKTLACRAVG 299

Query: 301 KVEDIDLALRS 311
             ED+  A  S
Sbjct: 300 TPEDVAAAAES 310


>gi|322833650|ref|YP_004213677.1| malonyl CoA-acyl carrier protein transacylase [Rahnella sp. Y9602]
 gi|321168851|gb|ADW74550.1| malonyl CoA-acyl carrier protein transacylase [Rahnella sp. Y9602]
          Length = 309

 Score =  197 bits (500), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 125/310 (40%), Positives = 170/310 (54%), Gaps = 3/310 (0%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
              + FPGQGSQ +GM  DL  + P     F E    L  +L  L+  G  EEL  T   
Sbjct: 3   KIAVVFPGQGSQTLGMLADLAAAHPVVEETFAEASSALGYDLWQLVQQGPAEELNKTWQT 62

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPAL A S+A  RV ++           +AGHSLGEY+AL  A        I LV  RGK
Sbjct: 63  QPALLAASVAIWRVWQQQNGT---QPVLMAGHSLGEYSALVCAGVLDFKQAISLVELRGK 119

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCA 181
            MQEAVP G G+M AIIGLD+  +   C ++++  +    N N  GQVVI+G ++AV+ A
Sbjct: 120 LMQEAVPAGTGAMYAIIGLDNDAIAKACEESAQGQVVSPVNFNSPGQVVIAGNKEAVERA 179

Query: 182 ADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSS 241
              C   GAKRA+ LPVS P H +LM P ++ M   L++VT   P   ++ N      +S
Sbjct: 180 GAACKEAGAKRALPLPVSVPSHCALMKPAAEKMAIALENVTFNAPQYSVVNNVDVKVETS 239

Query: 242 IDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISK 301
            + I   LV Q+   VRW E++++ A  GV+ + EVG GKVLTGL KRI  +L+A +++ 
Sbjct: 240 PEAIRSALVRQLYSPVRWTESVEYIAAQGVEQLLEVGPGKVLTGLTKRIVDTLTAAAVND 299

Query: 302 VEDIDLALRS 311
              +  AL  
Sbjct: 300 TASLAAALEQ 309


>gi|253573482|ref|ZP_04850825.1| malonyl CoA-acyl carrier protein transacylase [Paenibacillus sp.
           oral taxon 786 str. D14]
 gi|251847010|gb|EES75015.1| malonyl CoA-acyl carrier protein transacylase [Paenibacillus sp.
           oral taxon 786 str. D14]
          Length = 312

 Score =  197 bits (500), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 130/312 (41%), Positives = 183/312 (58%), Gaps = 5/312 (1%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
            T   FPGQGSQ +GMG+D+YD+ PEAR  FE  D  L+  L+DL++ G   EL  T N 
Sbjct: 3   KTAFVFPGQGSQSVGMGKDIYDALPEARARFEAADEQLDFKLTDLIFGGPDTELKQTANT 62

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPAL   S+A        G        YVAGHSLGEY+AL AA   +  D ++LVRARG+
Sbjct: 63  QPALLTTSVALYEAFAAKGF----QPDYVAGHSLGEYSALTAAGVLNFEDAVKLVRARGE 118

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGI-CEIANDNGGGQVVISGLQDAVKC 180
            M++AVP G G+M A++G +   +  +CA  +  G   E+AN N  GQ+V+SG ++ V  
Sbjct: 119 YMEQAVPGGQGAMAAVLGGERDALAKLCADITAGGALVELANVNCPGQIVVSGSREGVDL 178

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
             +     GAKRA+ L VS PFHSSLM   ++ +   L + +  D  VP++ N  A PV 
Sbjct: 179 VIERVKEIGAKRAIPLEVSGPFHSSLMKTAAERLGERLAAASFSDAKVPVVANVTARPVQ 238

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
           S  EI+ LLV QV   V W +++ W  + GV +  E+G G VLTGL K+IDKS    ++S
Sbjct: 239 SGAEIAELLVRQVYSPVLWEDSVSWLLSQGVDTFVEIGPGSVLTGLIKKIDKSARLFNVS 298

Query: 301 KVEDIDLALRSI 312
            ++ ++    ++
Sbjct: 299 GLDSLEQTAAAL 310


>gi|329850893|ref|ZP_08265738.1| malonyl CoA-acyl carrier protein transacylase [Asticcacaulis
           biprosthecum C19]
 gi|328841208|gb|EGF90779.1| malonyl CoA-acyl carrier protein transacylase [Asticcacaulis
           biprosthecum C19]
          Length = 319

 Score =  197 bits (499), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 135/319 (42%), Positives = 185/319 (57%), Gaps = 6/319 (1%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M+T   FPGQGSQ +GMG +LYD+FP AR VF+EVD  L Q L  LM  G + +LT T N
Sbjct: 1   MTTAFVFPGQGSQNVGMGAELYDTFPRARAVFDEVDEALGQKLFQLMREGPESDLTLTEN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
           AQPA+ AVS+A  RV+E +         YVAGHSLGEY+A  AA  FSL+DT RL++ RG
Sbjct: 61  AQPAIMAVSIAVARVLEGDFGIACTRAKYVAGHSLGEYSAHAAAGTFSLTDTARLLKIRG 120

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           ++MQ AVP G+G+M A+IG  D  +     QA   G   +  ++     ++     A   
Sbjct: 121 QAMQAAVPVGIGAMAALIGKADLALAEAACQAGSAGGVVVVANDNNAGQIVISGVKAAVE 180

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
            A     +   +A+ L VSAPFH  LM P +  M   L  V    PV  ++ N  A PV+
Sbjct: 181 IAMEKAKELGAKAMLLNVSAPFHCPLMQPAADAMADALAKVNINAPVSTLVANVTARPVA 240

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANH------GVKSVYEVGSGKVLTGLAKRIDKSL 294
              +I+ LLV+QVTGRVRWRET++W          GV  + E+G+GKVLTG+ KR    +
Sbjct: 241 DKADIAGLLVQQVTGRVRWRETMEWLGAKESENGGGVTCIAELGAGKVLTGMIKRSLPDV 300

Query: 295 SAVSISKVEDIDLALRSIV 313
           +AV+++   D +   + + 
Sbjct: 301 TAVALNGAADFEAFAKDLA 319


>gi|271500131|ref|YP_003333156.1| malonyl CoA-acyl carrier protein transacylase [Dickeya dadantii
           Ech586]
 gi|270343686|gb|ACZ76451.1| malonyl CoA-acyl carrier protein transacylase [Dickeya dadantii
           Ech586]
          Length = 309

 Score =  197 bits (499), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 129/310 (41%), Positives = 173/310 (55%), Gaps = 3/310 (0%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
              + FPGQGSQ +GM  +L + FP  +  F+E    L  +L  L   G  EEL  T   
Sbjct: 3   KFAMVFPGQGSQSVGMLAELAEQFPLIKETFDEASSVLGYDLWQLSQQGPAEELNKTWQT 62

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPAL   S+A  RV ++ G       + +AGHSLGEY+AL  A        + LV  RGK
Sbjct: 63  QPALLTASVALWRVWQQQGG---PQPTLMAGHSLGEYSALVCAGVLDFKQAVSLVELRGK 119

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCA 181
            MQEAVP G G+M AIIGLD+  + + CA A++  +    N N  GQVVI+G ++AV+ A
Sbjct: 120 LMQEAVPEGTGAMYAIIGLDNDAIATACADAAQGQVVSPVNFNSPGQVVIAGNKEAVERA 179

Query: 182 ADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSS 241
              C   GAKRA+ LPVS P H +LM P +  +   L++VT   P VP++ N      S+
Sbjct: 180 GAACKAAGAKRALPLPVSVPSHCALMEPAAHKLAQALEAVTFNAPQVPVVNNVDVCAESA 239

Query: 242 IDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISK 301
              I   LV Q+   VRW E +++ A  GV ++ EVG GKVLTGL KRI  SL+A +I+ 
Sbjct: 240 PQAIRSALVRQLHNPVRWTECVEYIAAQGVSTLVEVGPGKVLTGLTKRIVDSLTATAIND 299

Query: 302 VEDIDLALRS 311
              +  AL  
Sbjct: 300 PASLSAALEQ 309


>gi|256750705|ref|ZP_05491590.1| malonyl CoA-acyl carrier protein transacylase [Thermoanaerobacter
           ethanolicus CCSD1]
 gi|256750288|gb|EEU63307.1| malonyl CoA-acyl carrier protein transacylase [Thermoanaerobacter
           ethanolicus CCSD1]
          Length = 309

 Score =  197 bits (499), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 125/314 (39%), Positives = 191/314 (60%), Gaps = 5/314 (1%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M     +PGQG+Q  GMG+++Y  + EAR +FE  D  L  ++S L + G +EEL  T N
Sbjct: 1   MKVAFIYPGQGAQYAGMGKEIYQKYQEAREIFERADEALGFSISKLCFEGPEEELMKTEN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
            QPA+  VS+A  +V++K G+         AG SLGEY++L  A+A    D +RLV+ RG
Sbjct: 61  TQPAILTVSVALTKVLQKRGI----KAEVTAGLSLGEYSSLVLAEALDFEDAVRLVKNRG 116

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           K MQE VP  +G+M AI+GL++  V+ IC  AS+VGI E AN N  GQ+VISG   AV+ 
Sbjct: 117 KYMQEVVPQEVGTMAAILGLENEAVEEICRIASQVGIVEPANYNCPGQLVISGEVKAVEK 176

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A +    KGAKRAV L VSAPFH S++    ++++  L+ +  ++  +P++ N  A+   
Sbjct: 177 AVELAKEKGAKRAVVLAVSAPFHCSMLKKAGELLEKDLEKIEIKELKIPVISNVTAN-YV 235

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
           + +E+  LL++QV+  V W ++++     GV +  E+G GK LTG  K+ID++ +A +  
Sbjct: 236 TREEVKDLLIKQVSHPVLWEQSVKRMIEDGVDTFVEIGPGKTLTGFVKKIDRTKAAYNFE 295

Query: 301 KVEDIDLALRSIVG 314
             E +   L ++ G
Sbjct: 296 DEESLLKTLSALEG 309


>gi|134295152|ref|YP_001118887.1| [Acyl-carrier-protein] S-malonyltransferase [Burkholderia
           vietnamiensis G4]
 gi|134138309|gb|ABO54052.1| [Acyl-carrier-protein] S-malonyltransferase [Burkholderia
           vietnamiensis G4]
          Length = 310

 Score =  197 bits (499), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 135/310 (43%), Positives = 173/310 (55%), Gaps = 4/310 (1%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M     FPGQGSQ +GM     D     R    E    L Q+L  L+  G  EEL  T N
Sbjct: 1   MKFAFVFPGQGSQSVGMLNAFAD-LAVVRETLAEASDALGQDLGKLIAEGPAEELNLTTN 59

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
            QP +   + A  R  ++ G       S VAGHSLGEYTAL AA A +  D + LVR R 
Sbjct: 60  TQPVMLTAAYACYRAWQQAGG---PAPSIVAGHSLGEYTALVAAGALAFKDAVPLVRFRA 116

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           ++MQ AVP G G M AI+GLDD  V ++CA+A++ G+ E  N N   QVVI+G + AV+ 
Sbjct: 117 QAMQTAVPVGQGGMAAILGLDDDTVRAVCAEAAQAGVVEAVNFNAPAQVVIAGAKAAVEK 176

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A +    KGAKRA+ LPVSAPFHSSL+ P S  ++  L ++  + P +P++ N   + VS
Sbjct: 177 ACEIAKAKGAKRALPLPVSAPFHSSLLKPASDQLRDYLANIDVKAPQIPVVNNIDVAVVS 236

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
               I   LV Q  G VRW E +Q  A  GV  V E G GKVL GL KRID +L   S+ 
Sbjct: 237 DPAAIKDALVRQAAGPVRWVECVQHIAATGVTHVIECGPGKVLAGLTKRIDGNLVGASVF 296

Query: 301 KVEDIDLALR 310
               +D AL+
Sbjct: 297 DPASLDEALK 306


>gi|323499358|ref|ZP_08104334.1| malonyl CoA-acyl carrier protein transacylase [Vibrio sinaloensis
           DSM 21326]
 gi|323315543|gb|EGA68578.1| malonyl CoA-acyl carrier protein transacylase [Vibrio sinaloensis
           DSM 21326]
          Length = 307

 Score =  197 bits (499), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 122/307 (39%), Positives = 175/307 (57%), Gaps = 3/307 (0%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
              + FPGQGSQ +GM  +L + +   +  F E    L  +L  L+ NG  E+L  T   
Sbjct: 3   KFAIVFPGQGSQAVGMLAELGEQYDVVKQTFAEASEALGYDLWALVQNGPAEDLNQTHRT 62

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPAL A S+A  RV ++ GL        +AGHSLGEY+AL  A      + I+LV+ RG+
Sbjct: 63  QPALLASSVAIWRVWQELGL---EQPVNLAGHSLGEYSALVCAGVIDFKEAIKLVQLRGQ 119

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCA 181
            MQEAVP G G+M AIIGLDD  +   C +A++  +    N N  GQVVI+G +DAV+ A
Sbjct: 120 LMQEAVPAGTGAMYAIIGLDDESIAKACEEAAQGEVVSPVNFNSPGQVVIAGSKDAVERA 179

Query: 182 ADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSS 241
              C   GAKRA+ LPVS P H +LM P +  +   L+++    P +P++ N   +  + 
Sbjct: 180 GALCKEAGAKRALPLPVSVPSHCALMKPAADKLAVALEALEFNAPQLPVINNVDVAAETD 239

Query: 242 IDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISK 301
             +I   LV Q+   VRW E++Q  +  GV+ + E+G GKVLTGL KRI K+LS  +++ 
Sbjct: 240 PAKIKDALVRQLYSPVRWTESVQLMSEQGVEKLLELGPGKVLTGLTKRIVKTLSGAAVND 299

Query: 302 VEDIDLA 308
              ++  
Sbjct: 300 AASLEAT 306


>gi|302389620|ref|YP_003825441.1| (Acyl-carrier-protein) S-malonyltransferase [Thermosediminibacter
           oceani DSM 16646]
 gi|302200248|gb|ADL07818.1| (Acyl-carrier-protein) S-malonyltransferase [Thermosediminibacter
           oceani DSM 16646]
          Length = 313

 Score =  197 bits (499), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 123/313 (39%), Positives = 180/313 (57%), Gaps = 4/313 (1%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
                F GQG+Q +GMG++L D+F  AR +F+  D  L   +S++ +NG +E L  T N 
Sbjct: 3   KVAFLFAGQGAQYVGMGKELIDNFETARKIFDMADEVLGYKISEICFNGPEERLKETANT 62

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPA+   S+A   ++++ G+      + VAG SLGEY+AL AA++    + + LVR RG 
Sbjct: 63  QPAILTHSVACYFLLKEEGIV----PNVVAGLSLGEYSALVAAESIDFEEAVPLVRKRGI 118

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCA 181
            MQEAVP G G+M A+IGL+   V  +C  AS  GI E AN N   Q+VISG   AV+ A
Sbjct: 119 YMQEAVPLGRGAMAAVIGLEKQEVLRVCELASEAGIVEAANFNCPDQIVISGEVRAVEKA 178

Query: 182 ADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSS 241
            +    KGA++AV L VSAPFH SL+ P  + +   L  V  +   +P++ N  A PVS 
Sbjct: 179 VEIAKGKGARKAVMLHVSAPFHCSLLKPAGEKLAVELGKVHIKSAKIPLISNVTADPVSD 238

Query: 242 IDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISK 301
              I  LLV+QV+  V W +++      GV +  E+G G+ L+G  K+ID+SL  +++  
Sbjct: 239 GATIKELLVKQVSSPVLWEDSVNKMKEMGVDTFVELGPGRALSGFVKKIDRSLVTLNVED 298

Query: 302 VEDIDLALRSIVG 314
           VE +   +    G
Sbjct: 299 VESLRKTIAFFRG 311


>gi|212639599|ref|YP_002316119.1| (acyl-carrier-protein) S-malonyltransferase [Anoxybacillus
           flavithermus WK1]
 gi|212561079|gb|ACJ34134.1| (acyl-carrier-protein) S-malonyltransferase [Anoxybacillus
           flavithermus WK1]
          Length = 314

 Score =  196 bits (498), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 123/314 (39%), Positives = 191/314 (60%), Gaps = 5/314 (1%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
                FPGQGSQ +GMG++  +   +   VF + D  L  +LS L++ G Q+ LT T NA
Sbjct: 4   KIAFIFPGQGSQTVGMGKEWAEKDEKVAAVFRQADERLQVSLSQLIFEGPQDVLTKTENA 63

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPAL   S+AF++ +++          YVAGHSLGEY+AL AA   S SD +  VR RG+
Sbjct: 64  QPALLTTSIAFLQKVKE----AHIAPHYVAGHSLGEYSALVAASVLSFSDAVYAVRKRGE 119

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVG-ICEIANDNGGGQVVISGLQDAVKC 180
            M++AVP G G+M A++G+D+ ++  +  +AS      ++AN N  GQ+VISG ++AV+ 
Sbjct: 120 LMEKAVPSGQGTMAAVLGMDEALLQQVVDEASTESSPVQLANLNCPGQIVISGAKEAVER 179

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A+     KGAKR + L VS PFHS LM P ++    +L++++ Q+  VP++ N  A P++
Sbjct: 180 ASQLAKEKGAKRVIPLEVSGPFHSILMKPAAEQFLSVLNTLSFQESTVPVISNVTAEPMT 239

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
           +  EI + LVEQ+   VRW +++Q   + GV +  E+G GKVL+GL K+I++ ++  SI 
Sbjct: 240 NPTEIKQRLVEQLYSPVRWEQSVQTMIDLGVDTFIEIGPGKVLSGLVKKINRHVNVYSIF 299

Query: 301 KVEDIDLALRSIVG 314
                   + ++ G
Sbjct: 300 DEASFMATVTALKG 313


>gi|167040361|ref|YP_001663346.1| malonyl CoA-acyl carrier protein transacylase [Thermoanaerobacter
           sp. X514]
 gi|300914445|ref|ZP_07131761.1| malonyl CoA-acyl carrier protein transacylase [Thermoanaerobacter
           sp. X561]
 gi|307724319|ref|YP_003904070.1| malonyl CoA-acyl carrier protein transacylase [Thermoanaerobacter
           sp. X513]
 gi|166854601|gb|ABY93010.1| malonyl CoA-acyl carrier protein transacylase [Thermoanaerobacter
           sp. X514]
 gi|300889380|gb|EFK84526.1| malonyl CoA-acyl carrier protein transacylase [Thermoanaerobacter
           sp. X561]
 gi|307581380|gb|ADN54779.1| malonyl CoA-acyl carrier protein transacylase [Thermoanaerobacter
           sp. X513]
          Length = 309

 Score =  196 bits (498), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 126/314 (40%), Positives = 192/314 (61%), Gaps = 5/314 (1%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M     +PGQG+Q  GMG+++Y  + EAR +FE  D  L  ++S L + G +EEL  T N
Sbjct: 1   MKVAFIYPGQGAQYAGMGKEIYQKYQEAREIFERADEALGFSISKLCFEGPEEELMKTEN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
            QPA+  VS+A  +V++K G+         AG SLGEY++L  A+A    D +RLV+ RG
Sbjct: 61  TQPAILTVSVALTKVLQKRGI----KAEVTAGLSLGEYSSLVLAEALDFEDAVRLVKNRG 116

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           K MQE VP G+G+M AI+GL++  V+ IC  AS+VGI E AN N  GQ+VISG   AV+ 
Sbjct: 117 KYMQEVVPQGVGTMAAILGLENEAVEEICRIASQVGIVEPANYNCPGQLVISGEVKAVEK 176

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A +    KGAKRAV L VSAPFH S++    ++++  L+ +  ++  +P++ N  A+   
Sbjct: 177 AVELAKEKGAKRAVVLAVSAPFHCSMLKKAGELLEKDLEKIEIKELKIPVISNVTAN-YV 235

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
           + +E+  LL++QV+  V W ++++     GV +  E+G GK LTG  K+ID++ +A +  
Sbjct: 236 TREEVKDLLIKQVSHPVLWEQSVKRMIEDGVDTFVEIGPGKTLTGFVKKIDRTKAAYNFE 295

Query: 301 KVEDIDLALRSIVG 314
             E +   L ++ G
Sbjct: 296 DEESLLKTLSALEG 309


>gi|312111711|ref|YP_003990027.1| malonyl CoA-acyl carrier protein transacylase [Geobacillus sp.
           Y4.1MC1]
 gi|311216812|gb|ADP75416.1| malonyl CoA-acyl carrier protein transacylase [Geobacillus sp.
           Y4.1MC1]
          Length = 313

 Score =  196 bits (498), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 121/314 (38%), Positives = 191/314 (60%), Gaps = 5/314 (1%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
                FPGQGSQ +GMG+D+  S      VF+  D  L  +LS L++ G QE LT T NA
Sbjct: 3   KIAFIFPGQGSQTVGMGKDVAQSDANIAAVFQSADERLGFSLSSLIFEGPQETLTLTYNA 62

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPAL   S+A ++ +++ G+       YVAGHSLGEYTAL AA A S +D +  VR RG+
Sbjct: 63  QPALLTTSVALLQKVKEAGITAD----YVAGHSLGEYTALVAAGAISFTDAVYAVRKRGE 118

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQA-SRVGICEIANDNGGGQVVISGLQDAVKC 180
            M++AVP G G+M A++G+D   ++++  +   +    ++AN N  GQ+VISG +  V+ 
Sbjct: 119 FMEKAVPAGEGTMAAVLGMDAAALEAVTNEISEQGDPVQLANLNCPGQIVISGSKAGVEK 178

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A +    +GAKR + L VS PFHS LM P +  ++ +L+++  +D  +P++ N  A PV 
Sbjct: 179 AGNLAKERGAKRVIPLEVSGPFHSLLMKPAASHLQEVLNTIAIRDAEIPVIANVTAQPVV 238

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
             +EI RLL+EQ+   VRW ++++     GV +  E+G GKVL+GL K+I +++   +++
Sbjct: 239 KKEEILRLLIEQLYSPVRWEQSVETMIRLGVDTFVEIGPGKVLSGLVKKISRNVRVYAVN 298

Query: 301 KVEDIDLALRSIVG 314
            +  +   + ++ G
Sbjct: 299 DLASLQATVAALKG 312


>gi|323702689|ref|ZP_08114350.1| malonyl CoA-acyl carrier protein transacylase [Desulfotomaculum
           nigrificans DSM 574]
 gi|323532352|gb|EGB22230.1| malonyl CoA-acyl carrier protein transacylase [Desulfotomaculum
           nigrificans DSM 574]
          Length = 314

 Score =  196 bits (498), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 131/310 (42%), Positives = 182/310 (58%), Gaps = 3/310 (0%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
                FPGQGSQ +GMG++LY +F   R   EE D  LN  L+ L + G  EEL  T N 
Sbjct: 3   KCAFIFPGQGSQYVGMGQELYKNFTVCRQTLEEADDALNFGLTKLCFEGPAEELNKTANT 62

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPA+ AVS+A +RV+ +           VAGHSLGEY+AL AA A   +D IR+VR RG+
Sbjct: 63  QPAILAVSIAALRVLTQECGL---RPEAVAGHSLGEYSALVAAGAIKFADAIRVVRQRGQ 119

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCA 181
            MQEA P G G M A++GLD   V + C +A+  G+ E  N N  GQVVI+G + A++ A
Sbjct: 120 FMQEAAPIGSGGMAAVLGLDRAKVIACCQEAAASGVIEPVNFNCPGQVVIAGQKGALQRA 179

Query: 182 ADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSS 241
            + C   GAKR + L VS PFHSSLM P  + +  +L  V  +DP  P++ N  A  V++
Sbjct: 180 MELCRQAGAKRVIELAVSGPFHSSLMRPAGERLAQVLAEVEIKDPQTPVMANVSARYVTN 239

Query: 242 IDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISK 301
             EI   L +QV G V W ++I   A  G+ ++ E+G GKVL GL K+I+K ++  ++  
Sbjct: 240 AGEIRDSLAKQVYGAVLWEDSIAKLAQDGIDTMVEIGPGKVLCGLVKKINKDIATHNVED 299

Query: 302 VEDIDLALRS 311
           +  ++  L  
Sbjct: 300 LASLEKVLAQ 309


>gi|269967352|ref|ZP_06181413.1| acyl carrier protein S-malonyltransferase [Vibrio alginolyticus
           40B]
 gi|269828060|gb|EEZ82333.1| acyl carrier protein S-malonyltransferase [Vibrio alginolyticus
           40B]
          Length = 307

 Score =  196 bits (497), Expect = 4e-48,   Method: Composition-based stats.
 Identities = 124/307 (40%), Positives = 176/307 (57%), Gaps = 3/307 (0%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
              + FPGQGSQ +GM  +L + +   +  F E    L  +L  L+ NG  E+L  T   
Sbjct: 3   KFAIVFPGQGSQAVGMLAELGEQYDVVKQTFAEASDALGYDLWALVQNGPAEDLNETFRT 62

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPAL A S+A  RV ++ GL      + +AGHSLGEY+AL  A      + I+LV  RG+
Sbjct: 63  QPALLASSVAIWRVWQELGL---EQPANLAGHSLGEYSALVCAGVIDFKEAIKLVELRGQ 119

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCA 181
            MQEAVP G G+M AIIGL D  +   C  A++  +    N N  GQVVI+G +DAV+ A
Sbjct: 120 LMQEAVPAGTGAMYAIIGLADDAIAKACEDAAQGEVVSPVNFNSPGQVVIAGSKDAVERA 179

Query: 182 ADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSS 241
              C   GAKRA+ LPVS P H +LM P ++ +   L+S+    P +P++ N      + 
Sbjct: 180 GALCKEAGAKRALPLPVSVPSHCALMKPAAEKLAVALESIEFNSPQLPVINNVDVVAETD 239

Query: 242 IDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISK 301
             +I   LV Q+   VRW ET++     GV+++ E+G GKVLTGL KRI K+L+A +++ 
Sbjct: 240 PAKIKDALVRQLHSPVRWTETVELMHEQGVENLLELGPGKVLTGLTKRIVKTLTAAAVND 299

Query: 302 VEDIDLA 308
           +  +D A
Sbjct: 300 IASLDAA 306


>gi|167037700|ref|YP_001665278.1| malonyl CoA-acyl carrier protein transacylase [Thermoanaerobacter
           pseudethanolicus ATCC 33223]
 gi|320116115|ref|YP_004186274.1| malonyl CoA-acyl carrier protein transacylase [Thermoanaerobacter
           brockii subsp. finnii Ako-1]
 gi|166856534|gb|ABY94942.1| malonyl CoA-acyl carrier protein transacylase [Thermoanaerobacter
           pseudethanolicus ATCC 33223]
 gi|319929206|gb|ADV79891.1| malonyl CoA-acyl carrier protein transacylase [Thermoanaerobacter
           brockii subsp. finnii Ako-1]
          Length = 309

 Score =  196 bits (497), Expect = 4e-48,   Method: Composition-based stats.
 Identities = 128/312 (41%), Positives = 192/312 (61%), Gaps = 5/312 (1%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M     +PGQG+Q  GMG+++Y  + EAR +FE  D  L  ++S+L + G +EEL  T N
Sbjct: 1   MKVAFIYPGQGAQYAGMGKEIYQKYQEAREIFERADEALGFSISELCFEGPEEELMKTEN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
            QPA+  VS+A  +V++K G+         AG SLGEY++L  A+A    D +RLV+ RG
Sbjct: 61  TQPAILTVSVALTKVLQKRGI----KAEVTAGLSLGEYSSLVLAEALDFEDAVRLVKNRG 116

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           K MQE VP G+G+M AI+GL++ VV+ IC   S+VGI E AN N  GQ+VISG   AV+ 
Sbjct: 117 KYMQEVVPQGVGTMAAILGLENEVVEEICRTVSQVGIVEPANYNCPGQLVISGEVKAVEK 176

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A +    KGAKRAV L VSAPFH S++    ++++  L+ +  +D  +P++ N  A   +
Sbjct: 177 AVELAKEKGAKRAVVLAVSAPFHCSMLKKAGELLERDLEKIEIKDLKIPVVSNVTAD-YA 235

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
           S D++  LL++QV+  V W ++++     GV +  E+G GK LTG  K+IDK+ +A +  
Sbjct: 236 SKDQVKDLLIKQVSHPVLWEQSVKRMIEDGVDTFVEIGPGKTLTGFVKKIDKTKNAYNFE 295

Query: 301 KVEDIDLALRSI 312
             E +   L ++
Sbjct: 296 DEESLLKTLSAL 307


>gi|167837361|ref|ZP_02464244.1| malonyl CoA-acyl carrier protein transacylase [Burkholderia
           thailandensis MSMB43]
          Length = 310

 Score =  196 bits (497), Expect = 4e-48,   Method: Composition-based stats.
 Identities = 132/313 (42%), Positives = 174/313 (55%), Gaps = 4/313 (1%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M     FPGQGSQ +GM     D     R   +E    L Q++  L+ +G  +EL  T N
Sbjct: 1   MKFAFVFPGQGSQSVGMLNAFAD-VAVVRETLDEASDALGQDIGKLIADGPADELNLTTN 59

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
            QP +   + A  R  ++ G       S VAGHSLGEYTAL AA A +  D + LVR R 
Sbjct: 60  TQPVMLTAAYACYRAWKQAGGA---QPSIVAGHSLGEYTALVAAGAIAFRDALPLVRFRA 116

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           ++MQ AVP G+G M AI+GLDD  V ++CA+AS  G+ E  N N   QVVI+G +  ++ 
Sbjct: 117 QAMQTAVPVGVGGMAAILGLDDDTVRAVCAEASASGVVEAVNFNAPAQVVIAGTKAGIEK 176

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A +    KGAKRA+ LPVSAPFHSSL+ P S  ++  L +V  + P +P++ N   + VS
Sbjct: 177 ACEIAKAKGAKRALPLPVSAPFHSSLLEPASDKLREYLANVDVKAPRIPVVNNIDVAVVS 236

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
               I   LV Q  G VRW E ++  A  GV  V E G GKVL GL KRID +L   S+ 
Sbjct: 237 DPAAIKDALVRQAAGPVRWVECVRHIAREGVTHVIECGPGKVLAGLTKRIDSNLVGASVF 296

Query: 301 KVEDIDLALRSIV 313
               +D AL+   
Sbjct: 297 DPASLDEALKLAA 309


>gi|307264832|ref|ZP_07546394.1| malonyl CoA-acyl carrier protein transacylase [Thermoanaerobacter
           wiegelii Rt8.B1]
 gi|306920090|gb|EFN50302.1| malonyl CoA-acyl carrier protein transacylase [Thermoanaerobacter
           wiegelii Rt8.B1]
          Length = 309

 Score =  196 bits (497), Expect = 4e-48,   Method: Composition-based stats.
 Identities = 128/312 (41%), Positives = 193/312 (61%), Gaps = 5/312 (1%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M     +PGQG+Q  GMG+++Y  + EAR +FE  D  L  ++S+L + G +EEL  T N
Sbjct: 1   MKVAFIYPGQGAQYAGMGKEIYQKYQEAREIFERADEALGFSISELCFEGPEEELMKTEN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
            QPA+  VS+A  +V++K G+    +    AG SLGEY++L  A+A    D +RLV+ RG
Sbjct: 61  TQPAILTVSVALTKVLQKRGI----NAEVTAGLSLGEYSSLVLAEALDFEDAVRLVKNRG 116

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           K MQE VP G+G+M AI+GL++ VV+ IC   S+VGI E AN N  GQ+VISG   AV+ 
Sbjct: 117 KYMQEVVPQGVGTMAAILGLENEVVEEICRTVSQVGIVEPANYNCPGQLVISGEVKAVEK 176

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A +    KGAKRAV L VSAPFH S++    ++++  L+ +  +D  +P++ N  A   +
Sbjct: 177 AVELAKEKGAKRAVVLAVSAPFHCSMLKKAGELLERDLEKIEIKDLKIPVVSNVTAD-YA 235

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
           S D++  LL++QV+  V W ++++     GV +  E+G GK LTG  K+IDK+ +A +  
Sbjct: 236 SKDQVKDLLIKQVSHPVLWEQSVKRMIEDGVDTFVEIGPGKTLTGFVKKIDKTKNAYNFE 295

Query: 301 KVEDIDLALRSI 312
             E +   L ++
Sbjct: 296 DEESLLKTLSAL 307


>gi|52080193|ref|YP_078984.1| malonyl CoA-acyl carrier protein transacylase [Bacillus
           licheniformis ATCC 14580]
 gi|52785570|ref|YP_091399.1| acyl-carrier-protein S-malonyltransferase [Bacillus licheniformis
           ATCC 14580]
 gi|319646028|ref|ZP_08000258.1| FabD protein [Bacillus sp. BT1B_CT2]
 gi|52003404|gb|AAU23346.1| malonyl CoA-acyl carrier protein transacylase [Bacillus
           licheniformis ATCC 14580]
 gi|52348072|gb|AAU40706.1| FabD [Bacillus licheniformis ATCC 14580]
 gi|317391778|gb|EFV72575.1| FabD protein [Bacillus sp. BT1B_CT2]
          Length = 319

 Score =  196 bits (497), Expect = 4e-48,   Method: Composition-based stats.
 Identities = 130/313 (41%), Positives = 190/313 (60%), Gaps = 5/313 (1%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
                FPGQGSQ IGMG +LY+  P A+ +FEE D TL   LS LM+ G  +ELT T NA
Sbjct: 3   KIAFLFPGQGSQHIGMGHELYEKEPNAKKIFEEADQTLETKLSTLMFEGDAKELTLTYNA 62

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QP+L   S+A +  +++ G+       Y AGHSLGEY+AL AA A S  D +  VR RG+
Sbjct: 63  QPSLLTASIAALEKLKEYGI----KADYAAGHSLGEYSALVAAGALSFKDAVYAVRKRGE 118

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQA-SRVGICEIANDNGGGQVVISGLQDAVKC 180
            M EAVP G G+M AI+G+D   +  +  +      + ++AN N  GQ+VISG    V+ 
Sbjct: 119 FMNEAVPAGEGAMAAILGMDSQALKEVTDKISEEGNLVQLANLNCPGQIVISGTAKGVEL 178

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A++    KGAKRA+ L VS PFHS LM P +  ++ +LD+ T  D  +P++ N  A  V+
Sbjct: 179 ASELAKEKGAKRAIPLEVSGPFHSELMKPAADKLREVLDACTINDAAIPVVSNVTADFVT 238

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
             D+I   L+EQ+   VR+ ETI    + GV +  E+G GKVL+GL K++++ +  +++S
Sbjct: 239 DKDDIKNKLIEQLYSPVRFEETISRLIDEGVTTFIEIGPGKVLSGLVKKVNRRVKTIAVS 298

Query: 301 KVEDIDLALRSIV 313
               I+LA++++ 
Sbjct: 299 DPNTIELAVQTLK 311


>gi|326389514|ref|ZP_08211081.1| malonyl CoA-acyl carrier protein transacylase [Thermoanaerobacter
           ethanolicus JW 200]
 gi|325994519|gb|EGD52944.1| malonyl CoA-acyl carrier protein transacylase [Thermoanaerobacter
           ethanolicus JW 200]
          Length = 309

 Score =  196 bits (497), Expect = 4e-48,   Method: Composition-based stats.
 Identities = 127/312 (40%), Positives = 192/312 (61%), Gaps = 5/312 (1%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M     +PGQG+Q  GMG+++Y  + EAR +FE  D  L  ++S+L + G +EEL  T N
Sbjct: 1   MKVAFIYPGQGAQYAGMGKEIYQKYQEAREIFERADEALGFSISELCFEGPEEELMKTEN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
            QPA+  VS+A  +V++K G+    +    AG SLGEY++L  A+A    D +RLV+ RG
Sbjct: 61  TQPAILTVSVALTKVLQKRGI----NAEVTAGLSLGEYSSLVLAEALDFEDAVRLVKNRG 116

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           K MQE VP G+G+M AI+GL++ VV+ IC   S+VG  E AN N  GQ+VISG   AV+ 
Sbjct: 117 KYMQEVVPQGVGTMAAILGLENEVVEEICRTVSQVGKVEPANYNCPGQLVISGEVKAVEK 176

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A +    KGAKRAV L VSAPFH S++    ++++  L+ +  +D  +P++ N  A   +
Sbjct: 177 AVELAKEKGAKRAVVLAVSAPFHCSMLKKAGELLERDLEKIEIKDLKIPVVSNVTAD-YA 235

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
           S D++  LL++QV+  V W ++++     GV +  E+G GK LTG  K+IDK+ +A +  
Sbjct: 236 SKDQVKDLLIKQVSHPVLWEQSVKRMIEDGVDTFVEIGPGKTLTGFVKKIDKTKNAYNFE 295

Query: 301 KVEDIDLALRSI 312
             E +   L ++
Sbjct: 296 DEESLLKTLSAL 307


>gi|295399777|ref|ZP_06809758.1| malonyl CoA-acyl carrier protein transacylase [Geobacillus
           thermoglucosidasius C56-YS93]
 gi|294978180|gb|EFG53777.1| malonyl CoA-acyl carrier protein transacylase [Geobacillus
           thermoglucosidasius C56-YS93]
          Length = 313

 Score =  196 bits (497), Expect = 4e-48,   Method: Composition-based stats.
 Identities = 121/314 (38%), Positives = 191/314 (60%), Gaps = 5/314 (1%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
                FPGQGSQ +GMG+D+  S      VF+  D  L  +LS L++ G QE LT T NA
Sbjct: 3   KIAFIFPGQGSQTVGMGKDVAQSDANIAAVFQSADERLGFSLSSLIFEGPQETLTLTYNA 62

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPAL   S+A ++ +++ G+       YVAGHSLGEYTAL AA A S +D +  VR RG+
Sbjct: 63  QPALLTTSVALLQKVKEAGITAD----YVAGHSLGEYTALVAAGAISFTDAVYAVRKRGE 118

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQA-SRVGICEIANDNGGGQVVISGLQDAVKC 180
            M++AVP G G+M A++G+D   ++++  +   +    ++AN N  GQ+VISG +  V+ 
Sbjct: 119 FMEKAVPAGEGTMAAVLGMDAAALEAVTNEISEQGDPVQLANLNCPGQIVISGSKAGVEK 178

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A +    +GAKR + L VS PFHS LM P +  ++ +L+++  +D  +P++ N  A PV 
Sbjct: 179 AGNLAKERGAKRVIPLEVSGPFHSLLMKPAASHLQDVLNTIAIRDAEIPVIANVTAQPVV 238

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
             +EI RLL+EQ+   VRW ++++     GV +  E+G GKVL+GL K+I +++   +++
Sbjct: 239 KKEEILRLLIEQLYSPVRWEQSVETMIRLGVDTFVEIGPGKVLSGLVKKISRNVRVYAVN 298

Query: 301 KVEDIDLALRSIVG 314
            +  +   + ++ G
Sbjct: 299 DLASLQATVAALKG 312


>gi|90579085|ref|ZP_01234895.1| acyl carrier protein S-malonyltransferase [Vibrio angustum S14]
 gi|90439918|gb|EAS65099.1| acyl carrier protein S-malonyltransferase [Vibrio angustum S14]
          Length = 309

 Score =  196 bits (497), Expect = 4e-48,   Method: Composition-based stats.
 Identities = 120/309 (38%), Positives = 178/309 (57%), Gaps = 3/309 (0%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
              + FPGQGSQ +GM  +L + F   +  F E    L  +L  L+ NG  E+L  T   
Sbjct: 3   KFAIVFPGQGSQTVGMLAELAEQFDVVKETFSEASDALGYDLWALVQNGPAEDLNQTQRT 62

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPAL   S+A  RV ++ G       + +AGHSLGEY+AL  A        ++LV  RG+
Sbjct: 63  QPALLTASVAIWRVWQQQGG---EQPTLLAGHSLGEYSALVCAGVIDFKAAVKLVELRGQ 119

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCA 181
            MQEAVP G+G+M AIIGLD+  +   C +A++  +C   N N  GQVVI+G ++AV+ A
Sbjct: 120 LMQEAVPAGVGAMSAIIGLDNDAIAKACEEAAQGEVCSPVNFNSPGQVVIAGNKEAVERA 179

Query: 182 ADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSS 241
              C   GAKRA+ LPVS P H +LM P +  +   L+++    P VP++ N   +  + 
Sbjct: 180 NVLCKEAGAKRALPLPVSVPSHCALMKPAADKLAVALEAIEFNAPSVPVINNADVATETD 239

Query: 242 IDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISK 301
              I   LV+Q+   VRW E+++  A  G++ + E+G GKVLTGL KRID++LS  +++ 
Sbjct: 240 PAAIKLALVKQLYSPVRWTESVERMAAEGIEELLEMGPGKVLTGLTKRIDRALSGAAVND 299

Query: 302 VEDIDLALR 310
           +  ++ A+ 
Sbjct: 300 IASLEAAMA 308


>gi|28209900|ref|NP_780844.1| acyl-carrier-protein S-malonyltransferase [Clostridium tetani E88]
 gi|28202335|gb|AAO34781.1| malonyl coA-acyl carrier protein transacylase [Clostridium tetani
           E88]
          Length = 312

 Score =  196 bits (497), Expect = 4e-48,   Method: Composition-based stats.
 Identities = 117/311 (37%), Positives = 178/311 (57%), Gaps = 5/311 (1%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
                FPGQGSQ +GMG++LYD+F E R +F   +  L+ N++DL + G  E+L  T   
Sbjct: 4   KIAFLFPGQGSQYVGMGKELYDNFKECRDIFNRAEELLDFNVTDLCFKGPDEKLNKTEFT 63

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPA+  VS+A  ++++K G+         AG SLGEY+AL  +   S  D ++LVR RGK
Sbjct: 64  QPAILTVSIAISKLIKKRGI----KAEIAAGLSLGEYSALIYSGMLSFEDGVKLVRKRGK 119

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCA 181
            M+EAVP G G M AIIGL +  +  +C + S +GI E AN N  GQ+VISG  +A++ A
Sbjct: 120 FMEEAVPKGTGGMAAIIGLKEEEIYKVCHEVSHIGIVEPANFNCPGQIVISGEINALRIA 179

Query: 182 ADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSS 241
            + C  KGA +   L VS PFHSSL+   +  ++  L+++  Q   +P++ N  A  +  
Sbjct: 180 CEMCQEKGALKVAMLKVSGPFHSSLLKKAADNLEKELNNIQFQKGNIPVITNVTADFMEL 239

Query: 242 IDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISK 301
                 L  + V   V+W ++++     GV +  E+G GK LT   K+ID+ +SA +I  
Sbjct: 240 DKIKDTLKSQ-VMHSVKWEQSMREMIKDGVNTFIEIGPGKTLTTFLKKIDRKISAYNIED 298

Query: 302 VEDIDLALRSI 312
           ++ +D  L  +
Sbjct: 299 IKSLDKTLNKL 309


>gi|325300076|ref|YP_004259993.1| malonyl CoA-acyl carrier protein transacylase [Bacteroides
           salanitronis DSM 18170]
 gi|324319629|gb|ADY37520.1| malonyl CoA-acyl carrier protein transacylase [Bacteroides
           salanitronis DSM 18170]
          Length = 294

 Score =  196 bits (497), Expect = 4e-48,   Method: Composition-based stats.
 Identities = 102/300 (34%), Positives = 147/300 (49%), Gaps = 7/300 (2%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M     FPGQG+Q +GMG+DLY++ P A+ +FE+ +  L   ++D+M+NG+ E+L  T  
Sbjct: 1   MK-AFVFPGQGAQFVGMGKDLYETSPLAKELFEKANEILGYRITDIMFNGTDEDLRQTKV 59

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVR-AR 119
            QPA+   S+     +       +      AGHSLGE++AL AA A S  D ++LV    
Sbjct: 60  TQPAVFLHSVISALCL-----GDEFKPEMTAGHSLGEFSALVAAGALSFEDGLKLVYARA 114

Query: 120 GKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVK 179
               +            I   D+ V +     +    +C  AN N  GQ+VISG  + + 
Sbjct: 115 MAMQKACEMQPSTMAAIIALPDEKVEEICAQVSQEGEVCVAANFNCPGQIVISGSIEGIN 174

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            A +     GAKRA+ L V   FHS LM P    ++  +++     P  PI  N  A P 
Sbjct: 175 KACELMKAAGAKRALPLKVGGAFHSPLMNPAKVELEAAINATEFHAPKCPIYQNVDARPH 234

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
           +   EI   LV Q+T  VRW +T+Q     G     E G G VL GL K+I+K  +A  I
Sbjct: 235 TDPAEIKANLVAQLTASVRWTQTVQNMIADGATEFVECGPGAVLQGLIKKINKEANAHGI 294


>gi|86749586|ref|YP_486082.1| malonyl CoA-acyl carrier protein transacylase [Rhodopseudomonas
           palustris HaA2]
 gi|86572614|gb|ABD07171.1| [Acyl-carrier-protein] S-malonyltransferase [Rhodopseudomonas
           palustris HaA2]
          Length = 319

 Score =  196 bits (497), Expect = 4e-48,   Method: Composition-based stats.
 Identities = 159/313 (50%), Positives = 218/313 (69%), Gaps = 1/313 (0%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M+   TFPGQGSQ +GMG+ L D+FP A+ VF+EVD  L + L+  +W G  E L  T N
Sbjct: 1   MTAAFTFPGQGSQAVGMGKALADAFPAAKAVFDEVDAALGEKLTATIWEGPAETLQLTEN 60

Query: 61  AQPALTAVSMAFIRVMEKN-GLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRAR 119
           AQPAL AVS+A +RV+E   G+ V RD ++VAGHSLGEY+AL AA A ++SDT RL+R R
Sbjct: 61  AQPALMAVSLAALRVLESEAGISVGRDAAFVAGHSLGEYSALAAAGALTVSDTARLLRIR 120

Query: 120 GKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVK 179
           G++MQ+AVP G+G+M A++GLD     ++ ++A++  +C+ ANDNGGGQVV+SG ++AV+
Sbjct: 121 GRAMQKAVPVGVGAMAALLGLDYEAAVAVASEAAQGQVCQAANDNGGGQVVVSGHKEAVE 180

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            A +    KGAKRA+ LPVSAPFH +LM P ++ M   L  V  Q P VP++ N  A+P+
Sbjct: 181 RAVEIAKGKGAKRAMLLPVSAPFHCALMQPAAEAMAEALAGVAIQSPAVPLVCNVLAAPI 240

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
           +  DEI R L+EQVTG VRWRE++ + A HGV    E+G+GKVL+GL KRI    + V+I
Sbjct: 241 TDPDEIRRRLIEQVTGTVRWRESVAYMAGHGVSRFLEIGAGKVLSGLVKRIADGATGVAI 300

Query: 300 SKVEDIDLALRSI 312
               DI  A  ++
Sbjct: 301 GNPNDIAAAKDAL 313


>gi|229162788|ref|ZP_04290745.1| Malonyl CoA-acyl carrier protein transacylase [Bacillus cereus
           R309803]
 gi|228620670|gb|EEK77539.1| Malonyl CoA-acyl carrier protein transacylase [Bacillus cereus
           R309803]
          Length = 314

 Score =  195 bits (496), Expect = 5e-48,   Method: Composition-based stats.
 Identities = 125/314 (39%), Positives = 185/314 (58%), Gaps = 5/314 (1%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
                FPGQGSQ +GMGR L D+  E   VFE+ D  L  +LS++++ G QE+LT T NA
Sbjct: 3   KLAFLFPGQGSQAVGMGRQLADNNKEVAKVFEKADEVLQDSLSEVIFEGPQEKLTLTTNA 62

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPAL   S A +  +++ G+       +VAGHSLGEY+AL AA A +  D +  VR RG+
Sbjct: 63  QPALLTTSYAILTALKEYGIT----PDFVAGHSLGEYSALVAAGALTFEDAVYAVRKRGE 118

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQAS-RVGICEIANDNGGGQVVISGLQDAVKC 180
            M+EAVP G G+M AI+G D  ++  +  + +      +IAN N   Q+VISG +  V+ 
Sbjct: 119 YMEEAVPGGEGAMAAILGADPHMLKQVTEEVTSEGYAVQIANMNSTKQIVISGTKQGVEI 178

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A+      GAKRA+ L VS PFHSSLM P ++  + +L+ +T +D  +P++ N  A  ++
Sbjct: 179 ASQRAKENGAKRAIPLKVSGPFHSSLMKPAAEKFQSVLNEITIRDTNIPVIANVTADVIT 238

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
              +I   L+EQ+   V W  ++++  N GV +  E+G GKVL GL K ID S+ A +I 
Sbjct: 239 RGADIQEKLIEQLYSPVLWYPSVEYMVNQGVDTFIEIGPGKVLAGLMKSIDSSVKAYAIY 298

Query: 301 KVEDIDLALRSIVG 314
             E +   + ++ G
Sbjct: 299 DEETLKDTISNLRG 312


>gi|192291856|ref|YP_001992461.1| malonyl CoA-acyl carrier protein transacylase [Rhodopseudomonas
           palustris TIE-1]
 gi|192285605|gb|ACF01986.1| malonyl CoA-acyl carrier protein transacylase [Rhodopseudomonas
           palustris TIE-1]
          Length = 319

 Score =  195 bits (496), Expect = 5e-48,   Method: Composition-based stats.
 Identities = 160/314 (50%), Positives = 219/314 (69%), Gaps = 1/314 (0%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M+   TFPGQGSQ +GMG+ L ++FP AR VF+EVD  L + L+ ++W G  E L  T N
Sbjct: 1   MTAAFTFPGQGSQAVGMGKALAEAFPAARAVFDEVDAALGEKLTSIIWEGPAETLQLTEN 60

Query: 61  AQPALTAVSMAFIRVME-KNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRAR 119
           AQPAL AVS+A +RV+E + G+ V +D ++VAGHSLGEY+AL AA + S+SDT RL+R R
Sbjct: 61  AQPALMAVSLATMRVLETEAGVSVGKDAAFVAGHSLGEYSALAAAGSLSVSDTARLLRIR 120

Query: 120 GKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVK 179
           G++MQ+AVP G+G+M A++GLD     ++ A+A++  +C+ ANDNGGGQVV+SG +DAV+
Sbjct: 121 GQAMQKAVPVGVGAMAALLGLDYDTAVAVAAEAAQGQVCQAANDNGGGQVVVSGHKDAVE 180

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            A +    KGAKRA+ LPVSAPFH SLM P ++ M   L  VT + P  P++ N  ASP+
Sbjct: 181 RAVEIAKGKGAKRAMLLPVSAPFHCSLMQPAAEAMAEALAGVTIKAPAAPLVANVLASPI 240

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
           +  DEI R LVEQVTG VRWRE++ + A+ GV    E+G+GKVL+GL KRI      +S+
Sbjct: 241 TDPDEIRRRLVEQVTGTVRWRESVAFMASQGVNQFLEIGAGKVLSGLVKRIADGAIGISV 300

Query: 300 SKVEDIDLALRSIV 313
               DI  A  ++ 
Sbjct: 301 GGPNDIASAKDALA 314


>gi|297544754|ref|YP_003677056.1| malonyl CoA-acyl carrier protein transacylase [Thermoanaerobacter
           mathranii subsp. mathranii str. A3]
 gi|296842529|gb|ADH61045.1| malonyl CoA-acyl carrier protein transacylase [Thermoanaerobacter
           mathranii subsp. mathranii str. A3]
          Length = 309

 Score =  195 bits (496), Expect = 5e-48,   Method: Composition-based stats.
 Identities = 127/314 (40%), Positives = 189/314 (60%), Gaps = 5/314 (1%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M     +PGQGSQ  GMG+++Y  + EAR +FE  D  L  ++S L + G +EEL  T N
Sbjct: 1   MKIAFIYPGQGSQYAGMGKEIYQRYQEAREIFERADEALGFSISKLCFEGPEEELLKTEN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
            QPA+  VS+A  +V++  G+    +    AG SLGEY++L  A+A    D +RLV+ RG
Sbjct: 61  TQPAILTVSVALTKVLQNRGI----NAEVTAGLSLGEYSSLVLAEALDFEDAVRLVKNRG 116

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           K MQ  VP G+G+M AI+GL++ VV+ IC  AS+VGI E AN N  GQ+VISG   AV+ 
Sbjct: 117 KYMQGVVPQGVGTMAAILGLENEVVEEICRIASQVGIVEPANYNCPGQLVISGEVKAVEK 176

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A +    KGAKRAV L VSAPFH S++    ++++  L  +  ++  +P++ N  A+   
Sbjct: 177 AVELAKEKGAKRAVVLAVSAPFHCSMLRKAGELLEKDLGKIEIRELKIPVISNVTAN-YV 235

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
           + +EI  LL++QV+  V W ++++     GV    E+G GK LTG  K+ID++  A +  
Sbjct: 236 TREEIKELLIKQVSHPVLWEQSVKRMIEDGVDIFVEIGPGKTLTGFVKKIDRTKDAYNFE 295

Query: 301 KVEDIDLALRSIVG 314
             E +   L ++ G
Sbjct: 296 DEESLLKTLSALEG 309


>gi|212375083|pdb|3EZO|A Chain A, Crystal Structure Of Acyl-Carrier-Protein S-
           Malonyltransferase From Burkholderia Pseudomallei 1710b
          Length = 318

 Score =  195 bits (496), Expect = 5e-48,   Method: Composition-based stats.
 Identities = 132/313 (42%), Positives = 172/313 (54%), Gaps = 4/313 (1%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M     FPGQGSQ +GM     D     R   +E    L Q++  L+ +G  +EL  T N
Sbjct: 9   MKFAFVFPGQGSQSVGMLNAFAD-VAVVRETLDEASDALGQDIGKLIADGPADELNLTTN 67

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
            QP +   + A  R  ++ G       S VAGHSLGEYTAL AA A +  D + LVR R 
Sbjct: 68  TQPVMLTAAYACYRAWQQAGGA---QPSIVAGHSLGEYTALVAAGAIAFRDALPLVRFRA 124

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           ++MQ AVP G+G M AI+GLDD  V ++CA+AS  G+ E  N N   QVVI+G +  ++ 
Sbjct: 125 QAMQTAVPVGVGGMAAILGLDDDTVRAVCAEASATGVVEAVNFNAPAQVVIAGTKAGIEK 184

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A +    KGAKRA+ LPVSAPFHSSL+ P S  ++  L  V  + P + ++ N   + VS
Sbjct: 185 ACEIAKEKGAKRALPLPVSAPFHSSLLKPASDKLREYLAGVDVKAPKISVVNNIDVAVVS 244

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
               I   LV Q  G VRW E +Q  A  GV  V E G GKVL GL KRID +L   S+ 
Sbjct: 245 DPAAIKDALVRQAAGPVRWVECVQHIAREGVTHVIECGPGKVLAGLTKRIDGNLVGASVF 304

Query: 301 KVEDIDLALRSIV 313
               +D AL+   
Sbjct: 305 DPASLDEALKLAA 317


>gi|53720047|ref|YP_109033.1| acyl-carrier-protein S-malonyltransferase [Burkholderia
           pseudomallei K96243]
 gi|53725369|ref|YP_102327.1| acyl-carrier-protein S-malonyltransferase [Burkholderia mallei ATCC
           23344]
 gi|67641124|ref|ZP_00439909.1| malonyl CoA-acyl carrier protein transacylase [Burkholderia mallei
           GB8 horse 4]
 gi|76811768|ref|YP_334287.1| acyl-carrier-protein S-malonyltransferase [Burkholderia
           pseudomallei 1710b]
 gi|121598980|ref|YP_993782.1| malonyl CoA-acyl carrier protein transacylase [Burkholderia mallei
           SAVP1]
 gi|124384131|ref|YP_001028752.1| malonyl CoA-acyl carrier protein transacylase [Burkholderia mallei
           NCTC 10229]
 gi|126450420|ref|YP_001081340.1| malonyl CoA-acyl carrier protein transacylase [Burkholderia mallei
           NCTC 10247]
 gi|167000767|ref|ZP_02266574.1| malonyl CoA-acyl carrier protein transacylase [Burkholderia mallei
           PRL-20]
 gi|167816764|ref|ZP_02448444.1| malonyl CoA-acyl carrier protein transacylase [Burkholderia
           pseudomallei 91]
 gi|167895257|ref|ZP_02482659.1| malonyl CoA-acyl carrier protein transacylase [Burkholderia
           pseudomallei 7894]
 gi|167903641|ref|ZP_02490846.1| malonyl CoA-acyl carrier protein transacylase [Burkholderia
           pseudomallei NCTC 13177]
 gi|167919886|ref|ZP_02506977.1| malonyl CoA-acyl carrier protein transacylase [Burkholderia
           pseudomallei BCC215]
 gi|217420517|ref|ZP_03452022.1| [acyl-carrier-protein] S-malonyltransferase [Burkholderia
           pseudomallei 576]
 gi|254178662|ref|ZP_04885317.1| malonyl CoA-acyl carrier protein transacylase [Burkholderia mallei
           ATCC 10399]
 gi|254184198|ref|ZP_04890788.1| malonyl CoA-acyl carrier protein transacylase [Burkholderia
           pseudomallei 1655]
 gi|254199220|ref|ZP_04905586.1| malonyl CoA-acyl carrier protein transacylase [Burkholderia mallei
           FMH]
 gi|254205527|ref|ZP_04911879.1| malonyl CoA-acyl carrier protein transacylase [Burkholderia mallei
           JHU]
 gi|254260114|ref|ZP_04951168.1| malonyl CoA-acyl carrier protein transacylase [Burkholderia
           pseudomallei 1710a]
 gi|254357694|ref|ZP_04973967.1| malonyl CoA-acyl carrier protein transacylase [Burkholderia mallei
           2002721280]
 gi|52210461|emb|CAH36444.1| malonyl CoA-acyl carrier protein transacylase [Burkholderia
           pseudomallei K96243]
 gi|52428792|gb|AAU49385.1| malonyl CoA-acyl carrier protein transacylase [Burkholderia mallei
           ATCC 23344]
 gi|76581221|gb|ABA50696.1| malonyl CoA-acyl carrier protein transacylase [Burkholderia
           pseudomallei 1710b]
 gi|121227790|gb|ABM50308.1| malonyl CoA-acyl carrier protein transacylase [Burkholderia mallei
           SAVP1]
 gi|124292151|gb|ABN01420.1| malonyl CoA-acyl carrier protein transacylase [Burkholderia mallei
           NCTC 10229]
 gi|126243290|gb|ABO06383.1| malonyl CoA-acyl carrier protein transacylase [Burkholderia mallei
           NCTC 10247]
 gi|147748816|gb|EDK55890.1| malonyl CoA-acyl carrier protein transacylase [Burkholderia mallei
           FMH]
 gi|147752970|gb|EDK60035.1| malonyl CoA-acyl carrier protein transacylase [Burkholderia mallei
           JHU]
 gi|148026821|gb|EDK84842.1| malonyl CoA-acyl carrier protein transacylase [Burkholderia mallei
           2002721280]
 gi|160699701|gb|EDP89671.1| malonyl CoA-acyl carrier protein transacylase [Burkholderia mallei
           ATCC 10399]
 gi|184214729|gb|EDU11772.1| malonyl CoA-acyl carrier protein transacylase [Burkholderia
           pseudomallei 1655]
 gi|217395929|gb|EEC35946.1| [acyl-carrier-protein] S-malonyltransferase [Burkholderia
           pseudomallei 576]
 gi|238521989|gb|EEP85436.1| malonyl CoA-acyl carrier protein transacylase [Burkholderia mallei
           GB8 horse 4]
 gi|243063317|gb|EES45503.1| malonyl CoA-acyl carrier protein transacylase [Burkholderia mallei
           PRL-20]
 gi|254218803|gb|EET08187.1| malonyl CoA-acyl carrier protein transacylase [Burkholderia
           pseudomallei 1710a]
          Length = 310

 Score =  195 bits (496), Expect = 5e-48,   Method: Composition-based stats.
 Identities = 132/313 (42%), Positives = 172/313 (54%), Gaps = 4/313 (1%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M     FPGQGSQ +GM     D     R   +E    L Q++  L+ +G  +EL  T N
Sbjct: 1   MKFAFVFPGQGSQSVGMLNAFAD-VAVVRETLDEASDALGQDIGKLIADGPADELNLTTN 59

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
            QP +   + A  R  ++ G       S VAGHSLGEYTAL AA A +  D + LVR R 
Sbjct: 60  TQPVMLTAAYACYRAWQQAGGA---QPSIVAGHSLGEYTALVAAGAIAFRDALPLVRFRA 116

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           ++MQ AVP G+G M AI+GLDD  V ++CA+AS  G+ E  N N   QVVI+G +  ++ 
Sbjct: 117 QAMQTAVPVGVGGMAAILGLDDDTVRAVCAEASATGVVEAVNFNAPAQVVIAGTKAGIEK 176

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A +    KGAKRA+ LPVSAPFHSSL+ P S  ++  L  V  + P + ++ N   + VS
Sbjct: 177 ACEIAKEKGAKRALPLPVSAPFHSSLLKPASDKLREYLAGVDVKAPKISVVNNIDVAVVS 236

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
               I   LV Q  G VRW E +Q  A  GV  V E G GKVL GL KRID +L   S+ 
Sbjct: 237 DPAAIKDALVRQAAGPVRWVECVQHIAREGVTHVIECGPGKVLAGLTKRIDGNLVGASVF 296

Query: 301 KVEDIDLALRSIV 313
               +D AL+   
Sbjct: 297 DPASLDEALKLAA 309


>gi|167720571|ref|ZP_02403807.1| malonyl CoA-acyl carrier protein transacylase [Burkholderia
           pseudomallei DM98]
          Length = 310

 Score =  195 bits (496), Expect = 5e-48,   Method: Composition-based stats.
 Identities = 132/313 (42%), Positives = 172/313 (54%), Gaps = 4/313 (1%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M     FPGQGSQ +GM     D     R   +E    L Q++  L+ +G  +EL  T N
Sbjct: 1   MKFAFVFPGQGSQSVGMLSAFAD-VAVVRETLDEASDALGQDIGKLIADGPADELNLTTN 59

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
            QP +   + A  R  ++ G       S VAGHSLGEYTAL AA A +  D + LVR R 
Sbjct: 60  TQPVMLTAAYACYRAWQQAGGA---QPSIVAGHSLGEYTALVAAGAIAFRDALPLVRFRA 116

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           ++MQ AVP G+G M AI+GLDD  V ++CA+AS  G+ E  N N   QVVI+G +  ++ 
Sbjct: 117 QAMQTAVPVGVGGMAAILGLDDDTVRAVCAEASATGVVEAVNFNAPAQVVIAGTKAGIEK 176

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A +    KGAKRA+ LPVSAPFHSSL+ P S  ++  L  V  + P + ++ N   + VS
Sbjct: 177 ACEIAKAKGAKRALPLPVSAPFHSSLLKPASDKLREYLAGVDVKAPKISVVNNIDVAVVS 236

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
               I   LV Q  G VRW E +Q  A  GV  V E G GKVL GL KRID +L   S+ 
Sbjct: 237 DPAAIKDALVRQAAGPVRWVECVQHIAREGVTHVIECGPGKVLAGLTKRIDGNLVGASVF 296

Query: 301 KVEDIDLALRSIV 313
               +D AL+   
Sbjct: 297 DPASLDEALKLAA 309


>gi|289578478|ref|YP_003477105.1| malonyl CoA-acyl carrier protein transacylase [Thermoanaerobacter
           italicus Ab9]
 gi|289528191|gb|ADD02543.1| malonyl CoA-acyl carrier protein transacylase [Thermoanaerobacter
           italicus Ab9]
          Length = 309

 Score =  195 bits (496), Expect = 6e-48,   Method: Composition-based stats.
 Identities = 126/314 (40%), Positives = 189/314 (60%), Gaps = 5/314 (1%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M     +PGQGSQ  GMG+++Y  + EAR +FE  D  L  ++S L + G +EEL  T N
Sbjct: 1   MKIAFIYPGQGSQYAGMGKEIYQRYQEAREIFERADEALGFSISKLCFEGPEEELLKTEN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
            QPA+  VS+A  +V++  G+    +    AG SLGEY++L  A+A    D +RLV+ RG
Sbjct: 61  TQPAILTVSVALTKVLQNRGI----NAEVTAGLSLGEYSSLVLAEALDFEDAVRLVKNRG 116

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           K MQ  VP G+G+M AI+GL++ VV+ IC  AS+VGI E AN N  GQ+VISG   AV+ 
Sbjct: 117 KYMQGVVPQGVGTMAAILGLENEVVEEICRIASQVGIVEPANYNCPGQLVISGEVKAVEK 176

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A +    KGAKRAV L VSAPFH S++    ++++  L  +  ++  +P++ N  A+   
Sbjct: 177 AVELAKEKGAKRAVVLAVSAPFHCSMLRKAGELLEKDLGKIEIRELKIPVISNVTAN-YV 235

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
           + +E+  LL++QV+  V W ++++     GV    E+G GK LTG  K+ID++  A +  
Sbjct: 236 TREEVKELLIKQVSHPVLWEQSVKRMIEDGVDIFVEIGPGKTLTGFVKKIDRTKDAYNFE 295

Query: 301 KVEDIDLALRSIVG 314
             E +   L ++ G
Sbjct: 296 DEESLLKTLSALEG 309


>gi|262393768|ref|YP_003285622.1| malonyl CoA-acyl carrier protein transacylase [Vibrio sp. Ex25]
 gi|262337362|gb|ACY51157.1| malonyl CoA-acyl carrier protein transacylase [Vibrio sp. Ex25]
          Length = 307

 Score =  195 bits (496), Expect = 6e-48,   Method: Composition-based stats.
 Identities = 126/307 (41%), Positives = 175/307 (57%), Gaps = 3/307 (0%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
              + FPGQGSQ +GM  +L + +   +  F E    L  +L  L+ NG  E+L  T   
Sbjct: 3   KFAIVFPGQGSQAVGMLAELGEQYDVVKQTFAEASDALGYDLWALVQNGPAEDLNETFRT 62

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPAL A S+A  RV ++ GL      + +AGHSLGEY+AL  A      + I+LV  RGK
Sbjct: 63  QPALLASSVAIWRVWQELGL---EQPANLAGHSLGEYSALVCAGVIDFKEAIKLVELRGK 119

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCA 181
            MQEAVP G G+M AIIGL D  +   C  A++  +    N N  GQVVI+G +DAV+ A
Sbjct: 120 LMQEAVPAGTGAMYAIIGLADDAIAKACEDAAQGEVVSPVNFNSPGQVVIAGSKDAVERA 179

Query: 182 ADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSS 241
              C   GAKRA+ LPVS P H +LM P ++ +   L+S+    P +P++ N      + 
Sbjct: 180 GALCKEAGAKRALPLPVSVPSHCALMKPAAEKLAVALESIEFNSPQLPVINNVDVVAETD 239

Query: 242 IDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISK 301
             +I   LV Q+   VRW ET++     GV+ + E+G GKVLTGL KRI K+L+A +++ 
Sbjct: 240 PAKIKDALVRQLHSPVRWTETVELMHEQGVEQLLELGPGKVLTGLTKRIVKTLTAAAVND 299

Query: 302 VEDIDLA 308
           V  +D A
Sbjct: 300 VASLDAA 306


>gi|125973452|ref|YP_001037362.1| [Acyl-carrier-protein] S-malonyltransferase [Clostridium
           thermocellum ATCC 27405]
 gi|256005348|ref|ZP_05430313.1| malonyl CoA-acyl carrier protein transacylase [Clostridium
           thermocellum DSM 2360]
 gi|281417652|ref|ZP_06248672.1| malonyl CoA-acyl carrier protein transacylase [Clostridium
           thermocellum JW20]
 gi|125713677|gb|ABN52169.1| [Acyl-carrier-protein] S-malonyltransferase [Clostridium
           thermocellum ATCC 27405]
 gi|255990667|gb|EEU00784.1| malonyl CoA-acyl carrier protein transacylase [Clostridium
           thermocellum DSM 2360]
 gi|281409054|gb|EFB39312.1| malonyl CoA-acyl carrier protein transacylase [Clostridium
           thermocellum JW20]
 gi|316940311|gb|ADU74345.1| malonyl CoA-acyl carrier protein transacylase [Clostridium
           thermocellum DSM 1313]
          Length = 311

 Score =  195 bits (496), Expect = 6e-48,   Method: Composition-based stats.
 Identities = 117/311 (37%), Positives = 178/311 (57%), Gaps = 4/311 (1%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
                FPGQG+Q IGMG+ + D +  A  +F+E    L  ++  +++ G +E L  T N 
Sbjct: 3   KLAFLFPGQGAQYIGMGKQIADEYKSADAIFDEASEVLGFDMKKMIFEGDEETLKITENT 62

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPA+   S+A ++ + + G+        VAG SLGEY+A  AA   +  D + LVR RGK
Sbjct: 63  QPAILTTSVALLQPVLEKGI----KPDVVAGLSLGEYSAHVAAGTMTFRDAVALVRKRGK 118

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCA 181
            MQEAVP G+G+M AIIGLD   V   C +AS  GI E AN N  GQ+ ++G   AV+ A
Sbjct: 119 FMQEAVPVGVGTMAAIIGLDSEAVKECCKKASSEGIVEPANFNCPGQITVAGEVKAVEKA 178

Query: 182 ADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSS 241
            +     GAKRA+ L VSAPFH S++ P    +   L+ VT  D  +P++ N  A  +  
Sbjct: 179 LEIAKEMGAKRAMLLAVSAPFHCSMLKPAGDKLAAELERVTLGDMQIPVVTNVTAEYIID 238

Query: 242 IDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISK 301
            D++  LL+ QV+  V + ++I+     GV +  E+G GKVL+G  K+I+K +  +++  
Sbjct: 239 KDKVKDLLIRQVSSSVLFEDSIRNMIEDGVDTFVEIGPGKVLSGFVKKINKEMKTLNVED 298

Query: 302 VEDIDLALRSI 312
           +E ++  L+ +
Sbjct: 299 IESLNKTLQEL 309


>gi|134277015|ref|ZP_01763730.1| malonyl CoA-acyl carrier protein transacylase [Burkholderia
           pseudomallei 305]
 gi|167739562|ref|ZP_02412336.1| malonyl CoA-acyl carrier protein transacylase [Burkholderia
           pseudomallei 14]
 gi|237813207|ref|YP_002897658.1| malonyl CoA-acyl carrier protein transacylase [Burkholderia
           pseudomallei MSHR346]
 gi|134250665|gb|EBA50744.1| malonyl CoA-acyl carrier protein transacylase [Burkholderia
           pseudomallei 305]
 gi|237502956|gb|ACQ95274.1| malonyl CoA-acyl carrier protein transacylase [Burkholderia
           pseudomallei MSHR346]
          Length = 310

 Score =  195 bits (495), Expect = 6e-48,   Method: Composition-based stats.
 Identities = 132/313 (42%), Positives = 172/313 (54%), Gaps = 4/313 (1%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M     FPGQGSQ +GM     D     R   +E    L Q++  L+ +G  +EL  T N
Sbjct: 1   MKFAFVFPGQGSQSVGMLNAFAD-VAVVRETLDEASDALGQDIGKLIADGPADELNLTTN 59

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
            QP +   + A  R  ++ G       S VAGHSLGEYTAL AA A +  D + LVR R 
Sbjct: 60  TQPVMLTAAYACYRAWQQAGGA---QPSIVAGHSLGEYTALVAAGAIAFRDALPLVRFRA 116

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           ++MQ AVP G+G M AI+GLDD  V ++CA+AS  G+ E  N N   QVVI+G +  ++ 
Sbjct: 117 QAMQTAVPVGVGGMAAILGLDDDTVRAVCAEASATGVVEAVNFNAPAQVVIAGTKAGIEK 176

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A +    KGAKRA+ LPVSAPFHSSL+ P S  ++  L  V  + P + ++ N   + VS
Sbjct: 177 ACEIAKAKGAKRALPLPVSAPFHSSLLKPASDKLREYLAGVDVKAPKISVVNNIDVAVVS 236

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
               I   LV Q  G VRW E +Q  A  GV  V E G GKVL GL KRID +L   S+ 
Sbjct: 237 DPAAIKDALVRQAAGPVRWVECVQHIAREGVTHVIECGPGKVLAGLTKRIDGNLVGASVF 296

Query: 301 KVEDIDLALRSIV 313
               +D AL+   
Sbjct: 297 DPASLDEALKLAA 309


>gi|154686006|ref|YP_001421167.1| hypothetical protein RBAM_015730 [Bacillus amyloliquefaciens FZB42]
 gi|154351857|gb|ABS73936.1| FabD [Bacillus amyloliquefaciens FZB42]
          Length = 317

 Score =  195 bits (495), Expect = 7e-48,   Method: Composition-based stats.
 Identities = 126/313 (40%), Positives = 192/313 (61%), Gaps = 5/313 (1%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
                FPGQGSQ IGMG+DLY+    ++ +F+E D TL   LS L++ G  EELT T NA
Sbjct: 3   KIAFLFPGQGSQYIGMGKDLYEREEASKRIFDEADETLETKLSSLIFEGDAEELTLTYNA 62

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPAL   S+A +   +++ +       + AGHSLGEY+AL AA A +  D +  VR RG+
Sbjct: 63  QPALLTTSIAVLEKFKESSIT----PDFTAGHSLGEYSALVAAGAMTFKDAVYTVRKRGE 118

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQAS-RVGICEIANDNGGGQVVISGLQDAVKC 180
            M EAVP G G+M AI+G+D   +  +  Q +    + ++AN N  GQ+VISG    V+ 
Sbjct: 119 FMNEAVPAGEGAMAAILGMDAESLKKVTDQVTENGHLVQLANLNCPGQIVISGTAKGVEL 178

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A++   N GAKRA+ L VS PFHS LM P ++ ++ +L +   ++  VP++ N  A  ++
Sbjct: 179 ASEEAKNNGAKRAIPLEVSGPFHSELMKPAAQKLEEVLSACELKNAAVPVISNVSADVMT 238

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
             D+I + L+EQ+   VR+ ETI    + GV +  E+G GKVL+GL K++++ L  +++S
Sbjct: 239 EKDDIKKKLIEQLYSPVRFEETINKLIDEGVTTFVEIGPGKVLSGLVKKVNRRLKTIAVS 298

Query: 301 KVEDIDLALRSIV 313
             E I+LA++++ 
Sbjct: 299 DHETIELAIQTLK 311


>gi|114766137|ref|ZP_01445141.1| acyl-carrier-protein S-malonyltransferase [Pelagibaca bermudensis
           HTCC2601]
 gi|114541597|gb|EAU44639.1| acyl-carrier-protein S-malonyltransferase [Roseovarius sp.
           HTCC2601]
          Length = 313

 Score =  195 bits (495), Expect = 7e-48,   Method: Composition-based stats.
 Identities = 154/313 (49%), Positives = 201/313 (64%), Gaps = 2/313 (0%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           MS    FPGQG+Q IGMG+ L +++P AR VFEEVD  L + LS L+W G  E LT T N
Sbjct: 1   MSRAFIFPGQGAQAIGMGKALAEAYPAARAVFEEVDEALGEKLSTLIWEGEAETLTLTEN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
           AQPAL A S+A +R +E  G+ V    S+VAGHSLGEY+AL AA A S++D  RL+R RG
Sbjct: 61  AQPALMATSLAAMRALEAEGIAVGA-ASFVAGHSLGEYSALTAAGALSVADAARLLRTRG 119

Query: 121 KSMQEAVPPGLGSMVAIIGLD-DCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVK 179
           ++MQ+AVP G G+M A++GLD           A   G+C  ANDN   QVVISG +DAV+
Sbjct: 120 RAMQQAVPVGEGAMAALLGLDLATAQAVAAEAAEGGGVCAAANDNDPAQVVISGSKDAVE 179

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            A +    KGAKRAV LPVSAPFH  LM P ++VM   L +V    P VP++ N  AS V
Sbjct: 180 RAVEIAKEKGAKRAVMLPVSAPFHCELMAPAAEVMAEALAAVEIAAPSVPLVANVRASAV 239

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
           +   EI  LLVEQVTG VRWRE++++    GV + +E+G+GK LTG+ +RI +     ++
Sbjct: 240 TDPTEIRALLVEQVTGSVRWRESVEYMVAQGVTAFWEIGAGKALTGMVRRIHRPAGVQTV 299

Query: 300 SKVEDIDLALRSI 312
              ED+   L + 
Sbjct: 300 GTPEDVAKVLEAA 312


>gi|292670171|ref|ZP_06603597.1| malonyl CoA-acyl carrier protein transacylase [Selenomonas noxia
           ATCC 43541]
 gi|292648123|gb|EFF66095.1| malonyl CoA-acyl carrier protein transacylase [Selenomonas noxia
           ATCC 43541]
          Length = 311

 Score =  195 bits (495), Expect = 7e-48,   Method: Composition-based stats.
 Identities = 122/312 (39%), Positives = 172/312 (55%), Gaps = 4/312 (1%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
                FPGQG+QV+GMG+D +D++  A+  F E D  L  ++S L + G  ++L  T + 
Sbjct: 3   KLAFLFPGQGAQVVGMGKDFFDAYDLAKKRFAEADEALGYSISKLCFEGPADQLQLTEHT 62

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPA+  VS+    ++ + G+         AGHSLGEY+AL  A   S  D + LV  RG 
Sbjct: 63  QPAILTVSVIAAELLREEGIA----PEIAAGHSLGEYSALVLAGVLSFQDAVALVHKRGA 118

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCA 181
            MQEAVP G G+M A+IGLDD  + ++CA+AS  G  +  N N  GQ VI+G    V+ A
Sbjct: 119 YMQEAVPVGEGAMAAVIGLDDDTIVAVCAEASAAGAVQAVNFNCPGQTVIAGTVKGVEQA 178

Query: 182 ADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSS 241
            +    KGAK+AV LPVSAPFHS+LM P +K +   LD V   D   P++ N+      +
Sbjct: 179 VELLQEKGAKKAVILPVSAPFHSTLMEPAAKKLAAELDKVQLHDAAFPVVSNYTGGLQQT 238

Query: 242 IDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISK 301
             EI   LV Q    VRW   +      G  +  E G GK L G  KRIDK+L+++++  
Sbjct: 239 AAEIKANLVAQADHPVRWIACVNTMRTFGADTYVECGPGKTLAGFNKRIDKALTSLNVEN 298

Query: 302 VEDIDLALRSIV 313
           V  +   L ++ 
Sbjct: 299 VASLQKTLDTLK 310


>gi|170755402|ref|YP_001783237.1| malonyl CoA-acyl carrier protein transacylase [Clostridium
           botulinum B1 str. Okra]
 gi|169120614|gb|ACA44450.1| malonyl CoA-acyl carrier protein transacylase [Clostridium
           botulinum B1 str. Okra]
          Length = 314

 Score =  195 bits (495), Expect = 7e-48,   Method: Composition-based stats.
 Identities = 110/312 (35%), Positives = 170/312 (54%), Gaps = 4/312 (1%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
                F GQG+Q +GMG++LY+S PE R +F   +  L   L+ + + G +EE+  T N 
Sbjct: 3   KIAFIFSGQGAQYVGMGKELYESIPECREIFHIAEEELQIPLTKICFEGPKEEIDKTENT 62

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPA+  +S+A ++ +EK G+         AG SLGEY+AL  +      + + LVR RG+
Sbjct: 63  QPAILTLSIAAMKALEKYGI----KPDVTAGLSLGEYSALVCSNVIDFKEAVSLVRKRGQ 118

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCA 181
            M+ AVP G+G+M AIIGL   VV  IC      GI +IAN N  GQ+VISG   AV+ A
Sbjct: 119 YMENAVPNGVGTMAAIIGLKKEVVKEICDCIKEEGIVQIANINCPGQIVISGEIKAVEKA 178

Query: 182 ADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSS 241
            +    K A R V L VS PFHS ++    + +   L  +  +   VP   N     V +
Sbjct: 179 CEIAKEKRALRCVKLSVSGPFHSIMLKEAGEKLYEELQKIQLESIEVPFTTNVTGDFVKN 238

Query: 242 IDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISK 301
             EI  LL +QV   V W ++I+   + GV +  E+G  KVL+G  K+I++ ++ +++  
Sbjct: 239 TSEIKDLLKKQVMSTVHWEDSIKAMIDFGVDTFIEIGPSKVLSGFVKKINRKVNILNVED 298

Query: 302 VEDIDLALRSIV 313
           ++ ++  +  + 
Sbjct: 299 IDSLNKTIEKLK 310


>gi|15642024|ref|NP_231656.1| acyl carrier protein S-malonyltransferase [Vibrio cholerae O1
           biovar El Tor str. N16961]
 gi|147673966|ref|YP_001217549.1| malonyl CoA-acyl carrier protein transacylase [Vibrio cholerae
           O395]
 gi|153824232|ref|ZP_01976899.1| malonyl CoA-acyl carrier protein transacylase [Vibrio cholerae B33]
 gi|227082149|ref|YP_002810700.1| malonyl CoA-acyl carrier protein transacylase [Vibrio cholerae
           M66-2]
 gi|254849109|ref|ZP_05238459.1| malonyl Coa-acyl carrier protein transacylase [Vibrio cholerae
           MO10]
 gi|297579526|ref|ZP_06941454.1| malonyl Coa-acyl carrier protein transacylase [Vibrio cholerae
           RC385]
 gi|298497948|ref|ZP_07007755.1| malonyl CoA-acyl carrier protein transacylase [Vibrio cholerae MAK
           757]
 gi|9656566|gb|AAF95170.1| malonyl Coa-acyl carrier protein transacylase [Vibrio cholerae O1
           biovar El Tor str. N16961]
 gi|126518245|gb|EAZ75470.1| malonyl CoA-acyl carrier protein transacylase [Vibrio cholerae B33]
 gi|146315849|gb|ABQ20388.1| malonyl CoA-acyl carrier protein transacylase [Vibrio cholerae
           O395]
 gi|227010037|gb|ACP06249.1| malonyl CoA-acyl carrier protein transacylase [Vibrio cholerae
           M66-2]
 gi|227013919|gb|ACP10129.1| malonyl CoA-acyl carrier protein transacylase [Vibrio cholerae
           O395]
 gi|254844814|gb|EET23228.1| malonyl Coa-acyl carrier protein transacylase [Vibrio cholerae
           MO10]
 gi|297537120|gb|EFH75953.1| malonyl Coa-acyl carrier protein transacylase [Vibrio cholerae
           RC385]
 gi|297542281|gb|EFH78331.1| malonyl CoA-acyl carrier protein transacylase [Vibrio cholerae MAK
           757]
          Length = 312

 Score =  195 bits (495), Expect = 8e-48,   Method: Composition-based stats.
 Identities = 121/307 (39%), Positives = 171/307 (55%), Gaps = 3/307 (0%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
              + FPGQGSQ +GM  DL + +   +  F E    L  +L  L+ +G  E+L  T   
Sbjct: 8   KFAIVFPGQGSQAVGMLADLAEQYAVVKQTFAEASEVLGYDLWALVQDGPVEDLNQTFRT 67

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPAL A S+A  RV ++ GL      + +AGHSLGEY+AL  A        I+LV  RG+
Sbjct: 68  QPALLAASVAIWRVWQQLGL---EQPAVLAGHSLGEYSALVCAGVIDFKQAIKLVELRGQ 124

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCA 181
            MQ+AVP G G+M AIIGL+D  +   CA A++  +    N N  GQVVI+G +DAV+ A
Sbjct: 125 LMQQAVPAGTGAMYAIIGLEDEAIAKACADAAQGEVVSPVNFNSPGQVVIAGQKDAVERA 184

Query: 182 ADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSS 241
              C   GAKRA+ LPVS P H +LM P +  +   L  +    P +P++ N      + 
Sbjct: 185 GVLCKEAGAKRALPLPVSVPSHCALMKPAADELAKTLAELEFNAPQIPVINNVDVVAETD 244

Query: 242 IDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISK 301
             +I   L+ Q+   VRW E ++  +  GV+ + E+G GKVLTGL KRI K+L  V+++ 
Sbjct: 245 PVKIKDALIRQLYSPVRWTECVEQMSAQGVEKLIEMGPGKVLTGLTKRIVKTLEGVAVND 304

Query: 302 VEDIDLA 308
           V  +D  
Sbjct: 305 VASLDAV 311


>gi|39936138|ref|NP_948414.1| malonyl CoA-acyl carrier protein transacylase [Rhodopseudomonas
           palustris CGA009]
 gi|39649992|emb|CAE28516.1| putative malonyl CoA-acyl carrier protein transacylase
           [Rhodopseudomonas palustris CGA009]
          Length = 319

 Score =  195 bits (495), Expect = 8e-48,   Method: Composition-based stats.
 Identities = 159/314 (50%), Positives = 218/314 (69%), Gaps = 1/314 (0%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M+   TFPGQGSQ +GMG+ L ++FP AR VF+EVD  L + L+ ++W G  E L  T N
Sbjct: 1   MTAAFTFPGQGSQAVGMGKALAEAFPAARAVFDEVDAALGEKLTSIIWEGPAETLQLTEN 60

Query: 61  AQPALTAVSMAFIRVME-KNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRAR 119
           AQPAL AVS+A +RV+E + G+ V +D ++VAGHSLGEY+AL AA + S+SDT RL+R R
Sbjct: 61  AQPALMAVSLATMRVLETEAGVSVGKDAAFVAGHSLGEYSALAAAGSLSVSDTARLLRIR 120

Query: 120 GKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVK 179
           G++MQ+AVP G+G+M A++GLD     ++ A+A++  +C+ ANDNGGGQVV+SG +DAV+
Sbjct: 121 GQAMQKAVPVGVGAMAALLGLDYDTAVAVAAEAAQGQVCQAANDNGGGQVVVSGHKDAVE 180

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            A +    KGAKRA+ LPVSAPFH SLM P ++ M   L  VT + P  P++ N  ASP+
Sbjct: 181 RAVEIAKGKGAKRAMLLPVSAPFHCSLMQPAAEAMAEALAGVTIKAPAAPLVANVLASPI 240

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
           +   EI R LVEQVTG VRWRE++ + A+ GV    E+G+GKVL+GL KRI      +S+
Sbjct: 241 TDPHEIRRRLVEQVTGTVRWRESVAFMASQGVNQFLEIGAGKVLSGLVKRIADGAIGISV 300

Query: 300 SKVEDIDLALRSIV 313
               DI  A  ++ 
Sbjct: 301 GGPNDIVSAKDALA 314


>gi|332981626|ref|YP_004463067.1| (Acyl-carrier-protein) S-malonyltransferase [Mahella australiensis
           50-1 BON]
 gi|332699304|gb|AEE96245.1| (Acyl-carrier-protein) S-malonyltransferase [Mahella australiensis
           50-1 BON]
          Length = 311

 Score =  195 bits (495), Expect = 8e-48,   Method: Composition-based stats.
 Identities = 125/313 (39%), Positives = 184/313 (58%), Gaps = 4/313 (1%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
                FPGQG+Q  GMG+ L   + E   +F+    TL  +++ L + G  E L  T   
Sbjct: 3   KIAFIFPGQGAQYAGMGQQLALRYAEVSEIFKAASETLGYDMAKLCFEGPDEVLKQTEIT 62

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QP++  VSMA  + +E NG+         AG SLGEY AL  A A   +D ++L+R RG+
Sbjct: 63  QPSIFTVSMACAKALEINGVV----PDMAAGLSLGEYGALTVANAIDFADAVKLLRQRGR 118

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCA 181
            MQEAVP G G+M AIIGLD   V+ +C +AS+ G+ E AN N  GQ+VISG   AV+ A
Sbjct: 119 FMQEAVPIGQGAMAAIIGLDKETVEQVCKEASKYGVVEPANYNCPGQIVISGQTVAVQKA 178

Query: 182 ADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSS 241
           ++    KGAKRA+ L VSAPFH SL+      +  +L+SV+   P +P++ N  A  VSS
Sbjct: 179 SEMAKEKGAKRAIMLEVSAPFHCSLLKSAGDRLAEVLESVSINKPAIPVIANVTAEEVSS 238

Query: 242 IDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISK 301
            ++I +LL+EQV+  VRW E+++     G  +  EVG GK L+G  K+I K +  +++  
Sbjct: 239 PEDIRQLLIEQVSSPVRWEESVRRMMAMGADTFIEVGPGKALSGFVKKISKDVKVMNVED 298

Query: 302 VEDIDLALRSIVG 314
           ++ ++ A+  + G
Sbjct: 299 IQSLESAISQLEG 311


>gi|168183680|ref|ZP_02618344.1| malonyl CoA-acyl carrier protein transacylase [Clostridium
           botulinum Bf]
 gi|182673270|gb|EDT85231.1| malonyl CoA-acyl carrier protein transacylase [Clostridium
           botulinum Bf]
          Length = 314

 Score =  195 bits (495), Expect = 8e-48,   Method: Composition-based stats.
 Identities = 113/312 (36%), Positives = 174/312 (55%), Gaps = 4/312 (1%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
                F GQG+Q +GMG+DLY++ PE R +F   +  L   L+ + + G ++E+  T N 
Sbjct: 3   KIAFIFSGQGAQYVGMGKDLYENIPECREIFHIAEEELQIPLTKICFQGPKDEIDKTENT 62

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPA+  +S+A ++ +EK G+         AG SLGEY++L  +K       + LVR RG+
Sbjct: 63  QPAILTLSIAAMKALEKYGI----KPDVTAGLSLGEYSSLVCSKVIDFRKAVSLVRKRGQ 118

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCA 181
            M+ AVP G+G+M AIIGL    V  IC     VGI EIAN N  GQ+VISG  +AV+ A
Sbjct: 119 YMEHAVPNGVGTMAAIIGLKKEKVKEICDGLKEVGIVEIANINCPGQIVISGEINAVEKA 178

Query: 182 ADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSS 241
            +    K A + V L VS PFHSS++    + +   L  +  +   VP + N     V S
Sbjct: 179 CEMAKEKRALKCVNLSVSGPFHSSMLKEAGENLYEELQKIQFKSIEVPFITNVTGDFVIS 238

Query: 242 IDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISK 301
           I EI  LL +QV   V W ++I+   + GV +  E+G  KVL+G  K+ID+ ++ +++  
Sbjct: 239 ISEIKDLLKKQVMSTVLWEDSIKTMIDFGVDTFIEIGPSKVLSGFVKKIDRKVNILNVED 298

Query: 302 VEDIDLALRSIV 313
           ++ ++  +  + 
Sbjct: 299 IDSLNKTIEKLK 310


>gi|163797517|ref|ZP_02191468.1| S-malonyltransferase [alpha proteobacterium BAL199]
 gi|159177266|gb|EDP61825.1| S-malonyltransferase [alpha proteobacterium BAL199]
          Length = 319

 Score =  195 bits (495), Expect = 8e-48,   Method: Composition-based stats.
 Identities = 160/311 (51%), Positives = 212/311 (68%), Gaps = 1/311 (0%)

Query: 4   VLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQP 63
              FPGQGSQ +GMG+DL D++P AR VF+EVD  L ++LS L+W+G +E L  T NAQP
Sbjct: 9   AFVFPGQGSQAVGMGKDLADAYPAARAVFQEVDDALGESLSQLIWDGPEERLVLTANAQP 68

Query: 64  ALTAVSMAFIRVME-KNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKS 122
           AL AVS+A  RV+E ++G    +   +VAGHSLGEY+AL AA  F ++   RL+R RG++
Sbjct: 69  ALMAVSLAVARVLEAESGRSFAQLCDFVAGHSLGEYSALAAAGTFDVATAARLLRLRGEA 128

Query: 123 MQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAA 182
           MQ+AVP G+G+M A+IG +  V  ++ A A+   +C+IANDNGGGQVV+SG   A+    
Sbjct: 129 MQQAVPVGVGAMAALIGAELEVAQALAAAAAEGEVCDIANDNGGGQVVLSGHAGAIDRVL 188

Query: 183 DTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSI 242
               + G KRAV L VSAPFH +LM P +  M   L     + PVVP++ N  A P +  
Sbjct: 189 ALAADHGIKRAVKLTVSAPFHCALMAPAADAMADALALADPRPPVVPVVANVTAMPTTDP 248

Query: 243 DEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKV 302
           D I R LVEQVTGRVRWRE++  FA  GV+S+ EVG+GKVLTGLA+RIDK L+A +I+  
Sbjct: 249 DAIRRQLVEQVTGRVRWRESVASFAGLGVRSMVEVGAGKVLTGLARRIDKDLAATTINGP 308

Query: 303 EDIDLALRSIV 313
            D+D  L S+V
Sbjct: 309 ADVDAFLASLV 319


>gi|229524032|ref|ZP_04413437.1| malonyl CoA-acyl carrier protein transacylase [Vibrio cholerae bv.
           albensis VL426]
 gi|229337613|gb|EEO02630.1| malonyl CoA-acyl carrier protein transacylase [Vibrio cholerae bv.
           albensis VL426]
          Length = 307

 Score =  195 bits (495), Expect = 8e-48,   Method: Composition-based stats.
 Identities = 121/307 (39%), Positives = 172/307 (56%), Gaps = 3/307 (0%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
              + FPGQGSQ +GM  DL + +   +  F E    L  +L  L+ +G  E+L  T   
Sbjct: 3   KFAIVFPGQGSQAVGMLADLAEQYAVVKQTFAEASEVLGYDLWALVQDGPVEDLNQTFRT 62

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPAL A S+A  RV ++ GL      + +AGHSLGEY+AL  A        I+LV  RG+
Sbjct: 63  QPALLAASVAIWRVWQQLGL---EQPAVLAGHSLGEYSALVCAGVIDFKQAIKLVELRGQ 119

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCA 181
            MQ+AVP G G+M AIIGL+D  +   CA+A++  +    N N  GQVVI+G +DAV+ A
Sbjct: 120 LMQQAVPAGTGAMYAIIGLEDEAIAKACAEAAQGEVVSPVNFNSPGQVVIAGQKDAVERA 179

Query: 182 ADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSS 241
              C   GAKRA+ LPVS P H +LM P +  +   L  +    P +P++ N      + 
Sbjct: 180 GVLCKEAGAKRALPLPVSVPSHCALMKPAADELAKTLAELEFNAPQIPVINNVDVVAETD 239

Query: 242 IDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISK 301
             +I   L+ Q+   VRW E ++  +  GV+ + E+G GKVLTGL KRI K+L  V+++ 
Sbjct: 240 PVKIKDALIRQLYSPVRWTECVEQMSAQGVEKLIEMGPGKVLTGLTKRIVKTLEGVAVND 299

Query: 302 VEDIDLA 308
           V  +D  
Sbjct: 300 VASLDAV 306


>gi|229507889|ref|ZP_04397394.1| malonyl CoA-acyl carrier protein transacylase [Vibrio cholerae BX
           330286]
 gi|229511876|ref|ZP_04401355.1| malonyl CoA-acyl carrier protein transacylase [Vibrio cholerae B33]
 gi|229519012|ref|ZP_04408455.1| malonyl CoA-acyl carrier protein transacylase [Vibrio cholerae RC9]
 gi|229521934|ref|ZP_04411351.1| malonyl CoA-acyl carrier protein transacylase [Vibrio cholerae TM
           11079-80]
 gi|229607434|ref|YP_002878082.1| malonyl CoA-acyl carrier protein transacylase [Vibrio cholerae
           MJ-1236]
 gi|255745229|ref|ZP_05419178.1| malonyl CoA-acyl carrier protein transacylase [Vibrio cholera CIRS
           101]
 gi|229340859|gb|EEO05864.1| malonyl CoA-acyl carrier protein transacylase [Vibrio cholerae TM
           11079-80]
 gi|229343701|gb|EEO08676.1| malonyl CoA-acyl carrier protein transacylase [Vibrio cholerae RC9]
 gi|229351841|gb|EEO16782.1| malonyl CoA-acyl carrier protein transacylase [Vibrio cholerae B33]
 gi|229355394|gb|EEO20315.1| malonyl CoA-acyl carrier protein transacylase [Vibrio cholerae BX
           330286]
 gi|229370089|gb|ACQ60512.1| malonyl CoA-acyl carrier protein transacylase [Vibrio cholerae
           MJ-1236]
 gi|255737059|gb|EET92455.1| malonyl CoA-acyl carrier protein transacylase [Vibrio cholera CIRS
           101]
          Length = 307

 Score =  195 bits (495), Expect = 8e-48,   Method: Composition-based stats.
 Identities = 121/307 (39%), Positives = 171/307 (55%), Gaps = 3/307 (0%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
              + FPGQGSQ +GM  DL + +   +  F E    L  +L  L+ +G  E+L  T   
Sbjct: 3   KFAIVFPGQGSQAVGMLADLAEQYAVVKQTFAEASEVLGYDLWALVQDGPVEDLNQTFRT 62

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPAL A S+A  RV ++ GL      + +AGHSLGEY+AL  A        I+LV  RG+
Sbjct: 63  QPALLAASVAIWRVWQQLGL---EQPAVLAGHSLGEYSALVCAGVIDFKQAIKLVELRGQ 119

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCA 181
            MQ+AVP G G+M AIIGL+D  +   CA A++  +    N N  GQVVI+G +DAV+ A
Sbjct: 120 LMQQAVPAGTGAMYAIIGLEDEAIAKACADAAQGEVVSPVNFNSPGQVVIAGQKDAVERA 179

Query: 182 ADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSS 241
              C   GAKRA+ LPVS P H +LM P +  +   L  +    P +P++ N      + 
Sbjct: 180 GVLCKEAGAKRALPLPVSVPSHCALMKPAADELAKTLAELEFNAPQIPVINNVDVVAETD 239

Query: 242 IDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISK 301
             +I   L+ Q+   VRW E ++  +  GV+ + E+G GKVLTGL KRI K+L  V+++ 
Sbjct: 240 PVKIKDALIRQLYSPVRWTECVEQMSAQGVEKLIEMGPGKVLTGLTKRIVKTLEGVAVND 299

Query: 302 VEDIDLA 308
           V  +D  
Sbjct: 300 VASLDAV 306


>gi|315925424|ref|ZP_07921635.1| malonyl-CoA-[acyl-carrier-protein] transacylase [Pseudoramibacter
           alactolyticus ATCC 23263]
 gi|315621325|gb|EFV01295.1| malonyl-CoA-[acyl-carrier-protein] transacylase [Pseudoramibacter
           alactolyticus ATCC 23263]
          Length = 307

 Score =  195 bits (494), Expect = 9e-48,   Method: Composition-based stats.
 Identities = 108/313 (34%), Positives = 167/313 (53%), Gaps = 7/313 (2%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M+    + GQG+Q +GMG DLY+ +P    VF+E    L  +L  L +NG  E+L  T  
Sbjct: 1   MTIAFLYAGQGAQHVGMGADLYERYPAFAKVFDEA--KLPFDLKALCFNGPAEKLNQTAY 58

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
            QPA+ A ++    V+ + G+         AG SLGEY+AL AA  +  + T+ L+  RG
Sbjct: 59  TQPAMVAFAIGVTNVLREVGIV----PDMAAGLSLGEYSALYAAGVWDAATTLDLIAFRG 114

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           ++M +A       M A++ LD   + ++CA+A+  G+ E+AN N  GQVVISG + AV  
Sbjct: 115 QAMAKASEGLDVGMAAVMNLDRDALAAVCAEAASAGVVEMANFNCPGQVVISGDKAAVDR 174

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A +     GA+R V L VS PFH+S M P    +     ++   +P +P+L N       
Sbjct: 175 ACELAKAAGARRCVPLAVSGPFHTSFMKPAGDALAQKFRAIPFNEPRIPVLFNTLGDVKP 234

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
               I  LL +QV   V   ETI+  A+ GV +  E+G GK L+G  K+  +    + + 
Sbjct: 235 EGVSIPELLEKQVQSPVYLEETIRKMADLGVDTFVEIGPGKALSGFVKKTLRGTKPLRVE 294

Query: 301 KVEDIDLALRSIV 313
             +DI+ AL++++
Sbjct: 295 TADDIE-ALKTVL 306


>gi|237797059|ref|YP_002864611.1| malonyl CoA-acyl carrier protein transacylase [Clostridium
           botulinum Ba4 str. 657]
 gi|229263479|gb|ACQ54512.1| malonyl CoA-acyl carrier protein transacylase [Clostridium
           botulinum Ba4 str. 657]
          Length = 314

 Score =  195 bits (494), Expect = 9e-48,   Method: Composition-based stats.
 Identities = 113/312 (36%), Positives = 174/312 (55%), Gaps = 4/312 (1%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
                F GQG+Q +GMG+DLY++ PE R +F   +  L   L+ + + G ++E+  T N 
Sbjct: 3   KIAFIFSGQGAQYVGMGKDLYENIPECREIFHIAEEELQIPLTKICFQGPKDEIDKTENT 62

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPA+  +S+A ++ +EK G+         AG SLGEY++L  +K       + LVR RG+
Sbjct: 63  QPAILTLSIAVMKALEKYGI----KPDVTAGLSLGEYSSLVCSKVIDFRKAVSLVRKRGQ 118

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCA 181
            M+ AVP G+G+M AIIGL    V  IC     VGI EIAN N  GQ+VISG  +AV+ A
Sbjct: 119 YMEHAVPNGVGTMAAIIGLKKEKVKEICDGLKEVGIVEIANINCPGQIVISGEINAVEKA 178

Query: 182 ADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSS 241
            +    K A + V L VS PFHSS++    + +   L  +  +   VP + N     V S
Sbjct: 179 CEMAKEKRALKCVNLSVSGPFHSSMLKEAGENLYEELQKIQFKSIEVPFITNVTGDFVIS 238

Query: 242 IDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISK 301
           I EI  LL +QV   V W ++I+   + GV +  E+G  KVL+G  K+ID+ ++ +++  
Sbjct: 239 ISEIKDLLKKQVMSTVLWEDSIKTMIDFGVDTFIEIGPSKVLSGFVKKIDRKVNILNVED 298

Query: 302 VEDIDLALRSIV 313
           ++ ++  +  + 
Sbjct: 299 IDSLNKTIEKLK 310


>gi|167563540|ref|ZP_02356456.1| malonyl CoA-acyl carrier protein transacylase [Burkholderia
           oklahomensis EO147]
 gi|167570700|ref|ZP_02363574.1| malonyl CoA-acyl carrier protein transacylase [Burkholderia
           oklahomensis C6786]
          Length = 310

 Score =  195 bits (494), Expect = 9e-48,   Method: Composition-based stats.
 Identities = 130/313 (41%), Positives = 172/313 (54%), Gaps = 4/313 (1%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M     FPGQGSQ +GM     D     R   +E    L Q++  L+ +G  +EL  T N
Sbjct: 1   MKFAFVFPGQGSQSVGMLNAFAD-VAVVRETLDEASDVLGQDIGKLIADGPADELNLTTN 59

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
            QP +   + A  R  ++ G       S VAGHSLGEYTAL AA A +  D + LVR R 
Sbjct: 60  TQPVMLTAAYACYRAWQQAGGA---RPSIVAGHSLGEYTALVAAGAIAFRDALPLVRFRA 116

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           ++MQ AVP G G M AI+GLDD  V ++CA+AS  G+ E  N N   QVVI+G +  ++ 
Sbjct: 117 QAMQTAVPVGEGGMAAILGLDDDTVRAVCAEASAAGVVEAVNFNAPAQVVIAGTKAGIEK 176

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A +    KGAKRA+ L VSAPFHSSL+ P S  ++  L +V  + P +P++ N   +  S
Sbjct: 177 ACEIAKAKGAKRALPLQVSAPFHSSLLKPASDKLREYLANVDVKAPQIPVVNNIDVAVAS 236

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
               I   LV Q  G VRW E ++  A  GV  V E G GKVL GL KRID +L   S+ 
Sbjct: 237 DPAAIKDALVRQAAGPVRWVECVKHIAGQGVTHVIECGPGKVLAGLTKRIDTNLVGASVF 296

Query: 301 KVEDIDLALRSIV 313
               +D AL+ + 
Sbjct: 297 DPASLDEALKLVA 309


>gi|75675882|ref|YP_318303.1| acyl-carrier-protein S-malonyltransferase [Nitrobacter winogradskyi
           Nb-255]
 gi|74420752|gb|ABA04951.1| [Acyl-carrier-protein] S-malonyltransferase [Nitrobacter
           winogradskyi Nb-255]
          Length = 317

 Score =  195 bits (494), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 157/305 (51%), Positives = 208/305 (68%), Gaps = 1/305 (0%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M+   TFPGQGSQ +GMG+ L D+FP A+ VF EVD  L + L+ ++W+G  E L  T N
Sbjct: 1   MTAAFTFPGQGSQTVGMGKALADAFPVAKAVFAEVDAALGEKLTAIIWDGPAETLQLTEN 60

Query: 61  AQPALTAVSMAFIRVME-KNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRAR 119
            QPAL AVS+A +RV+E + GL V RD ++VAGHSLGEY+AL AA + S++DT RL+R R
Sbjct: 61  TQPALMAVSIAALRVLEAEAGLSVARDAAFVAGHSLGEYSALAAAGSLSIADTARLLRTR 120

Query: 120 GKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVK 179
           G +MQ+AVP G G+M A++GLD  V  ++  +A++  +CE ANDNGGGQ+V+SG + AV 
Sbjct: 121 GLAMQKAVPVGDGAMAALLGLDYEVAVAVADEAAQGQVCEAANDNGGGQIVVSGDKAAVD 180

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            A +    KGA+RA+ L VSAPFH  LM P +  M   L  VT   PV P++ N  A+PV
Sbjct: 181 RAVEIAKAKGARRAMLLAVSAPFHCRLMQPAADTMAEALARVTINKPVAPVVANVIAAPV 240

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
           S  D I +LLV+QVTG VRWRE++ + A  GV    EVG+GKVLTGL KRI K  + V++
Sbjct: 241 SDPDAIRKLLVKQVTGTVRWRESVAYMAAQGVTHFLEVGAGKVLTGLLKRIVKDAAGVAV 300

Query: 300 SKVED 304
               D
Sbjct: 301 GGPGD 305


>gi|261253411|ref|ZP_05945984.1| malonyl CoA-acyl carrier protein transacylase [Vibrio orientalis
           CIP 102891]
 gi|260936802|gb|EEX92791.1| malonyl CoA-acyl carrier protein transacylase [Vibrio orientalis
           CIP 102891]
          Length = 307

 Score =  195 bits (494), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 125/307 (40%), Positives = 177/307 (57%), Gaps = 3/307 (0%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
              + FPGQGSQV+GM  +L + +   +  F E    L  +L  L+ NG  E+L  T   
Sbjct: 3   KFAIVFPGQGSQVVGMLAELGEQYDVVKQTFAEASDALGYDLWALVQNGPAEDLNQTHRT 62

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPAL A S+A  RV ++ GL      + +AGHSLGEY+AL  A      + I+LV+ RG+
Sbjct: 63  QPALLASSVAIWRVWQELGL---EQPANLAGHSLGEYSALVCAGVIDFKEAIKLVQLRGE 119

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCA 181
            MQEAVP G G+M AIIGLDD  +   C +A++  +    N N  GQVVI+G +DAV+ A
Sbjct: 120 LMQEAVPAGTGAMFAIIGLDDESIAKACEEAAQGEVVSPVNFNSPGQVVIAGSKDAVERA 179

Query: 182 ADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSS 241
              C   GAKRA+ LPVS P H +LM P +  +   L+++    P +P++ N      + 
Sbjct: 180 GALCKEAGAKRALPLPVSVPSHCALMKPAADKLAVALEALEFNAPQLPVINNVDVVAETD 239

Query: 242 IDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISK 301
             +I   LV Q+   VRW E++Q  +  GV+ + E+G GKVLTGL KRI K+LS  +++ 
Sbjct: 240 PAKIKDALVRQLYSPVRWTESVQLMSEQGVEKLLELGPGKVLTGLTKRIVKTLSGAAVND 299

Query: 302 VEDIDLA 308
              +D A
Sbjct: 300 TASLDAA 306


>gi|88859594|ref|ZP_01134234.1| malonyl-CoA-[acyl-carrier-protein] transacylase [Pseudoalteromonas
           tunicata D2]
 gi|88818611|gb|EAR28426.1| malonyl-CoA-[acyl-carrier-protein] transacylase [Pseudoalteromonas
           tunicata D2]
          Length = 311

 Score =  195 bits (494), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 123/310 (39%), Positives = 170/310 (54%), Gaps = 3/310 (0%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
              + FPGQGSQ +GM  DL  S    +  F E    L  +L+ L+ NG +E L  T   
Sbjct: 4   KFAILFPGQGSQSVGMLADLLASSTVVQETFAEASAALGYDLAALVLNGPEESLNQTDKT 63

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPAL   S+A  R     G       + +AGHSLGEY+AL  A   SL D + LV  RG+
Sbjct: 64  QPALLTSSVAIYRHWLSQGGA---KPAVLAGHSLGEYSALVCAGVLSLGDAVVLVEKRGQ 120

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCA 181
            MQ AVP G GSM A+IGL D +V   C  A++  +    N N  GQVVI+G + AV+ A
Sbjct: 121 YMQLAVPAGTGSMAAVIGLADDLVAQACQSAAQGDVVAPVNFNSPGQVVIAGEKAAVERA 180

Query: 182 ADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSS 241
           +  C   GA+  + L VS P H +LM P ++ +   L+++      + ++ N   + V+ 
Sbjct: 181 SAACKEAGARMVMPLAVSVPSHCALMKPAAEKLANDLNAIDFNIADINVINNVDVATVTE 240

Query: 242 IDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISK 301
             ++   LV Q+   VRW ET+Q  A  G+ + YE G GKVL+GLAKRIDKS+S VS++ 
Sbjct: 241 QAQVKDALVRQLYSPVRWTETVQHIAALGITTTYEFGPGKVLSGLAKRIDKSVSCVSVND 300

Query: 302 VEDIDLALRS 311
           V  +  AL  
Sbjct: 301 VASVTAALAQ 310


>gi|323526871|ref|YP_004229024.1| malonyl CoA-acyl carrier protein transacylase [Burkholderia sp.
           CCGE1001]
 gi|323383873|gb|ADX55964.1| malonyl CoA-acyl carrier protein transacylase [Burkholderia sp.
           CCGE1001]
          Length = 311

 Score =  194 bits (493), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 136/312 (43%), Positives = 177/312 (56%), Gaps = 4/312 (1%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M     FPGQGSQ +GM     D  P  R   +E    LNQ+L  L+  G  E+L  T N
Sbjct: 1   MKFAFVFPGQGSQSVGMLNAFADQ-PIVRETVQEASDALNQDLGKLIAEGPAEDLNLTTN 59

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
            QP +   + A  R  ++ G       + VAGHSLGEYTAL AA A +  D + LVR R 
Sbjct: 60  TQPVMLTAAYAIYRAWQQAGG---PAPALVAGHSLGEYTALVAAGAIAFRDAVPLVRFRA 116

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           ++MQ AVP G G M AI+GLDD  V ++CA+AS  G+ E  N N   QVVI+G + AV+ 
Sbjct: 117 QAMQTAVPVGEGGMAAILGLDDDTVRAVCAEASAAGVVEAVNFNAPSQVVIAGHKAAVEK 176

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A +    KGAKRA+ LPVSAPFHSSL+ P S  ++  L SV  Q P +P++ N   + V+
Sbjct: 177 ACEVAKAKGAKRALPLPVSAPFHSSLLKPASDQLREYLASVHVQVPSIPVINNVDVAIVN 236

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
              +I   LV Q  G VRW E++Q  A  GV  V E G GKVL GL KRID +L   S+ 
Sbjct: 237 EPAQIKDALVRQAAGAVRWVESVQAMAAQGVTHVVECGPGKVLAGLTKRIDGNLIGASVF 296

Query: 301 KVEDIDLALRSI 312
               ++  L+ +
Sbjct: 297 DPASLEEMLKLL 308


>gi|119775116|ref|YP_927856.1| malonyl CoA-acyl carrier protein transacylase [Shewanella
           amazonensis SB2B]
 gi|119767616|gb|ABM00187.1| [Acyl-carrier-protein] S-malonyltransferase [Shewanella amazonensis
           SB2B]
          Length = 308

 Score =  194 bits (493), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 121/307 (39%), Positives = 166/307 (54%), Gaps = 3/307 (0%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
                FPGQGSQ +GM  DL   FP     F E    L  +L  L+ +G  E+L  T   
Sbjct: 3   KFAFVFPGQGSQAVGMLTDLAAEFPVVTETFAEASAALGYDLWALVQDGPAEQLNQTQKT 62

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPAL   S++  R  + +G       + +AGHSLGEY+AL  A     +D ++LV  RG+
Sbjct: 63  QPALLTASVSIWRAYQASGK---PQPAVLAGHSLGEYSALVCAGVIPFTDAVKLVELRGQ 119

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCA 181
            MQ AVP G G+M AIIGLD+  +   C +++   +    N N  GQVVI+G +DAV+ A
Sbjct: 120 LMQAAVPEGTGAMYAIIGLDNDAIAKACEESAEGEVVSPVNFNSPGQVVIAGNKDAVERA 179

Query: 182 ADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSS 241
           A  C   GAK AV LPVS P H SLM   +  +   L ++    P +P++ N      + 
Sbjct: 180 AAACKAAGAKMAVALPVSVPSHCSLMKGAADKLAEALAAIEFSAPAIPVINNVDVQAPTD 239

Query: 242 IDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISK 301
           +  I   LV Q+   VRW ET++  A  G+  + E G GKVLTGLAKRI+KS+SA +++ 
Sbjct: 240 VAAIRDALVRQLYCPVRWTETVEAMAADGITHLVECGPGKVLTGLAKRINKSVSAQAVND 299

Query: 302 VEDIDLA 308
           V      
Sbjct: 300 VASFAAL 306


>gi|83721554|ref|YP_442253.1| malonyl CoA-acyl carrier protein transacylase [Burkholderia
           thailandensis E264]
 gi|167581139|ref|ZP_02374013.1| malonyl CoA-acyl carrier protein transacylase [Burkholderia
           thailandensis TXDOH]
 gi|257138446|ref|ZP_05586708.1| malonyl CoA-acyl carrier protein transacylase [Burkholderia
           thailandensis E264]
 gi|83655379|gb|ABC39442.1| malonyl CoA-acyl carrier protein transacylase [Burkholderia
           thailandensis E264]
          Length = 309

 Score =  194 bits (493), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 131/313 (41%), Positives = 173/313 (55%), Gaps = 4/313 (1%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M     FPGQGSQ +GM     D     R   +E    L Q++  L+ +G  +EL  T N
Sbjct: 1   MKFAFVFPGQGSQSVGMLNAFAD-VAVVRETLDEASDALGQDIGKLIADGPADELNLTTN 59

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
            QP +   + A  R  ++ G       S VAGHSLGEYTAL AA A +  D + LVR R 
Sbjct: 60  TQPVMLTAAYACYRAWQQAGGA---QPSIVAGHSLGEYTALVAAGAIAFRDALPLVRFRA 116

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           ++MQ AVP G+G M AI+GLDD  V ++CA+AS  G+ E  N N   QVVI+G +  ++ 
Sbjct: 117 QAMQTAVPVGVGGMAAILGLDDDTVRAVCAEASAAGVVEAVNFNAPAQVVIAGTKAGIEM 176

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A +    KGAKRA+ LPVSAPFHSSL+ P S  ++  L +V  + P +P++ N   + VS
Sbjct: 177 ACEIAKAKGAKRALPLPVSAPFHSSLLKPASDKLRDYLANVDVKTPRIPVVNNIDVAVVS 236

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
               I   LV Q  G VRW E ++  A  G   V E G GKVL GL KRID +L   S+ 
Sbjct: 237 DPAAIKDALVRQAAGPVRWVECVRHIAREGATHVIECGPGKVLAGLTKRIDSNLVGASVF 296

Query: 301 KVEDIDLALRSIV 313
               +D AL+   
Sbjct: 297 DPASLDEALKLAA 309


>gi|228960068|ref|ZP_04121732.1| Malonyl CoA-acyl carrier protein transacylase [Bacillus
           thuringiensis serovar pakistani str. T13001]
 gi|228799584|gb|EEM46537.1| Malonyl CoA-acyl carrier protein transacylase [Bacillus
           thuringiensis serovar pakistani str. T13001]
          Length = 314

 Score =  194 bits (493), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 122/314 (38%), Positives = 182/314 (57%), Gaps = 5/314 (1%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
                FPGQGSQ +GMG+ L ++  E   VF + D  L  +LS++++ G QE+LT T NA
Sbjct: 3   KIAFLFPGQGSQAVGMGKQLAENNKEVAKVFAKADEVLKDSLSEVIFEGPQEKLTLTTNA 62

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPAL   S A +  +++  +       +VAGHSLGEY+AL AA A +  D +  VR RG+
Sbjct: 63  QPALLTTSFAILTALKEYDIT----PDFVAGHSLGEYSALVAAGALTFEDAVYAVRKRGE 118

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQAS-RVGICEIANDNGGGQVVISGLQDAVKC 180
            M+EAVP G G+M AI+G D  ++  +  + +      +IAN N   Q+VISG +  V+ 
Sbjct: 119 YMEEAVPGGEGAMAAILGADPHMLKQVTEEVTSEGYAVQIANMNSTKQIVISGTKQGVEV 178

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A+      GAKRA+ L VS PFHSSLM P ++  + +L+ +T  D  +P++ N  A  ++
Sbjct: 179 ASQRAKENGAKRAIPLKVSGPFHSSLMKPAAEKFQSVLNEITIHDTNIPVIANVTAEVIT 238

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
              +I   L+EQ+   V W  +I++  N GV +  E+G GKVL GL K ID S+ A +I 
Sbjct: 239 RGADIQENLIEQLYSPVLWYPSIEYMVNQGVDTFIEIGPGKVLAGLMKSIDSSVKAYAIY 298

Query: 301 KVEDIDLALRSIVG 314
             E +   + ++ G
Sbjct: 299 DEETLKDTISNLRG 312


>gi|121533807|ref|ZP_01665634.1| malonyl CoA-acyl carrier protein transacylase [Thermosinus
           carboxydivorans Nor1]
 gi|121307798|gb|EAX48713.1| malonyl CoA-acyl carrier protein transacylase [Thermosinus
           carboxydivorans Nor1]
          Length = 314

 Score =  194 bits (493), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 132/309 (42%), Positives = 185/309 (59%), Gaps = 5/309 (1%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
            T   FPGQGSQ +GMG++LYD+F  A+ VF+  D  L  ++++L +NG +EEL  T N 
Sbjct: 3   KTAFVFPGQGSQAVGMGKELYDAFSIAQTVFKTADEALGFSITELCFNGPEEELRKTYNT 62

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPA+  VS+A  +V+E+ G         VAGHSLGEY+AL AA A   +D ++LVR RG+
Sbjct: 63  QPAILTVSVACYKVLEEKG----LKPDIVAGHSLGEYSALVAAGAIDFADAVQLVRKRGQ 118

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQAS-RVGICEIANDNGGGQVVISGLQDAVKC 180
            MQEAVP G G M AI+GL+   V  +C Q   +VG  +  N N  GQ+VI+G   AV+ 
Sbjct: 119 YMQEAVPLGEGGMAAIMGLERDKVVEVCRQVQDQVGPVQAVNFNCPGQIVIAGRTAAVEK 178

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A +     GAKRAV LPVSAPFHS+LM P ++ +   L+ +T +D VVP++ N     V+
Sbjct: 179 AVEELKAVGAKRAVMLPVSAPFHSTLMQPAAEKLAIELEKITVRDAVVPVVANVNGQIVT 238

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
             + I   LV+Q    V W + +      G     EVG GKVLTG  K+I K +  +++ 
Sbjct: 239 KGETIKASLVQQAANPVLWEDCVAQIVRSGANVFVEVGPGKVLTGFTKKIAKDVVTLNVE 298

Query: 301 KVEDIDLAL 309
            +  ++ AL
Sbjct: 299 DLASLEKAL 307


>gi|183599492|ref|ZP_02960985.1| hypothetical protein PROSTU_02971 [Providencia stuartii ATCC 25827]
 gi|188021739|gb|EDU59779.1| hypothetical protein PROSTU_02971 [Providencia stuartii ATCC 25827]
          Length = 310

 Score =  194 bits (493), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 127/313 (40%), Positives = 174/313 (55%), Gaps = 4/313 (1%)

Query: 1   MS-TVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATC 59
           M+   + FPGQGSQ +GM   L    P     F E    L  +L  L+ NG +EEL  T 
Sbjct: 1   MTQFAMVFPGQGSQSLGMLSALAAESPLVEQTFAEASEALGYDLWALVQNGPEEELNKTW 60

Query: 60  NAQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRAR 119
             QPAL A S+A  RV ++         + +AGHSLGEY+AL  A        I+LV  R
Sbjct: 61  QTQPALLAASVAIFRVWQEK---KGAMPTMMAGHSLGEYSALVCAGVLDFKAAIKLVELR 117

Query: 120 GKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVK 179
           GK MQEAVP G G+M AIIGLD+  ++  C  A++  +    N N  GQVVI+G + AV+
Sbjct: 118 GKLMQEAVPEGTGAMYAIIGLDNESIEKACQDAAQGQVVSPVNFNSPGQVVIAGEKAAVE 177

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            A   C   GAKRA+ L VS P H +LM P ++ +   L  +T   P  P++ N      
Sbjct: 178 RAGAACKEAGAKRALPLSVSVPSHCALMKPAAEKLAVALQEITFNQPNFPVINNVDVKIE 237

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
            S + I   LV Q+   VRW ET+++ AN G++ + EVG GKVLTGL KRI  +L+AV++
Sbjct: 238 QSAENIRDALVRQLYNPVRWTETVEFMANQGIEHLVEVGPGKVLTGLTKRIVSNLTAVAV 297

Query: 300 SKVEDIDLALRSI 312
           +    +  AL ++
Sbjct: 298 NDPVSLGTALENL 310


>gi|262404377|ref|ZP_06080932.1| malonyl CoA-acyl carrier protein transacylase [Vibrio sp. RC586]
 gi|262349409|gb|EEY98547.1| malonyl CoA-acyl carrier protein transacylase [Vibrio sp. RC586]
          Length = 307

 Score =  194 bits (493), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 120/307 (39%), Positives = 171/307 (55%), Gaps = 3/307 (0%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
              + FPGQGSQ +GM  DL   +   +  F E    L  +L  L+ +G  E+L  T   
Sbjct: 3   KFAIVFPGQGSQAVGMLADLAQQYDVVKQTFAEASEVLGYDLWALVQDGPVEDLNQTFRT 62

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPAL A S+A  RV ++ GL      + +AGHSLGEY+AL  A        I+LV  RG+
Sbjct: 63  QPALLAASVAIWRVWQQLGL---EQPAVLAGHSLGEYSALVCAGVIDFKQAIKLVELRGQ 119

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCA 181
            MQ+AVP G G+M AIIGL+D  +   CA+A++  +    N N  GQVVI+G +DAV+ A
Sbjct: 120 LMQQAVPAGTGAMYAIIGLEDDAIAKACAEAAQGEVVSPVNFNSPGQVVIAGQKDAVERA 179

Query: 182 ADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSS 241
              C   GAKRA+ LPVS P H +LM P +  +   L  +    P +P++ N   +  + 
Sbjct: 180 GVLCKEAGAKRALPLPVSVPSHCALMKPAADELAKTLAELEFNAPQIPVINNVDVAAETD 239

Query: 242 IDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISK 301
             +I   L+ Q+   VRW E ++  +  GV+ + E+G GKVLTGL KRI K+L   +++ 
Sbjct: 240 PAKIKDALIRQLYSPVRWTECVEQMSAQGVEKLIEMGPGKVLTGLTKRIVKTLEGAAVND 299

Query: 302 VEDIDLA 308
           V  +D  
Sbjct: 300 VASLDAV 306


>gi|262170989|ref|ZP_06038667.1| malonyl CoA-acyl carrier protein transacylase [Vibrio mimicus
           MB-451]
 gi|261892065|gb|EEY38051.1| malonyl CoA-acyl carrier protein transacylase [Vibrio mimicus
           MB-451]
          Length = 307

 Score =  194 bits (493), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 121/307 (39%), Positives = 170/307 (55%), Gaps = 3/307 (0%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
              + FPGQGSQ +GM  DL   +   +  F E    L  +L  L+ +G  E+L  T   
Sbjct: 3   KFAIVFPGQGSQAVGMLADLAQQYDVVKQTFAEASEVLGYDLWALVQDGPVEDLNQTFRT 62

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPAL A S+A  RV ++ GL        +AGHSLGEY+AL  A        I+LV  RG+
Sbjct: 63  QPALLAASVAIWRVWQQLGL---EQPVVLAGHSLGEYSALVCAGVIDFKQAIKLVELRGQ 119

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCA 181
            MQ+AVP G G+M AIIGL+D  +   CA+A++  +    N N  GQVVI+G +DAV+ A
Sbjct: 120 LMQQAVPAGTGAMYAIIGLEDEAIAKACAEAAQGEVVSPVNFNSPGQVVIAGQKDAVERA 179

Query: 182 ADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSS 241
              C   GAKRA+ LPVS P H +LM P +  +   L  +    P +P++ N   +  + 
Sbjct: 180 GVLCKEAGAKRALPLPVSVPSHCALMKPAADELAKTLAELEFNTPQIPVINNVDVAAETD 239

Query: 242 IDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISK 301
             +I   LV Q+   VRW E ++  +  GV+ + E+G GKVLTGL KRI K+L   +++ 
Sbjct: 240 PAKIKEALVRQLYSPVRWTECVEQMSAQGVEKLIEMGPGKVLTGLTKRIVKTLEGAAVND 299

Query: 302 VEDIDLA 308
           V  +D  
Sbjct: 300 VASLDAV 306


>gi|95929575|ref|ZP_01312317.1| malonyl CoA-acyl carrier protein transacylase [Desulfuromonas
           acetoxidans DSM 684]
 gi|95134272|gb|EAT15929.1| malonyl CoA-acyl carrier protein transacylase [Desulfuromonas
           acetoxidans DSM 684]
          Length = 305

 Score =  194 bits (493), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 122/308 (39%), Positives = 186/308 (60%), Gaps = 3/308 (0%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M     FPGQG+Q  GMG++L ++F  AR VFEE +  L  +L+ + + G +E+L  T N
Sbjct: 1   MMLAFIFPGQGAQHAGMGKELSENFSVAREVFEEANDALGFDLAKMCYEGPEEDLKLTAN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
            QPA+  +S+A +RV+++          +VAGHSLGEY+AL A+   + +D +  VR RG
Sbjct: 61  TQPAILTMSVAALRVLQQESDL---QADFVAGHSLGEYSALVASGGMTFADAVCTVRQRG 117

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
             MQ+AVP G G+M A++G+D   ++ ICA+A+   I   AN N  GQ+VI+G   AV+ 
Sbjct: 118 TFMQQAVPVGEGAMAAVLGVDGETLEKICAEAAGDQIVSPANFNSPGQIVIAGHTAAVER 177

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A +     GAK+A+ LPVSAPFH +LM P  + +  +LD+VT     +P++ N  AS  S
Sbjct: 178 AIELAKENGAKKAMPLPVSAPFHCALMKPAGEQLAGVLDAVTLSALAIPVVTNVEASANS 237

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
            +  +  LLV QV+  VRW E++++    GV+   E+G GKVL GL KRI++ +   ++ 
Sbjct: 238 DMARVKSLLVSQVSAPVRWDESVRYMVEQGVERFIEIGPGKVLCGLIKRIERRMPVANVE 297

Query: 301 KVEDIDLA 308
            +  +   
Sbjct: 298 NLASLKAL 305


>gi|308186408|ref|YP_003930539.1| malonyl-CoA-[acyl-carrier-protein] transacylase [Pantoea vagans
           C9-1]
 gi|308056918|gb|ADO09090.1| malonyl-CoA-[acyl-carrier-protein] transacylase [Pantoea vagans
           C9-1]
          Length = 310

 Score =  194 bits (493), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 126/310 (40%), Positives = 174/310 (56%), Gaps = 4/310 (1%)

Query: 1   MS-TVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATC 59
           M+     FPGQGSQ +GM  +L  ++P     F E    L  +L  L+  G  EEL  T 
Sbjct: 1   MTQFAFVFPGQGSQTVGMLTELAATYPLVEETFREASDALGYDLWQLVSQGPAEELNKTW 60

Query: 60  NAQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRAR 119
             QPAL A S+A  RV ++ G         +AGHSLGEY+AL  A   + +D ++LV  R
Sbjct: 61  QTQPALLAASVAIYRVWQQQGG---EQPVLMAGHSLGEYSALVCAGVLNFADAVKLVELR 117

Query: 120 GKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVK 179
           GK MQEAVP G G+M AIIGLDD  +   C ++++  +    N N  GQVVI+G ++AV+
Sbjct: 118 GKLMQEAVPEGTGAMQAIIGLDDAAIRKACEESAQGQVVSPVNFNSPGQVVIAGNKEAVE 177

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            A   C   GAKRA+ LPVS P H +LM P +  +   L+S+T   P VP++ N      
Sbjct: 178 RAGAACKAAGAKRALPLPVSVPSHCALMKPAADKLAVALESITFNAPAVPVINNVDVKAE 237

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
           +    I   LV Q+   VRW E+++  A  GV  + E+G GKVLTGL KRI  +L+A ++
Sbjct: 238 TDAAAIRHALVRQLYSPVRWTESVEAMAAQGVTQLLEMGPGKVLTGLTKRIVDTLTAAAV 297

Query: 300 SKVEDIDLAL 309
           +    +  AL
Sbjct: 298 NDTASLAAAL 307


>gi|296532307|ref|ZP_06895046.1| malonyl-CoA-[acyl-carrier-protein] transacylase [Roseomonas
           cervicalis ATCC 49957]
 gi|296267383|gb|EFH13269.1| malonyl-CoA-[acyl-carrier-protein] transacylase [Roseomonas
           cervicalis ATCC 49957]
          Length = 318

 Score =  194 bits (493), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 151/318 (47%), Positives = 202/318 (63%), Gaps = 6/318 (1%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           MS    FPGQGSQ +GMGR+L ++F  AR VFE VD TL QNLS LM+ G  EELT T N
Sbjct: 1   MSIAFVFPGQGSQAVGMGRELAEAFAPAREVFEAVDETLKQNLSRLMFEGPIEELTLTAN 60

Query: 61  AQPALTAVSMAFIRVME-KNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRAR 119
           AQPAL A+S+A +RV+E + G  +K  ++ VAGHSLGEY+AL AA++F ++   RL+R R
Sbjct: 61  AQPALMAMSLAVMRVLEQEGGFDLKAKVAVVAGHSLGEYSALAAAQSFDVATAARLLRLR 120

Query: 120 GKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGI-----CEIANDNGGGQVVISGL 174
           G++MQ+AVP G G+M A++G +      IC +A+          E ANDNGGGQVVISG 
Sbjct: 121 GEAMQKAVPAGQGAMAALLGAEMAQAQEICERAALTPEGGQEVVEAANDNGGGQVVISGH 180

Query: 175 QDAVKCAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNF 234
           + AV+ A       G KRA+ LPVSAPFH +LM P +  M   L     + P+VP++ N 
Sbjct: 181 RAAVERAVALAKEAGIKRAMLLPVSAPFHCALMAPAADAMAEALALAELRPPLVPVVANV 240

Query: 235 CASPVSSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSL 294
            A+  +   EI  LLV QVTG VRWRE I      G +   E+G+GKVL+GL KR+    
Sbjct: 241 TAAKATDPTEIRELLVRQVTGTVRWRECIGTMRALGCERFIEIGAGKVLSGLMKRLAPEA 300

Query: 295 SAVSISKVEDIDLALRSI 312
            A+S+    +I+  L+++
Sbjct: 301 QAMSVGSPAEIEAFLKTL 318


>gi|295677188|ref|YP_003605712.1| malonyl CoA-acyl carrier protein transacylase [Burkholderia sp.
           CCGE1002]
 gi|295437031|gb|ADG16201.1| malonyl CoA-acyl carrier protein transacylase [Burkholderia sp.
           CCGE1002]
          Length = 311

 Score =  194 bits (493), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 136/310 (43%), Positives = 175/310 (56%), Gaps = 4/310 (1%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M     FPGQGSQ +GM     D     R   +E    LNQ+L  L+  G  E+L  T N
Sbjct: 1   MKFAFVFPGQGSQAVGMLNAFAD-HAVVRETVQEASDALNQDLGKLIAEGPAEDLNLTTN 59

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
            QP +   + A  R  ++ G    R  + VAGHSLGEYTAL AA A +  D + LVR R 
Sbjct: 60  TQPVMLTAAYAVYRAWQQAGG---RTPAIVAGHSLGEYTALVAAGALAFRDAVPLVRFRA 116

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           ++MQ AVP G G M AI+GLDD  V ++CA+AS  G+ E  N N   QVVI+G + AV+ 
Sbjct: 117 QAMQTAVPVGEGGMAAILGLDDDTVRAVCAEASVAGVVEAVNFNAPAQVVIAGHKAAVEK 176

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A +    KGAKRA+ LPVSAPFHSSL+ P S  ++  L S+  Q P +P++ N   + V+
Sbjct: 177 ACEVAKAKGAKRALSLPVSAPFHSSLLKPASDQLREYLASIDVQVPSIPVINNVDVAVVN 236

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
              +I   LV Q  G VRW E +Q  A  GV  V E G GKVL GL KRID SL   S+ 
Sbjct: 237 EPAKIKDALVRQAAGPVRWVECVQAMAAQGVTHVIECGPGKVLAGLTKRIDGSLVGTSVF 296

Query: 301 KVEDIDLALR 310
               ++  L+
Sbjct: 297 DPASLEETLK 306


>gi|291288900|ref|YP_003505716.1| malonyl CoA-acyl carrier protein transacylase [Denitrovibrio
           acetiphilus DSM 12809]
 gi|290886060|gb|ADD69760.1| malonyl CoA-acyl carrier protein transacylase [Denitrovibrio
           acetiphilus DSM 12809]
          Length = 306

 Score =  194 bits (493), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 117/307 (38%), Positives = 180/307 (58%), Gaps = 6/307 (1%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
            T + FPGQG+Q +GMG+D Y+     + +F++ D +L   L+++M++G +++L  T N 
Sbjct: 3   KTAVVFPGQGAQFVGMGKDFYEKHESVKQIFDKADESLGYGLTEIMFDGPEDDLKLTSNT 62

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPAL  +S+A   +++           + AGHSLGEY+A+ AA   S  + ++ V  RG+
Sbjct: 63  QPALLTMSIAIWDILKSRVHAD-----FFAGHSLGEYSAVVAAGGLSFEEGVKAVHNRGR 117

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCA 181
            MQ AVP G+G+M A++G  D  + ++C + S   ICE AN N  GQVV++G  +AV+  
Sbjct: 118 FMQSAVPVGVGAMAAVMGAADEDIVAVCKEVSGDRICEPANFNCPGQVVVAGHTEAVEEF 177

Query: 182 ADTCLNKGAKRAVFLPVSAPFHSSLMTP-VSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
                 KGAKRA+ LPVSAPFH SLM P    +  ++ +    ++   P+  N  A    
Sbjct: 178 CVKIKEKGAKRAMLLPVSAPFHCSLMKPARQDMAAYLKNETIIKNLSTPVYNNVDAKVEH 237

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
           + +E+   L  QV G V W E I+   N GV    EVG+GKVL+GL K+IDK+++  +IS
Sbjct: 238 TGEEVYDALCRQVDGAVMWTELIRNMINDGVDRFIEVGAGKVLSGLIKKIDKTVAIENIS 297

Query: 301 KVEDIDL 307
              D++ 
Sbjct: 298 TASDLEK 304


>gi|148263933|ref|YP_001230639.1| malonyl CoA-acyl carrier protein transacylase [Geobacter
           uraniireducens Rf4]
 gi|146397433|gb|ABQ26066.1| [Acyl-carrier-protein] S-malonyltransferase [Geobacter
           uraniireducens Rf4]
          Length = 311

 Score =  194 bits (492), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 128/310 (41%), Positives = 184/310 (59%), Gaps = 3/310 (0%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
                FPGQGSQ  GMG+DL D+F  A  VF E D  L   LS L + G +E+L  T N 
Sbjct: 3   KKAFIFPGQGSQYAGMGKDLADNFKAAAHVFAEADDALGFKLSKLCFEGPEEDLKLTANT 62

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPA+  VS+A +RV+++          ++AGHSLGEY+AL AA A   +D +R VRARG 
Sbjct: 63  QPAILTVSIAALRVLQE---ETSLTADFLAGHSLGEYSALVAAGAMQFADAVRTVRARGT 119

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCA 181
            MQEAVP G+GSM AI+G++  ++  ICA+A++  +   AN N  GQ+V++G   AV  A
Sbjct: 120 FMQEAVPVGVGSMAAILGVEADILAQICAEAAQGEVVSPANFNSPGQIVVAGHSGAVNRA 179

Query: 182 ADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSS 241
            +    +G ++A+ LPVSAPFHSSLM P    +  +L+++       P++ N  A   S 
Sbjct: 180 IEIAKARGFRKAMLLPVSAPFHSSLMEPAGARLAGVLEAIEISSLQAPVVSNVEAKANSD 239

Query: 242 IDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISK 301
           +  +  LLV+QV+  V W  ++Q  A  GV +  E+G GKVL GL KRIDK+    ++  
Sbjct: 240 MKRVKELLVKQVSAPVLWDASVQEMAACGVTAFVEIGPGKVLAGLVKRIDKTAETRNVQD 299

Query: 302 VEDIDLALRS 311
           V+ +   ++ 
Sbjct: 300 VDSLKALVQE 309


>gi|262166126|ref|ZP_06033863.1| malonyl CoA-acyl carrier protein transacylase [Vibrio mimicus
           VM223]
 gi|262025842|gb|EEY44510.1| malonyl CoA-acyl carrier protein transacylase [Vibrio mimicus
           VM223]
          Length = 307

 Score =  194 bits (492), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 121/307 (39%), Positives = 171/307 (55%), Gaps = 3/307 (0%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
              + FPGQGSQ +GM  DL   +   +  F E    L  +L  L+ +G  E+L  T   
Sbjct: 3   KFAIVFPGQGSQAVGMLADLAQQYDVVKQTFAEASEVLGYDLWALVQDGPVEDLNQTFRT 62

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPAL A S+A  RV ++ GL      + +AGHSLGEY+AL  A        I+LV  RG+
Sbjct: 63  QPALLAASVAIWRVWQQLGL---EQPAVLAGHSLGEYSALVCAGVIDFKQAIKLVELRGQ 119

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCA 181
            MQ+AVP G G+M AIIGL+D  +   CA+A++  +    N N  GQVVI+G +DAV+ A
Sbjct: 120 LMQQAVPAGTGAMYAIIGLEDEAIAKACAEAAQGEVVSPVNFNSPGQVVIAGQKDAVERA 179

Query: 182 ADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSS 241
              C   GAKRA+ LPVS P H +LM P +  +   L  +    P +P++ N   +  + 
Sbjct: 180 GVLCKEAGAKRALPLPVSVPSHCALMKPAADELAKTLAELEFNTPQIPVINNVDVAAETD 239

Query: 242 IDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISK 301
             +I   LV Q+   VRW E ++  +  GV+ + E+G GKVLTGL KRI K+L   +++ 
Sbjct: 240 PAKIKEALVRQLYSPVRWTECVEQMSAQGVEKLIEMGPGKVLTGLTKRIVKTLEGAAVND 299

Query: 302 VEDIDLA 308
           V  +D  
Sbjct: 300 VASLDAV 306


>gi|212712804|ref|ZP_03320932.1| hypothetical protein PROVALCAL_03901 [Providencia alcalifaciens DSM
           30120]
 gi|212684496|gb|EEB44024.1| hypothetical protein PROVALCAL_03901 [Providencia alcalifaciens DSM
           30120]
          Length = 310

 Score =  194 bits (492), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 123/313 (39%), Positives = 176/313 (56%), Gaps = 4/313 (1%)

Query: 1   MS-TVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATC 59
           M+   + FPGQGSQ +GM   L +     +  F E    L  +L  L+ NG +EEL  T 
Sbjct: 1   MTQFAMVFPGQGSQSLGMLAGLAEQNQLVKDTFAEASEALGYDLWTLVQNGPEEELNKTW 60

Query: 60  NAQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRAR 119
             QPAL A S+A  RV ++      +  + +AGHSLGEY+AL  A        I+LV  R
Sbjct: 61  QTQPALLAASVAIFRVWQEK---NGKMPALMAGHSLGEYSALVCAGVIDFKQAIKLVELR 117

Query: 120 GKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVK 179
           G+ MQ+AVP G G+M AIIGLD+  ++  C  A++  +    N N  GQVVI+G + AV+
Sbjct: 118 GRLMQDAVPEGTGAMYAIIGLDNESIEKACQDAAQGQVVSPVNFNSPGQVVIAGEKAAVE 177

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            A   C   GAKRA+ L VS P H +LM P +  +   L+ +   +P  P++ N      
Sbjct: 178 RAGAACKEAGAKRALPLSVSVPSHCALMKPAADKLADALEKIEFCEPTYPVINNVDVKME 237

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
           +S   I   LV Q+   VRW ET+++ A  G++ + E+G GKVLTGL KRI  +L+AV++
Sbjct: 238 TSAKNIRDALVRQLYNPVRWTETVEFMAEQGIEQLVEMGPGKVLTGLTKRIVSNLTAVAV 297

Query: 300 SKVEDIDLALRSI 312
           +    +D AL +I
Sbjct: 298 NDPVSLDSALETI 310


>gi|299133699|ref|ZP_07026893.1| malonyl CoA-acyl carrier protein transacylase [Afipia sp. 1NLS2]
 gi|298591535|gb|EFI51736.1| malonyl CoA-acyl carrier protein transacylase [Afipia sp. 1NLS2]
          Length = 318

 Score =  194 bits (492), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 157/306 (51%), Positives = 208/306 (67%), Gaps = 1/306 (0%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M+   TFPGQGSQ +GMG+ L ++FP AR VF+EVD  L Q LS ++W G  E L  T N
Sbjct: 1   MTAAFTFPGQGSQAVGMGKALAEAFPAARAVFDEVDSALGQKLSTVIWEGPAEALQLTEN 60

Query: 61  AQPALTAVSMAFIRVME-KNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRAR 119
            QPAL A+S+A +RV+E + G+ + RD ++VAGHSLGEY+AL AA + S++DT RL+R R
Sbjct: 61  TQPALMAMSLATLRVLEAEAGIDLARDAAFVAGHSLGEYSALAAAGSLSIADTARLLRIR 120

Query: 120 GKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVK 179
           G +MQ+A P G+G+M A++GLD     +   +A++  +C+ ANDNGGGQVV+SG + AV+
Sbjct: 121 GTAMQKATPVGVGAMAALLGLDYETAVAAADEAAQGQVCQAANDNGGGQVVVSGDKAAVE 180

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            A +    KGAKRA+ L VSAPFH  LM P +  M   L  VT   PVVP++ N  A PV
Sbjct: 181 RAVEIAKAKGAKRAMLLQVSAPFHCRLMQPAADAMAEALAKVTVNKPVVPVVANILAGPV 240

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
           +  D+I +LLVEQVTG VRWRE++ + A HGV    E+GSGKVLTGL KRI      V++
Sbjct: 241 TDPDQIRKLLVEQVTGTVRWRESVAYMAAHGVTHFLEIGSGKVLTGLVKRIADGAVGVAV 300

Query: 300 SKVEDI 305
               DI
Sbjct: 301 GGPGDI 306


>gi|323142419|ref|ZP_08077245.1| [acyl-carrier-protein] S-malonyltransferase [Phascolarctobacterium
           sp. YIT 12067]
 gi|322413112|gb|EFY04005.1| [acyl-carrier-protein] S-malonyltransferase [Phascolarctobacterium
           sp. YIT 12067]
          Length = 313

 Score =  194 bits (492), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 116/313 (37%), Positives = 168/313 (53%), Gaps = 6/313 (1%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
                FPGQGSQ +GM +  YD +P  + +FEE D  L  ++S + + G  E+L  T N 
Sbjct: 3   KIAFVFPGQGSQTVGMCKAFYDEYPVVKQIFEEADDALGYSISKMCFEGPAEDLKLTANT 62

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPA+   S A   V++++G+         AGHSLGEY+AL    A   +D +R+V  RG+
Sbjct: 63  QPAILTASTACAAVLKEHGVS----CDIAAGHSLGEYSALVNTGALKFADAVRIVNKRGQ 118

Query: 122 SMQEAVPPGL--GSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVK 179
            MQEAVP G    + +  +  D  V      +A      +  N N  GQVVI+G  + V 
Sbjct: 119 FMQEAVPVGEGSMAAILGLDSDKIVEICRSVEAESGEAVQAVNFNCPGQVVIAGAVNPVN 178

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            A +     GAKRAV LPVSAPFHS+LM P +  +  +L  +  +D  VP++ N  A  V
Sbjct: 179 KAIEALKAAGAKRAVLLPVSAPFHSTLMQPAADRLAEVLAPIEIKDITVPVVANVTAQEV 238

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
           +S +EI +LLV+Q    V W  +++     GV    EVG GKVLTG  K+I K + A+++
Sbjct: 239 TSGEEIKKLLVKQAAMPVLWETSVRNMVAGGVDIFVEVGPGKVLTGFTKKIAKGMMALNV 298

Query: 300 SKVEDIDLALRSI 312
                ++  L  +
Sbjct: 299 EDAASLEKTLAEL 311


>gi|167586619|ref|ZP_02379007.1| malonyl CoA-acyl carrier protein transacylase [Burkholderia
           ubonensis Bu]
          Length = 310

 Score =  194 bits (492), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 137/310 (44%), Positives = 176/310 (56%), Gaps = 4/310 (1%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M     FPGQGSQ +GM     D     R   +E    LNQ+L  L+  G  EEL  T N
Sbjct: 1   MKFAFVFPGQGSQSVGMLNAFAD-LAVVRETLQEASDALNQDLGKLIAEGPAEELNLTTN 59

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
            QP +   + A  R  ++ G       S VAGHSLGEYTAL AA A +  D + LVR R 
Sbjct: 60  TQPVMLTAAYACYRAWQEAGG---PAPSIVAGHSLGEYTALVAAGAIAFKDAVPLVRFRA 116

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           ++MQ AVP G G M AI+GLDD  V ++CA+A+  G+ E  N N   QVVI+G + AV+ 
Sbjct: 117 QAMQTAVPVGQGGMAAILGLDDDTVRAVCAEAAEAGVVEAVNFNAPAQVVIAGNKAAVEK 176

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A +    KGAKRA+ LPVSAPFHSSL+TP S  ++  L +V  + P +P++ N   + VS
Sbjct: 177 ACEIAKAKGAKRALPLPVSAPFHSSLLTPASDQLRDYLATVDVKAPQIPVVNNIDVAVVS 236

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
               I   LV Q  G VRW E ++  A  GV  V E G GKVL GL KRID +L+  S+ 
Sbjct: 237 DPAAIKDALVRQAAGPVRWVECVRHIAGTGVTHVIECGPGKVLAGLTKRIDANLTGASVF 296

Query: 301 KVEDIDLALR 310
               +D AL+
Sbjct: 297 DPASLDEALK 306


>gi|126440256|ref|YP_001059812.1| malonyl CoA-acyl carrier protein transacylase [Burkholderia
           pseudomallei 668]
 gi|126219749|gb|ABN83255.1| [acyl-carrier-protein] S-malonyltransferase [Burkholderia
           pseudomallei 668]
          Length = 310

 Score =  194 bits (492), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 132/313 (42%), Positives = 173/313 (55%), Gaps = 4/313 (1%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M+    FPGQGSQ +GM     D     R   +E    L Q++  L+ +G  +EL  T N
Sbjct: 1   MTFAFVFPGQGSQSVGMLNAFAD-VAVVRETLDEASDALGQDIGKLIADGPADELNLTTN 59

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
            QP +   + A  R  ++ G       S VAGHSLGEYTAL AA A +  D + LVR R 
Sbjct: 60  TQPVMLTAAYACYRAWQQAGGA---QPSIVAGHSLGEYTALVAAGAIAFRDALPLVRFRA 116

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           ++MQ AVP G+G M AI+GLDD  V ++CA+AS  G+ E  N N   QVVI+G +  ++ 
Sbjct: 117 QAMQTAVPVGVGGMAAILGLDDDTVRAVCAEASATGVVEAVNFNAPAQVVIAGTKAGIEK 176

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A +    KGAKRA+ LPVSAPFHSSL+ P S  ++  L  V  + P + ++ N   + VS
Sbjct: 177 ACEIAKEKGAKRALPLPVSAPFHSSLLKPASDKLREYLAGVDVKAPKISVVNNIDVAVVS 236

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
               I   LV Q  G VRW E +Q  A  GV  V E G GKVL GL KRID +L   S+ 
Sbjct: 237 DPAAIKDALVRQAAGPVRWVECVQHIAREGVTHVIECGPGKVLAGLTKRIDGNLVGASVF 296

Query: 301 KVEDIDLALRSIV 313
               +D AL+   
Sbjct: 297 DPASLDEALKLAA 309


>gi|322420574|ref|YP_004199797.1| malonyl CoA-acyl carrier protein transacylase [Geobacter sp. M18]
 gi|320126961|gb|ADW14521.1| malonyl CoA-acyl carrier protein transacylase [Geobacter sp. M18]
          Length = 310

 Score =  194 bits (492), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 128/312 (41%), Positives = 183/312 (58%), Gaps = 4/312 (1%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
           S    FPGQGSQ  GMG+DL D+F  A++ FEE D  L  +LS L + G +E+L  T N 
Sbjct: 3   SYAFIFPGQGSQHAGMGKDLADNFKAAKIAFEEADDALGFSLSRLCFEGPEEDLKLTANT 62

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPA+ A S+A +RV+ +         S++AGHSLGEY+AL A+ A   +D +R VRARG 
Sbjct: 63  QPAILAASVAALRVLREESPIT---PSFLAGHSLGEYSALVASGALDFADALRTVRARGS 119

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCA 181
            MQ+AVP G+G+M AI+G +  ++  ICA+A++  +   AN N  GQ+V++G   AV  A
Sbjct: 120 YMQDAVPVGIGAMAAILGAEADLLKEICAEAAQGEVVSPANFNSPGQIVVAGHTGAVNRA 179

Query: 182 ADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSS 241
            +    KG ++A+ LPVSAPFH +LM P +  +   L+ +T      P++ N  A P S 
Sbjct: 180 IEIAKAKGLRKAMLLPVSAPFHCALMKPAADRLARTLEPLTVNPLAAPVVSNVEAKPNSD 239

Query: 242 IDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISK 301
              +  LL+EQV   V W + IQ     GV +  E+G GKVL GL KRIDK  +  ++  
Sbjct: 240 AARVKPLLIEQVCAPVLWEQIIQNIVAQGVTNFVEIGPGKVLAGLVKRIDKEAACCNVQD 299

Query: 302 VEDIDLALRSIV 313
              +  A+  + 
Sbjct: 300 AAGV-KAITEVA 310


>gi|92117877|ref|YP_577606.1| malonyl CoA-acyl carrier protein transacylase [Nitrobacter
           hamburgensis X14]
 gi|91800771|gb|ABE63146.1| [Acyl-carrier-protein] S-malonyltransferase [Nitrobacter
           hamburgensis X14]
          Length = 319

 Score =  194 bits (492), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 153/306 (50%), Positives = 210/306 (68%), Gaps = 1/306 (0%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M+   TFPGQGSQ +GMG+ L D+FP A+ VF+EVD  L + L+ ++W G  E L  T N
Sbjct: 1   MTAAFTFPGQGSQTVGMGKALADAFPVAKAVFDEVDAALGEKLTAIIWGGPAETLQLTEN 60

Query: 61  AQPALTAVSMAFIRVME-KNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRAR 119
           AQPAL AVS+A +RV+E + G  V RD ++VAGHSLGEY+AL AA + S++DT RL+R R
Sbjct: 61  AQPALMAVSIATLRVLEVEAGFSVARDAAFVAGHSLGEYSALAAAGSLSIADTARLLRTR 120

Query: 120 GKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVK 179
           G +MQ+AVP G+G+M A++GLD     ++  +A++  +C+ ANDNGGGQVV+SG + AV 
Sbjct: 121 GLAMQKAVPVGVGAMAALLGLDYETAVAVADEAAQGQVCQAANDNGGGQVVVSGDKAAVD 180

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            A +    +GA+RA+ LPVSAPFH  LM P +  M   L +VT   P  P++ N  A+P+
Sbjct: 181 RAVEIAKTRGARRAMLLPVSAPFHCKLMQPAADAMAKALANVTINTPAAPVVSNVLAAPI 240

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
           +  DEI R L+EQVTG VRWRE++ + A HGV   +E+G+GKVL+GL KRI      V++
Sbjct: 241 TDPDEIRRRLIEQVTGTVRWRESVAYMAGHGVTRFFEIGAGKVLSGLVKRIADGAIGVAV 300

Query: 300 SKVEDI 305
               DI
Sbjct: 301 GGPNDI 306


>gi|330446416|ref|ZP_08310068.1| malonyl CoA-acyl carrier protein transacylase [Photobacterium
           leiognathi subsp. mandapamensis svers.1.1.]
 gi|328490607|dbj|GAA04565.1| malonyl CoA-acyl carrier protein transacylase [Photobacterium
           leiognathi subsp. mandapamensis svers.1.1.]
          Length = 309

 Score =  194 bits (492), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 121/309 (39%), Positives = 177/309 (57%), Gaps = 3/309 (0%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
              + FPGQGSQ +GM  +L + F   +  F E    L  +L  L+ NG  E+L  T   
Sbjct: 3   KFAIVFPGQGSQTVGMLAELAEQFDVVKETFSEASDALGYDLWALVQNGPVEDLNQTQRT 62

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPAL   S+A  RV ++ G       + +AGHSLGEY+AL  A        ++LV  RG+
Sbjct: 63  QPALLTASVAIWRVWQQQGG---EQPTVLAGHSLGEYSALVCAGVIDFKAAVKLVELRGQ 119

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCA 181
            MQEAVP G+G+M AIIGLD+  +   C +A++  +C   N N  GQVVI+G ++AV+ A
Sbjct: 120 LMQEAVPAGVGAMSAIIGLDNDAIAKACEEAAQGEVCSPVNFNSPGQVVIAGNKEAVERA 179

Query: 182 ADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSS 241
              C   GAKRA+ LPVS P H +LM P +  +   L+S+    P VP++ N   +  + 
Sbjct: 180 NVLCKEAGAKRALPLPVSVPSHCALMKPAADKLAVALESIEFNAPSVPVINNADVATETD 239

Query: 242 IDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISK 301
              I   LV+Q+   VRW E+++  A  G++ + E+G GKVLTGL KRID++L   +++ 
Sbjct: 240 PAAIKLALVKQLYSPVRWTESVERMAAEGIEELLEMGPGKVLTGLTKRIDRALGGAAVND 299

Query: 302 VEDIDLALR 310
           V  ++ A+ 
Sbjct: 300 VASLEAAIA 308


>gi|187777414|ref|ZP_02993887.1| hypothetical protein CLOSPO_00981 [Clostridium sporogenes ATCC
           15579]
 gi|187774342|gb|EDU38144.1| hypothetical protein CLOSPO_00981 [Clostridium sporogenes ATCC
           15579]
          Length = 314

 Score =  194 bits (492), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 112/312 (35%), Positives = 172/312 (55%), Gaps = 4/312 (1%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
                F GQG+Q +GMG++LY++ PE R +F   +  L   L+ + + G ++E+  T N 
Sbjct: 3   KIAFIFSGQGAQYVGMGKELYENIPECRKIFHIAEEELQIPLTKICFQGPKDEIDKTENT 62

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPA+   S+A ++ +EK G+         AG SLGEY+AL  +K     + + LVR RG+
Sbjct: 63  QPAILTFSIAAMKALEKYGI----KPDVTAGLSLGEYSALVCSKVIDFKEAVSLVRKRGQ 118

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCA 181
            M+ AVP G+G+M AIIGL    V  IC     VGI EIAN N  GQ+VISG  +AV+ A
Sbjct: 119 YMEHAVPSGVGTMAAIIGLKKEKVKEICDSLKEVGIVEIANINCPGQIVISGKINAVEKA 178

Query: 182 ADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSS 241
            +    K A + V L VS PFHSS++    + +   L  +  +   VP + N     V +
Sbjct: 179 CEIAKEKRALKCVNLSVSGPFHSSMLKEAGENLYEELQKIQFKSIEVPFITNVTGDFVKN 238

Query: 242 IDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISK 301
             EI  LL +QV   V W + I+   + GV +  E+G  KVL+G  K+ID+ ++ +++  
Sbjct: 239 TSEIKDLLKKQVMSTVLWEDCIKTMIDFGVDTFIEIGPSKVLSGFVKKIDRKVNILNVED 298

Query: 302 VEDIDLALRSIV 313
           +E ++  +  + 
Sbjct: 299 IESLNKTIEKLK 310


>gi|154247045|ref|YP_001418003.1| malonyl CoA-acyl carrier protein transacylase [Xanthobacter
           autotrophicus Py2]
 gi|154161130|gb|ABS68346.1| malonyl CoA-acyl carrier protein transacylase [Xanthobacter
           autotrophicus Py2]
          Length = 328

 Score =  194 bits (492), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 159/304 (52%), Positives = 214/304 (70%), Gaps = 1/304 (0%)

Query: 3   TVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQ 62
           T   FPGQGSQ +GMG+ L D+FP A+ VF+EVD  LN++L+ +MW+G  + LT T NAQ
Sbjct: 11  TAFIFPGQGSQAVGMGKALADNFPAAKAVFDEVDAALNESLTQVMWDGPIDALTLTANAQ 70

Query: 63  PALTAVSMAFIRVME-KNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           PAL AVS+A +RV+E + GL + R+ ++VAGHSLGEY+AL AA A ++++  RL+R RG+
Sbjct: 71  PALMAVSLAALRVLETEAGLDLAREAAFVAGHSLGEYSALAAAGALTITEAARLLRIRGR 130

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCA 181
           +MQEAVP G G+M A++GLD     ++ A+A+   +CE ANDN  GQVV+SG + AV+ A
Sbjct: 131 AMQEAVPVGEGAMAALLGLDYDQAVAVAAEAAGDDVCEAANDNAPGQVVVSGTKAAVERA 190

Query: 182 ADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSS 241
                 KGA +A+ LPVSAPFH  LM P ++ M+  L   T   P VP++ N  ASPV+ 
Sbjct: 191 IVIAKEKGAMKALLLPVSAPFHCRLMGPAAEAMEVALSGSTVMTPRVPLVANVRASPVTD 250

Query: 242 IDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISK 301
             EI RLLVEQVTG VRWRE++ + A  GV  + EVG+GKVL GL KRIDKS+SA ++  
Sbjct: 251 PAEIVRLLVEQVTGTVRWRESVIYMAGAGVTRMVEVGAGKVLCGLVKRIDKSVSASAVGT 310

Query: 302 VEDI 305
            ED+
Sbjct: 311 PEDV 314


>gi|258625447|ref|ZP_05720340.1| acyl carrier protein S-malonyltransferase [Vibrio mimicus VM603]
 gi|258582251|gb|EEW07107.1| acyl carrier protein S-malonyltransferase [Vibrio mimicus VM603]
          Length = 312

 Score =  194 bits (492), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 121/307 (39%), Positives = 171/307 (55%), Gaps = 3/307 (0%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
              + FPGQGSQ +GM  DL   +   +  F E    L  +L  L+ +G  E+L  T   
Sbjct: 8   KFAIVFPGQGSQAVGMLADLAQQYDVVKQTFAEASEVLGYDLWALVQDGPVEDLNQTFRT 67

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPAL A S+A  RV ++ GL      + +AGHSLGEY+AL  A        I+LV  RG+
Sbjct: 68  QPALLAASVAIWRVWQQLGL---EQPAVLAGHSLGEYSALVCAGVIDFKQAIKLVELRGQ 124

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCA 181
            MQ+AVP G G+M AIIGL+D  +   CA+A++  +    N N  GQVVI+G +DAV+ A
Sbjct: 125 LMQQAVPAGTGAMYAIIGLEDEAIAKACAEAAQGEVVSPVNFNSPGQVVIAGQKDAVERA 184

Query: 182 ADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSS 241
              C   GAKRA+ LPVS P H +LM P +  +   L  +    P +P++ N   +  + 
Sbjct: 185 GVLCKEAGAKRALPLPVSVPSHCALMKPAADELAKTLAELEFNAPQIPVINNVDVAAETD 244

Query: 242 IDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISK 301
             +I   LV Q+   VRW E ++  +  GV+ + E+G GKVLTGL KRI K+L   +++ 
Sbjct: 245 PAKIKEALVRQLYSPVRWTECVEQMSAQGVEKLIEMGPGKVLTGLTKRIVKTLEGAAVND 304

Query: 302 VEDIDLA 308
           V  +D  
Sbjct: 305 VASLDAV 311


>gi|89094376|ref|ZP_01167317.1| acyl carrier protein S-malonyltransferase [Oceanospirillum sp.
           MED92]
 gi|89081435|gb|EAR60666.1| acyl carrier protein S-malonyltransferase [Oceanospirillum sp.
           MED92]
          Length = 309

 Score =  194 bits (492), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 118/308 (38%), Positives = 173/308 (56%), Gaps = 3/308 (0%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
           S    FPGQGSQ +GM  +L  S P     F E    L  +L  L+ NG +E+L  T   
Sbjct: 4   SLAFVFPGQGSQQVGMLSELASSHPVIEATFAEASEVLGYDLWALVQNGPEEDLNQTDKT 63

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPAL    +A  R+ ++ G       S VAGHSLGEYTAL  A A   SD + LV+ RG+
Sbjct: 64  QPALLTAGVALWRLWQEQG---GEMPSVVAGHSLGEYTALVCAGAIKFSDGVSLVKLRGE 120

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCA 181
            MQ+AVP G G+M AI+GL D  ++  C  A +  +    N N  GQ+VI+G ++AV+ A
Sbjct: 121 FMQQAVPAGTGAMAAILGLADDAIEKACKDAEQGQVVSPVNYNCPGQIVIAGHKEAVERA 180

Query: 182 ADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSS 241
            + C   GAKRA+ LPVS P H +LM P +  M   L  +  + P + ++ N  A+   S
Sbjct: 181 IENCKEAGAKRAIPLPVSVPSHCALMQPAADQMAEELSKIEVKLPEISVVQNVTAAVPGS 240

Query: 242 IDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISK 301
           ++E+   L+ Q+   V W +++Q   +  +++  E G GKVL+GL K+I + L+  +I+ 
Sbjct: 241 VEELKENLLAQLYSPVLWTKSVQGMVDQQIETTIECGPGKVLSGLNKKIHRPLTVAAIND 300

Query: 302 VEDIDLAL 309
           V  ++ AL
Sbjct: 301 VAGLEKAL 308


>gi|85703382|ref|ZP_01034486.1| acyl-carrier-protein S-malonyltransferase [Roseovarius sp. 217]
 gi|85672310|gb|EAQ27167.1| acyl-carrier-protein S-malonyltransferase [Roseovarius sp. 217]
          Length = 327

 Score =  194 bits (492), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 154/313 (49%), Positives = 213/313 (68%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           MS    FPGQG+QVIGMG DL  ++P AR VF+EVD  L Q LS L+W G QE LT T N
Sbjct: 13  MSRAFVFPGQGAQVIGMGADLAANYPAARAVFDEVDEALGQKLSALIWEGEQEALTLTEN 72

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
           AQPAL A S+A +R +E  G+ + +   +VAGHSLGEY+AL AA A S++DT RL+R RG
Sbjct: 73  AQPALMATSLAALRALEAEGVDLAQVAGHVAGHSLGEYSALAAAGAISVADTARLLRIRG 132

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           ++MQ+AVP G+G+M A++GLD      +  +A++  +C+ ANDN  GQVV+SG + AV+ 
Sbjct: 133 QAMQQAVPVGVGAMAALLGLDFETARDVAQEAAQGEVCQAANDNDPGQVVVSGHKGAVER 192

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A D    +GAKRA+ LPVSAPFH +LM P ++VM   L  VT   PVVP++ N  AS V+
Sbjct: 193 ALDLAKARGAKRAMLLPVSAPFHCALMAPAAEVMAAALADVTIHAPVVPLVANVRASAVT 252

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
              EI  LLVEQVTG VRWRE++ + A  GV  ++E+G+GK L+G+ +RI++ ++  +I 
Sbjct: 253 DPAEIRALLVEQVTGSVRWRESVIYMAAQGVTEIWEIGAGKALSGMIRRIEREITCRAIG 312

Query: 301 KVEDIDLALRSIV 313
             E++    + + 
Sbjct: 313 TSEEVKATAQVVA 325


>gi|228940940|ref|ZP_04103499.1| Malonyl CoA-acyl carrier protein transacylase [Bacillus
           thuringiensis serovar berliner ATCC 10792]
 gi|228973869|ref|ZP_04134445.1| Malonyl CoA-acyl carrier protein transacylase [Bacillus
           thuringiensis serovar thuringiensis str. T01001]
 gi|228980459|ref|ZP_04140769.1| Malonyl CoA-acyl carrier protein transacylase [Bacillus
           thuringiensis Bt407]
 gi|228779279|gb|EEM27536.1| Malonyl CoA-acyl carrier protein transacylase [Bacillus
           thuringiensis Bt407]
 gi|228785894|gb|EEM33897.1| Malonyl CoA-acyl carrier protein transacylase [Bacillus
           thuringiensis serovar thuringiensis str. T01001]
 gi|228818776|gb|EEM64842.1| Malonyl CoA-acyl carrier protein transacylase [Bacillus
           thuringiensis serovar berliner ATCC 10792]
 gi|326941621|gb|AEA17517.1| acyl-carrier-protein S-malonyltransferase [Bacillus thuringiensis
           serovar chinensis CT-43]
          Length = 314

 Score =  194 bits (492), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 122/314 (38%), Positives = 182/314 (57%), Gaps = 5/314 (1%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
                FPGQGSQ +GMG+ L ++  E   VF + D  L  +LS++++ G QE+LT T NA
Sbjct: 3   KIAFLFPGQGSQAVGMGKQLAENNKEVAKVFAKADEVLEDSLSEVIFEGPQEKLTLTTNA 62

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPAL   S A +  +++  +       +VAGHSLGEY+AL AA A +  D +  VR RG+
Sbjct: 63  QPALLTTSFAILTALKEYDIT----PDFVAGHSLGEYSALVAAGALTFEDAVYAVRKRGE 118

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQAS-RVGICEIANDNGGGQVVISGLQDAVKC 180
            M+EAVP G G+M AI+G D  ++  +  + +      +IAN N   Q+VISG +  V+ 
Sbjct: 119 YMEEAVPGGEGAMAAILGADPHMLKQVTEEVTSEGYAVQIANMNSTKQIVISGTKQGVED 178

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A+      GAKRA+ L VS PFHSSLM P ++  + +L+ +T  D  +P++ N  A  ++
Sbjct: 179 ASQRAKENGAKRAIPLKVSGPFHSSLMKPAAEKFQSVLNEITIHDTNIPVIANVTAEVIT 238

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
              +I   L+EQ+   V W  +I++  N GV +  E+G GKVL GL K ID S+ A +I 
Sbjct: 239 RGADIQEKLIEQLYSPVLWYPSIEYMVNQGVDTFIEIGPGKVLAGLMKSIDSSVKAYAIY 298

Query: 301 KVEDIDLALRSIVG 314
             E +   + ++ G
Sbjct: 299 DEETLKDTISNLRG 312


>gi|307946731|ref|ZP_07662066.1| malonyl CoA-acyl carrier protein transacylase [Roseibium sp.
           TrichSKD4]
 gi|307770395|gb|EFO29621.1| malonyl CoA-acyl carrier protein transacylase [Roseibium sp.
           TrichSKD4]
          Length = 314

 Score =  194 bits (492), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 150/312 (48%), Positives = 202/312 (64%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M+   TFPGQGSQ + MG++L D+F EA+ VF+EVD  L+Q LS LMW G + +LT T N
Sbjct: 1   MTIAFTFPGQGSQAVSMGKELADTFAEAKAVFDEVDDALDQKLSTLMWEGPEADLTLTAN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
           AQPAL AVS+A +RV+E  GL + + +S+VAGHSLGEY+AL AA +  ++   RL+R RG
Sbjct: 61  AQPALMAVSLATMRVLEARGLDLAKSVSFVAGHSLGEYSALAAAGSLDVATAARLLRVRG 120

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
            +MQ AVP G G M A++GLD      +  +A++  +C+ ANDN  GQVV+SG   AV+ 
Sbjct: 121 NAMQTAVPVGQGGMAALLGLDFAEAAKVAEEAAQGEVCQAANDNAPGQVVVSGNMSAVER 180

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A +    KGAKRA+ L VSAPFH +LM P +  M   L       P VP++ N  AS ++
Sbjct: 181 AVEIAKAKGAKRAMMLSVSAPFHCALMAPAADAMAEALAGAEIVAPKVPLVANVLASAIT 240

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
              EI   LVEQVTG VRWRE++ W   +GV +  EVGSGKVL+G+ KRI++S     ++
Sbjct: 241 DPAEIRNHLVEQVTGTVRWRESMGWLVENGVDTFVEVGSGKVLSGMMKRIERSAKVQPVN 300

Query: 301 KVEDIDLALRSI 312
              DID     +
Sbjct: 301 TPTDIDALFELL 312


>gi|229528959|ref|ZP_04418349.1| malonyl CoA-acyl carrier protein transacylase [Vibrio cholerae
           12129(1)]
 gi|229332733|gb|EEN98219.1| malonyl CoA-acyl carrier protein transacylase [Vibrio cholerae
           12129(1)]
 gi|327484557|gb|AEA78964.1| Malonyl CoA-acyl carrier protein transacylase [Vibrio cholerae
           LMA3894-4]
          Length = 307

 Score =  194 bits (492), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 119/307 (38%), Positives = 169/307 (55%), Gaps = 3/307 (0%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
              + FPGQGSQ +GM  DL + +   +  F E    L  +L  L+ +G  E+L  T   
Sbjct: 3   KFAIVFPGQGSQAVGMLADLAEQYAVVKQTFAEASEVLGYDLWALVQDGPVEDLNQTFRT 62

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPAL A S+A  RV ++         + +AGHSLGEY+AL  A        I+LV  RG+
Sbjct: 63  QPALLAASVAIWRVWQQ---LDLEQPAVLAGHSLGEYSALVCAGVIDFKQAIKLVELRGQ 119

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCA 181
            MQ+AVP G G+M AIIGL+D  +   CA A++  +    N N  GQVVI+G +DAV+ A
Sbjct: 120 LMQQAVPAGTGAMYAIIGLEDEAIAKACADAAQGEVVSPVNFNSPGQVVIAGQKDAVERA 179

Query: 182 ADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSS 241
              C   GAKRA+ LPVS P H +LM P +  +   L  +    P +P++ N      + 
Sbjct: 180 GVLCKEAGAKRALPLPVSVPSHCALMKPAADELAKTLVELEFNAPQIPVINNVDVVAETD 239

Query: 242 IDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISK 301
             +I   L+ Q+   VRW E ++  +  GV+ + E+G GKVLTGL KRI K+L  V+++ 
Sbjct: 240 PVKIKDALIRQLYSPVRWTECVEQMSAQGVEKLIEMGPGKVLTGLTKRIVKTLEGVAVND 299

Query: 302 VEDIDLA 308
           V  +D  
Sbjct: 300 VASLDAV 306


>gi|221214101|ref|ZP_03587074.1| malonyl CoA-acyl carrier protein transacylase [Burkholderia
           multivorans CGD1]
 gi|221166278|gb|EED98751.1| malonyl CoA-acyl carrier protein transacylase [Burkholderia
           multivorans CGD1]
          Length = 332

 Score =  194 bits (492), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 138/310 (44%), Positives = 175/310 (56%), Gaps = 4/310 (1%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M     FPGQGSQ +GM     D     R   +E    LNQ+L  L+  G  EEL  T N
Sbjct: 23  MKFAFVFPGQGSQSVGMLNAFAD-LAVVRETLQEASDALNQDLGKLIAEGPAEELNLTTN 81

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
            QP +   + A  R  ++ G       S VAGHSLGEYTAL AA A +  D + LVR R 
Sbjct: 82  TQPVMLTAAYACYRAWQQAGG---PAPSIVAGHSLGEYTALVAAGAIAFKDAVPLVRFRA 138

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           ++MQ AVP G G M AI+GLDD  V ++CA+AS  G+ E  N N   QVVI+G + AV+ 
Sbjct: 139 QAMQTAVPVGQGGMAAILGLDDDTVRAVCAEASSEGVVEAVNFNAPAQVVIAGAKAAVEK 198

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A +    KGAKRA+ LPVSAPFHSSL+ P S  ++  L +V  + P +P++ N   + VS
Sbjct: 199 ACEVAKAKGAKRALPLPVSAPFHSSLLKPASDQLRDYLANVEVKAPQIPVVNNIDVAVVS 258

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
               I   LV Q  G VRW E +Q  A  GV  V E G GKVL GL KRID +L+  S+ 
Sbjct: 259 DPAAIKDALVRQAAGPVRWVECVQHIAGTGVTHVIECGPGKVLAGLTKRIDGNLTGASVF 318

Query: 301 KVEDIDLALR 310
               +D AL+
Sbjct: 319 DPASLDEALK 328


>gi|319789959|ref|YP_004151592.1| malonyl CoA-acyl carrier protein transacylase [Thermovibrio
           ammonificans HB-1]
 gi|317114461|gb|ADU96951.1| malonyl CoA-acyl carrier protein transacylase [Thermovibrio
           ammonificans HB-1]
          Length = 306

 Score =  194 bits (492), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 131/308 (42%), Positives = 176/308 (57%), Gaps = 4/308 (1%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M+    FPGQGSQ  GMG++LY++FPEAR VFEE       ++  L +   +EELT T N
Sbjct: 1   MAIAFIFPGQGSQYSGMGKELYEAFPEAREVFEEASEGAKVDIRKLCFEAPEEELTLTYN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
           AQPA+  VSMA +RV+EK G    +    VAGHSLGE++A  AA  FS+ +   LVR RG
Sbjct: 61  AQPAIFTVSMAVLRVLEKAG---FKKPDVVAGHSLGEFSAAGAAGVFSVGNGALLVRKRG 117

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           + MQ AVP G+G M A+IGL    V+ I  +       ++AN N   Q VISG   A++ 
Sbjct: 118 EFMQSAVPAGVGGMTAVIGLPAEAVEEIINKVKSG-FVQVANYNSPEQTVISGEIKALQE 176

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A +     GAKR V L VSAPFHS LM P ++ +K +++ +       PIL N     + 
Sbjct: 177 AEEMLKQAGAKRVVRLAVSAPFHSKLMEPAAERLKELMEELPFHKANPPILNNVDVKLIK 236

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
             +EI      QV   VRW E +   A  GV + YE+G   VL GL +RID+ L  V++ 
Sbjct: 237 EPEEIKDSFYRQVFSPVRWVEDVLKMAQMGVDTFYEIGPKNVLKGLIRRIDRKLKVVNVE 296

Query: 301 KVEDIDLA 308
           K +DI+  
Sbjct: 297 KPQDIEKL 304


>gi|238926910|ref|ZP_04658670.1| [acyl-carrier-protein] S-malonyltransferase [Selenomonas flueggei
           ATCC 43531]
 gi|238885144|gb|EEQ48782.1| [acyl-carrier-protein] S-malonyltransferase [Selenomonas flueggei
           ATCC 43531]
          Length = 311

 Score =  193 bits (491), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 124/311 (39%), Positives = 169/311 (54%), Gaps = 4/311 (1%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
                FPGQG+Q++GMGRD YD++  A+  F E D  L  ++S L + G  ++L  T N 
Sbjct: 3   KLAFLFPGQGAQIVGMGRDFYDAYDLAKDRFAEADDALGYSISKLCFEGPADQLQLTENT 62

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPA+  VS+   ++++  G+      +   GHSLGEY AL  A A S  D + LV  RG 
Sbjct: 63  QPAILTVSVIAAQLLQARGVA----PAIAGGHSLGEYAALVLAGALSFRDAVVLVHKRGA 118

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCA 181
            MQEAVP G G+M AIIGLDD  +   CA AS  G  +  N N  GQ VI+G +  V  A
Sbjct: 119 YMQEAVPVGEGAMAAIIGLDDATIIDACAAASAQGAVQAVNFNCPGQTVIAGAEKGVSTA 178

Query: 182 ADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSS 241
            +    KGAK+AV LPVSAPFHS+LM P +K +   LD V   D   P++ N+      +
Sbjct: 179 VELLKEKGAKKAVILPVSAPFHSTLMAPAAKKLAAELDKVALHDAAFPVVSNYTGGLQQT 238

Query: 242 IDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISK 301
             EI   LV Q    VRW   +    + G     E G GK L G  KRIDK+L+++++  
Sbjct: 239 AAEIKANLVAQADHPVRWIACVSAMRDFGADIYIECGPGKTLAGFNKRIDKTLTSLNVED 298

Query: 302 VEDIDLALRSI 312
              +   L ++
Sbjct: 299 DASLQKTLDTL 309


>gi|171319463|ref|ZP_02908567.1| malonyl CoA-acyl carrier protein transacylase [Burkholderia
           ambifaria MEX-5]
 gi|171095314|gb|EDT40297.1| malonyl CoA-acyl carrier protein transacylase [Burkholderia
           ambifaria MEX-5]
          Length = 310

 Score =  193 bits (491), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 137/310 (44%), Positives = 174/310 (56%), Gaps = 4/310 (1%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M     FPGQGSQ +GM     D     R   +E    LNQ+L  L+  G  EEL  T N
Sbjct: 1   MKFAFVFPGQGSQSVGMLNAFAD-LAVVRETLQEASDALNQDLGKLIAEGPAEELNLTTN 59

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
            QP +   + A  R  ++ G       S VAGHSLGEYTAL AA A +  D + LVR R 
Sbjct: 60  TQPVMLTAAYACYRAWQQAGG---PAPSIVAGHSLGEYTALVAAGAIAFKDAVPLVRFRA 116

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           ++MQ AVP G G M AI+GLDD  V ++CA+A+  G+ E  N N   QVVI+G + AV+ 
Sbjct: 117 QAMQTAVPVGQGGMAAILGLDDDTVRAVCAEAAEAGVVEAVNFNAPAQVVIAGAKAAVEK 176

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A +    KGAKRA+ LPVSAPFHSSL+ P S  ++  L +V  + P +P++ N   + V 
Sbjct: 177 ACEIAKAKGAKRALPLPVSAPFHSSLLKPASDQLRDYLANVDVKAPQIPVVNNIDVAVVG 236

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
               I   LV Q  G VRW E +Q  A  GV  V E G GKVL GL KRID +L  VS+ 
Sbjct: 237 DPAAIKDALVRQAAGPVRWVECVQHIAGTGVTHVIECGPGKVLAGLTKRIDGNLVGVSVF 296

Query: 301 KVEDIDLALR 310
               +D AL+
Sbjct: 297 DPASLDEALK 306


>gi|300857344|ref|YP_003782328.1| malonyl-CoA-acyl carrier protein transacylase [Clostridium
           ljungdahlii DSM 13528]
 gi|300437459|gb|ADK17226.1| malonyl-CoA-acyl carrier protein transacylase [Clostridium
           ljungdahlii DSM 13528]
          Length = 312

 Score =  193 bits (491), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 107/312 (34%), Positives = 180/312 (57%), Gaps = 4/312 (1%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
                F GQG+Q +GMG+DL+++    + VF++ D  L+ ++S++ + G +E+L  T N 
Sbjct: 3   KIAFLFSGQGAQYVGMGKDLFENIDVCKNVFKDADEVLDFSISNMCFEGPEEDLNKTENT 62

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPA+   S+A +R +E  G+         AG SLGEY+AL  +      + + LV+ RGK
Sbjct: 63  QPAILTTSIAALRALEGFGI----KPDIAAGLSLGEYSALVCSGVMEFKEAVSLVKKRGK 118

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCA 181
            MQEAVP G+G+M AI+GLD   V+ ICA +S  GI E +N N  GQVVI G  +AVK A
Sbjct: 119 YMQEAVPEGIGTMAAILGLDYVKVEKICADSSSFGIVETSNMNCPGQVVIGGEIEAVKAA 178

Query: 182 ADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSS 241
                 +GA+RA+ L VS PFH+S++ P ++ ++  L+ ++ ++  +P++ N     +  
Sbjct: 179 CKLAKERGARRAIELSVSGPFHTSMLKPAAEKLEGELNKLSLKEFSIPVVTNVTGEVIEK 238

Query: 242 IDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISK 301
           +D +   L  QV   V + ++I      G  +  E+G GKVL+G  ++ID+    +++  
Sbjct: 239 LDNVKPYLKRQVMSTVLFEKSINTMIEAGADTFVEIGPGKVLSGFVRKIDRKALILNVQD 298

Query: 302 VEDIDLALRSIV 313
           ++ ++  +  + 
Sbjct: 299 IKSLNSTVEELK 310


>gi|209517234|ref|ZP_03266079.1| malonyl CoA-acyl carrier protein transacylase [Burkholderia sp.
           H160]
 gi|209502370|gb|EEA02381.1| malonyl CoA-acyl carrier protein transacylase [Burkholderia sp.
           H160]
          Length = 311

 Score =  193 bits (491), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 133/310 (42%), Positives = 174/310 (56%), Gaps = 4/310 (1%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M     FPGQGSQ +GM     D     R   +E    LNQ+L  L+  G  E+L  T N
Sbjct: 1   MKFAFVFPGQGSQAVGMLNAFAD-HALVRETVQEASDALNQDLGKLIAEGPAEDLNLTTN 59

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
            QP +   + A  R  ++ G       + VAGHSLGEYTAL AA A +  D + LVR R 
Sbjct: 60  TQPVMLTAAYAVYRAWQQAGG---PAPAIVAGHSLGEYTALVAAGALAFRDAVPLVRFRA 116

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           ++MQ AVP G G M AI+GLDD  V ++CA+AS  G+ E  N N   QVVI+G + AV+ 
Sbjct: 117 QAMQTAVPVGEGGMAAILGLDDDTVRAVCAEASAAGVVEAVNFNAPAQVVIAGHKAAVEK 176

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A +    KGAKRA+ LPVSAPFHSSL+ P S  ++  L S+  + P +P++ N   + V+
Sbjct: 177 ACEVAKAKGAKRALPLPVSAPFHSSLLKPASDQLREYLASIDVRVPSIPVINNVDVAVVN 236

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
               I   LV Q  G VRW E++Q  A  G+  V E G GKVL GL KRID SL   S+ 
Sbjct: 237 EPSGIKDALVRQAAGPVRWVESVQAMAAQGITHVIECGPGKVLAGLTKRIDGSLVGASVF 296

Query: 301 KVEDIDLALR 310
               ++  L+
Sbjct: 297 DPASLEETLK 306


>gi|258621213|ref|ZP_05716247.1| acyl carrier protein S-malonyltransferase [Vibrio mimicus VM573]
 gi|258586601|gb|EEW11316.1| acyl carrier protein S-malonyltransferase [Vibrio mimicus VM573]
          Length = 307

 Score =  193 bits (491), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 122/307 (39%), Positives = 171/307 (55%), Gaps = 3/307 (0%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
              + FPGQGSQ +GM  DL   +   +  F E    L  +L  L+ +G  E+L  T   
Sbjct: 3   KFAIVFPGQGSQAVGMLADLAQQYDVVKQTFAEASEVLGYDLWALVQDGPVEDLNQTFRT 62

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPAL A S+A  RV ++ GL      + +AGHSLGEY+AL  A        I+LV  RGK
Sbjct: 63  QPALLAASVAIWRVWQQLGL---EQPTVLAGHSLGEYSALVCAGVIDFKQAIKLVELRGK 119

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCA 181
            MQ+AVP G G+M AIIGL+D  +   CA+A++  +    N N  GQVVI+G +DAV+ A
Sbjct: 120 LMQQAVPAGTGAMYAIIGLEDEAIAKACAEAAQGEVVSPVNFNSPGQVVIAGQKDAVERA 179

Query: 182 ADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSS 241
              C   GAKRA+ LPVS P H +LM P +  +   L  +    P +P++ N   +  + 
Sbjct: 180 GVLCKEAGAKRALPLPVSVPSHCALMKPAADELAKTLAELEFNAPQIPVINNVDVAAETD 239

Query: 242 IDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISK 301
             +I   LV Q+   VRW E ++  +  GV+ + E+G GKVLTGL KRI K+L   +++ 
Sbjct: 240 PAKIKEALVRQLYSPVRWTECVEQMSAQGVEKLIEMGPGKVLTGLTKRIVKTLEGAAVND 299

Query: 302 VEDIDLA 308
           V  +D  
Sbjct: 300 VASLDAV 306


>gi|152979654|ref|YP_001345283.1| malonyl CoA-acyl carrier protein transacylase [Actinobacillus
           succinogenes 130Z]
 gi|150841377|gb|ABR75348.1| malonyl CoA-acyl carrier protein transacylase [Actinobacillus
           succinogenes 130Z]
          Length = 312

 Score =  193 bits (491), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 120/312 (38%), Positives = 174/312 (55%), Gaps = 3/312 (0%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
              + FPGQGSQ +GM  DL + FP     F++  + L  +L  L+  G  EEL  T   
Sbjct: 3   KFAMVFPGQGSQSVGMLADLAEQFPVVTETFKQASNVLGYDLWALVQQGPAEELNKTWQT 62

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPAL   S+A  RV ++           +AGHSLGEY+AL  +      D ++LV  RG+
Sbjct: 63  QPALLTASVAIYRVWQQ--QYPDLQPELMAGHSLGEYSALVCSGVIDFEDAVKLVELRGR 120

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCA 181
            MQ+AVP G G+M AIIGLD+  + + C  A +  +    N N  GQVVI+G ++AV+ A
Sbjct: 121 LMQQAVPEGAGAMYAIIGLDNEAIINACKNAEQGEVVSAVNFNSPGQVVIAGSKNAVERA 180

Query: 182 ADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSS 241
           A  C   GAKR + L VS P H +LM P +  +   L+SV  + P+  ++ N      + 
Sbjct: 181 ATACKEAGAKRTLPLSVSVPSHCALMKPAADQLAVSLESVAVKKPLTSVINNVDVKTEND 240

Query: 242 IDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISK 301
            + I   LV Q+   VRW ET++  A  G++ + E+G GKVLTGLA RI K LSA +++ 
Sbjct: 241 AEAIRTALVRQLYSPVRWTETVEKMAAQGIEVLVEIGPGKVLTGLAGRIVKGLSAQAVND 300

Query: 302 VEDIDLALRSIV 313
           V+ +  A+  ++
Sbjct: 301 VKSL-TAVEELL 311


>gi|15615055|ref|NP_243358.1| acyl-carrier-protein S-malonyltransferase [Bacillus halodurans
           C-125]
 gi|10175112|dbj|BAB06211.1| malonyl CoA-acyl carrier protein transacylase [Bacillus halodurans
           C-125]
          Length = 313

 Score =  193 bits (491), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 114/312 (36%), Positives = 182/312 (58%), Gaps = 6/312 (1%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
                FPGQGSQ +GMG +L  S  +A+ +F+E D  L  +LS +M+ G +E+L  T N 
Sbjct: 3   KVAFLFPGQGSQSVGMGSELL-SEEKAKEIFDEADERLGYSLSSIMFEGPEEKLRRTENT 61

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPAL  +S A + ++ + G+       Y AGHSLGEY+AL A+ + + +D +  V  RG 
Sbjct: 62  QPALLTMSTAVLSLVREYGI----KPDYTAGHSLGEYSALVASGSLTFADAVYAVHHRGL 117

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQASR-VGICEIANDNGGGQVVISGLQDAVKC 180
            M+EAVP G G+M AI+G++   ++ +  + +    + E+AN N  GQ+VISG  + V+ 
Sbjct: 118 FMEEAVPFGEGAMAAILGMERDELEQVTKRVTEAGAVVELANLNCPGQIVISGSAEGVEQ 177

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A++     GAKR + L VS PFHSSLM P ++ ++ +L  +   D   P++ N  A  V 
Sbjct: 178 ASEEAKEAGAKRVIPLQVSGPFHSSLMKPAAEKLEAVLADLAIADAAPPVIANVTADLVQ 237

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
              +I   L+EQV   VRW +T++     GV +  E+GSG VL+GL +++ + ++  S+S
Sbjct: 238 KAADIRSSLIEQVYSPVRWEDTVRRMLELGVDTFVEIGSGNVLSGLVRKVQRRVNVFSVS 297

Query: 301 KVEDIDLALRSI 312
               I+  ++ +
Sbjct: 298 DRASIEAMVKKL 309


>gi|325523016|gb|EGD01436.1| malonyl CoA-acyl carrier protein transacylase [Burkholderia sp.
           TJI49]
          Length = 310

 Score =  193 bits (491), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 138/310 (44%), Positives = 175/310 (56%), Gaps = 4/310 (1%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M     FPGQGSQ +GM     D     R   +E    LNQ+L  L+  G  EEL  T N
Sbjct: 1   MKFAFVFPGQGSQSVGMLNAFAD-LAVVRETLQEASDALNQDLGKLIAEGPAEELNLTTN 59

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
            QP +   + A  R  ++ G       S VAGHSLGEYTAL AA A +  D + LVR R 
Sbjct: 60  TQPVMLTAAYACYRAWQQAGG---PAPSIVAGHSLGEYTALVAAGAIAFRDAVPLVRFRA 116

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           ++MQ AVP G G M AI+GLDD  V ++CA+AS  G+ E  N N   QVVI+G + AV+ 
Sbjct: 117 QAMQTAVPVGQGGMAAILGLDDDTVRAVCAEASSEGVVEAVNFNAPAQVVIAGAKAAVEK 176

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A +    KGAKRA+ LPVSAPFHSSL+ P S  ++  L SV  + P +P++ N   + V+
Sbjct: 177 ACEVAKAKGAKRALPLPVSAPFHSSLLKPASDQLRDYLASVDVKAPQIPVVNNIDVAVVA 236

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
               I   LV Q  G VRW E +Q  A  GV  V E G GKVL GL KRID +L+  S+ 
Sbjct: 237 DPAAIKDALVRQAAGPVRWVECVQHIAGTGVTHVIECGPGKVLAGLTKRIDGNLTGASVF 296

Query: 301 KVEDIDLALR 310
               +D AL+
Sbjct: 297 DPASLDEALK 306


>gi|167825172|ref|ZP_02456643.1| malonyl CoA-acyl carrier protein transacylase [Burkholderia
           pseudomallei 9]
 gi|167911891|ref|ZP_02498982.1| malonyl CoA-acyl carrier protein transacylase [Burkholderia
           pseudomallei 112]
 gi|226199988|ref|ZP_03795538.1| malonyl CoA-acyl carrier protein transacylase [Burkholderia
           pseudomallei Pakistan 9]
 gi|254191233|ref|ZP_04897737.1| malonyl CoA-acyl carrier protein transacylase [Burkholderia
           pseudomallei Pasteur 52237]
 gi|157938905|gb|EDO94575.1| malonyl CoA-acyl carrier protein transacylase [Burkholderia
           pseudomallei Pasteur 52237]
 gi|225928044|gb|EEH24081.1| malonyl CoA-acyl carrier protein transacylase [Burkholderia
           pseudomallei Pakistan 9]
          Length = 310

 Score =  193 bits (491), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 131/313 (41%), Positives = 171/313 (54%), Gaps = 4/313 (1%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M     FPGQGSQ +GM     D     R   +E    L Q++  L+ +G  +EL  T N
Sbjct: 1   MKFAFVFPGQGSQSVGMLNAFAD-VAVVRETLDEASDALGQDIGKLIADGPADELNLTTN 59

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
            QP +   + A  R  ++ G       S VAGHSLGEYTAL AA A +  D + LVR R 
Sbjct: 60  TQPVMLTAAYACYRAWQQAGGA---QPSIVAGHSLGEYTALVAAGAIAFRDALPLVRFRA 116

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           ++MQ AVP G+G M AI+GLDD  V ++CA+AS  G+ E  N N   QVVI+G +  ++ 
Sbjct: 117 QAMQTAVPVGVGGMAAILGLDDDTVRAVCAEASATGVVEAVNFNAPAQVVIAGTKAGIEK 176

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A +    KGAKRA+ LPVSAPFHSSL+ P S  ++  L  V  + P + ++ N   + VS
Sbjct: 177 ACEIAKEKGAKRALPLPVSAPFHSSLLKPASDKLREYLAGVDVKAPKISVVNNIDVAVVS 236

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
               I   LV Q  G VRW E +Q  A  GV  V E G GKVL  L KRID +L   S+ 
Sbjct: 237 DPAAIKDALVRQAAGPVRWVECVQHIAREGVTHVIECGPGKVLASLTKRIDGNLVGASVF 296

Query: 301 KVEDIDLALRSIV 313
               +D AL+   
Sbjct: 297 DPASLDEALKLAA 309


>gi|315179576|gb|ADT86490.1| malonyl Coa-acyl carrier protein transacylase [Vibrio furnissii
           NCTC 11218]
          Length = 307

 Score =  193 bits (490), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 122/307 (39%), Positives = 172/307 (56%), Gaps = 3/307 (0%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
              + FPGQGSQ +GM  +L + +   +  F E    L  +L  L+ NG  E+L  T   
Sbjct: 3   KFAIVFPGQGSQAVGMLAELGEQYDVVKQTFAEASDALGYDLWALVQNGPVEDLNQTFRT 62

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPAL A S+A  RV +  GL        +AGHSLGEY+AL  A        I+LV  RG+
Sbjct: 63  QPALLASSVAIWRVWQALGL---EQPEVLAGHSLGEYSALVCAGVIDFKAAIKLVELRGQ 119

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCA 181
            MQEAVP G G+M AIIGLDD  +   C  A++  +    N N  GQVVI+G +DAV+ A
Sbjct: 120 LMQEAVPAGTGAMYAIIGLDDAAIAKACEDAAQGDVVSPVNFNSPGQVVIAGQKDAVERA 179

Query: 182 ADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSS 241
              C   GAKRA+ LPVS P H +LM P ++ +   L+++    P +P++ N   +  + 
Sbjct: 180 GALCKEAGAKRALPLPVSVPSHCALMKPAAEKLAVALEALEFNAPQIPVINNVDVATETD 239

Query: 242 IDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISK 301
             +I   LV Q+   VRW E ++  A  G++ + EVG GKVLTGL KRI K+L A +++ 
Sbjct: 240 PAKIKDALVRQLHSPVRWTEGVEKMAAQGIEKLIEVGPGKVLTGLTKRIVKTLDAAAVND 299

Query: 302 VEDIDLA 308
           +  ++  
Sbjct: 300 IASLEAV 306


>gi|307826067|ref|ZP_07656280.1| malonyl CoA-acyl carrier protein transacylase [Methylobacter
           tundripaludum SV96]
 gi|307732906|gb|EFO03770.1| malonyl CoA-acyl carrier protein transacylase [Methylobacter
           tundripaludum SV96]
          Length = 318

 Score =  193 bits (490), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 127/313 (40%), Positives = 173/313 (55%), Gaps = 3/313 (0%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
           +    FPGQGSQ +GM  DL  S+PE +  FE     L ++L  ++  G ++EL  T N 
Sbjct: 9   NLAFVFPGQGSQSVGMLTDLAASYPEVKHTFERASDALGKDLWSIVAKGPEDELNQTHNT 68

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPA+ A  +A   V  K+        +++AGHSLGEYTAL  + A S  D I+LV ARG+
Sbjct: 69  QPAMLAAGVAVWEVWCKHSNV---RPAWMAGHSLGEYTALVCSDALSFEDGIKLVAARGR 125

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCA 181
            MQEAVPPG+G+M AI+GL+D  V  +CA A+   I    N N  GQVVI+G   AV+ A
Sbjct: 126 LMQEAVPPGVGAMAAILGLEDHQVVQVCADAAEDEIVSAVNFNSPGQVVIAGNVAAVERA 185

Query: 182 ADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSS 241
                  GAKR V LPVS P H +LM P +K +   L       P + ++ N   +  S+
Sbjct: 186 MLAAKAAGAKRVVLLPVSVPSHCALMGPAAKKLDEQLQRTAIDTPKMTLIHNVDVASHSA 245

Query: 242 IDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISK 301
            + I   L EQ+   VRW ++I++  + GV    E G GKVL GL KRI K    +SI  
Sbjct: 246 PEVIRNALKEQLYKPVRWADSIKFMHDQGVTCFVECGPGKVLIGLNKRIAKDAEQLSIYD 305

Query: 302 VEDIDLALRSIVG 314
            E ++  L  + G
Sbjct: 306 PETLNKVLEQLNG 318


>gi|220931871|ref|YP_002508779.1| malonyl CoA-acyl carrier protein transacylase [Halothermothrix
           orenii H 168]
 gi|219993181|gb|ACL69784.1| malonyl CoA-acyl carrier protein transacylase [Halothermothrix
           orenii H 168]
          Length = 309

 Score =  193 bits (490), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 122/312 (39%), Positives = 174/312 (55%), Gaps = 6/312 (1%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
                FPGQGSQ +GMG++L + +P     F++ +H L  +L +L +NG + +L  T   
Sbjct: 4   KIAFLFPGQGSQYVGMGQELIEHYPGTDDFFKKANHILGYDLKELCFNGPESKLNNTKYT 63

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPA+  VSM    ++  N +        VAGHSLGEY+AL AA  F+  D ++LV  RG 
Sbjct: 64  QPAIFTVSMIIYSILNSNNIY----PDVVAGHSLGEYSALAAAGVFTFEDGLKLVHRRGN 119

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCA 181
            M EA+P G G+M AIIGL+   V SIC Q    G+CE+AN N   Q+VI+G   AV+ A
Sbjct: 120 LMDEALPEGQGTMAAIIGLEKKQVLSICQQV--DGVCEVANYNSPSQLVITGETPAVQEA 177

Query: 182 ADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSS 241
                 +GAK+ V L VS PFHSSLM P    +   ++ +   DP VP++ N     V  
Sbjct: 178 MKLAEQEGAKKVVGLDVSGPFHSSLMKPARDKLSNYINEINFNDPQVPVVANVTGDYVKD 237

Query: 242 IDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISK 301
              I +LL+ Q+TG VRW E++      GV    EVG G+VL GL +RI++     +I  
Sbjct: 238 SAGIKKLLINQLTGSVRWVESMNRLLEDGVDIFIEVGPGRVLKGLMRRINRKARVYNIEN 297

Query: 302 VEDIDLALRSIV 313
           ++ ++  L  + 
Sbjct: 298 IKTLNKLLDILK 309


>gi|170759032|ref|YP_001788944.1| malonyl CoA-acyl carrier protein transacylase [Clostridium
           botulinum A3 str. Loch Maree]
 gi|169406021|gb|ACA54432.1| malonyl CoA-acyl carrier protein transacylase [Clostridium
           botulinum A3 str. Loch Maree]
          Length = 314

 Score =  193 bits (490), Expect = 3e-47,   Method: Composition-based stats.
 Identities = 112/312 (35%), Positives = 171/312 (54%), Gaps = 4/312 (1%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
                F GQG+Q +GMG+DLY + PE R +F   +  L   L+ + + G ++E+  T N 
Sbjct: 3   KIAFIFSGQGAQYVGMGKDLYKNIPECREIFNIAEEELQIPLTKICFQGPKDEIDKTENT 62

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPA+  +S+A ++ +EK G+         AG SLGEY+AL  +K     + + LVR RG+
Sbjct: 63  QPAILTLSIAAMKALEKYGI----KPDVTAGLSLGEYSALVCSKVIDFKEAVSLVRKRGQ 118

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCA 181
            M+ AVP G+G+M AIIGL    V  IC      GI EIAN N  GQ+VISG  +AV  A
Sbjct: 119 YMEHAVPNGVGTMAAIIGLKKEKVKEICDGLKEAGIVEIANINCPGQIVISGEINAVGKA 178

Query: 182 ADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSS 241
            +    K A + V L VS PFHSS++    + +   L  +  +   VP + N     V +
Sbjct: 179 CEMAKEKRALKCVNLSVSGPFHSSMLREAGENLYEELQKIQCKSIEVPFITNVTGDFVVN 238

Query: 242 IDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISK 301
             EI  LL +QV   V W E+I+   + GV +  E+G  KVL+G  K+ID+ ++ +++  
Sbjct: 239 TSEIKDLLKKQVMSTVLWEESIKTMIDFGVDTFIEIGPSKVLSGFVKKIDRKVNILNVED 298

Query: 302 VEDIDLALRSIV 313
           ++ ++  +  + 
Sbjct: 299 IDSLNKTIEKLK 310


>gi|30021940|ref|NP_833571.1| acyl-carrier-protein S-malonyltransferase [Bacillus cereus ATCC
           14579]
 gi|229047539|ref|ZP_04193129.1| Malonyl CoA-acyl carrier protein transacylase [Bacillus cereus
           AH676]
 gi|229111323|ref|ZP_04240876.1| Malonyl CoA-acyl carrier protein transacylase [Bacillus cereus
           Rock1-15]
 gi|229129128|ref|ZP_04258101.1| Malonyl CoA-acyl carrier protein transacylase [Bacillus cereus
           BDRD-Cer4]
 gi|229146423|ref|ZP_04274794.1| Malonyl CoA-acyl carrier protein transacylase [Bacillus cereus
           BDRD-ST24]
 gi|229152051|ref|ZP_04280246.1| Malonyl CoA-acyl carrier protein transacylase [Bacillus cereus
           m1550]
 gi|296504347|ref|YP_003666047.1| acyl-carrier-protein S-malonyltransferase [Bacillus thuringiensis
           BMB171]
 gi|29897496|gb|AAP10772.1| Malonyl-CoA-[acyl-carrier-protein] transacylase [Bacillus cereus
           ATCC 14579]
 gi|228631400|gb|EEK88034.1| Malonyl CoA-acyl carrier protein transacylase [Bacillus cereus
           m1550]
 gi|228637056|gb|EEK93515.1| Malonyl CoA-acyl carrier protein transacylase [Bacillus cereus
           BDRD-ST24]
 gi|228654365|gb|EEL10230.1| Malonyl CoA-acyl carrier protein transacylase [Bacillus cereus
           BDRD-Cer4]
 gi|228672099|gb|EEL27390.1| Malonyl CoA-acyl carrier protein transacylase [Bacillus cereus
           Rock1-15]
 gi|228723786|gb|EEL75141.1| Malonyl CoA-acyl carrier protein transacylase [Bacillus cereus
           AH676]
 gi|296325399|gb|ADH08327.1| acyl-carrier-protein S-malonyltransferase [Bacillus thuringiensis
           BMB171]
          Length = 314

 Score =  193 bits (490), Expect = 3e-47,   Method: Composition-based stats.
 Identities = 122/314 (38%), Positives = 182/314 (57%), Gaps = 5/314 (1%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
                FPGQGSQ +GMG+ L ++  E   VF + D  L  +LS++++ G QE+LT T NA
Sbjct: 3   KIAFLFPGQGSQAVGMGKQLAENNKEVAKVFAKADEVLEDSLSEVIFEGPQEKLTLTTNA 62

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPAL   S A +  +++  +       +VAGHSLGEY+AL AA A +  D +  VR RG+
Sbjct: 63  QPALLTTSFAILTALKEYDIT----PDFVAGHSLGEYSALVAAGALTFEDAVYAVRKRGE 118

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQAS-RVGICEIANDNGGGQVVISGLQDAVKC 180
            M+EAVP G G+M AI+G D  ++  +  + +      +IAN N   Q+VISG +  V+ 
Sbjct: 119 YMEEAVPGGEGAMAAILGADPHMLKQVTEEVTSEGYAVQIANMNSTKQIVISGTKQGVEV 178

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A+      GAKRA+ L VS PFHSSLM P ++  + +L+ +T  D  +P++ N  A  ++
Sbjct: 179 ASQRAKENGAKRAIPLKVSGPFHSSLMKPAAEKFQSVLNEITIHDTNIPVIANVTAEVIT 238

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
              +I   L+EQ+   V W  +I++  N GV +  E+G GKVL GL K ID S+ A +I 
Sbjct: 239 RGADIQEKLIEQLYSPVLWYPSIEYMVNQGVDTFIEIGPGKVLAGLMKSIDSSVKAYAIY 298

Query: 301 KVEDIDLALRSIVG 314
             E +   + ++ G
Sbjct: 299 DEETLKDTISNLRG 312


>gi|312113716|ref|YP_004011312.1| malonyl CoA-acyl carrier protein transacylase [Rhodomicrobium
           vannielii ATCC 17100]
 gi|311218845|gb|ADP70213.1| malonyl CoA-acyl carrier protein transacylase [Rhodomicrobium
           vannielii ATCC 17100]
          Length = 318

 Score =  193 bits (490), Expect = 3e-47,   Method: Composition-based stats.
 Identities = 148/308 (48%), Positives = 199/308 (64%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M+   TFPGQGSQ +GMG++L  +F  AR VF+EVD  L + LS +MW G +  LT T N
Sbjct: 1   MTFAFTFPGQGSQTVGMGQNLAQNFAVARAVFDEVDEALGEKLSAVMWEGPEATLTLTFN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
           AQPAL AVS+A   V++           YVAGHSLGEY+AL A   FS++D  RL+R RG
Sbjct: 61  AQPALMAVSLAAFAVIKNEYGWEAIKPVYVAGHSLGEYSALAAVGVFSVADAARLLRLRG 120

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
            +MQEAVP G G+M+A++G +      + A A+   + ++ANDN  GQ+VISG + A+  
Sbjct: 121 TAMQEAVPQGQGAMLALLGAEIDSAKKLAAAAAEGEVAQVANDNAPGQIVISGSKAAMDR 180

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           AA      G +RAV LPVSAPFH +LM+P ++ M   L ++  + P VP++ N  A+PVS
Sbjct: 181 AAKLAPEYGIRRAVPLPVSAPFHCALMSPAAERMATALAALDLKIPEVPVVTNVTAAPVS 240

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
               I  LLVEQVTG VRWRE++ +  +HGV +++EVG+GKVLTGLAKRI     A S+ 
Sbjct: 241 DPSLIRSLLVEQVTGVVRWRESVAYMVDHGVATLFEVGAGKVLTGLAKRIRSEADARSVG 300

Query: 301 KVEDIDLA 308
             +DI   
Sbjct: 301 TADDIKSF 308


>gi|257466294|ref|ZP_05630605.1| malonyl-CoA-[acyl-carrier-protein] transacylase [Fusobacterium
           gonidiaformans ATCC 25563]
 gi|315917451|ref|ZP_07913691.1| malonyl-CoA-[acyl-carrier-protein] transacylase [Fusobacterium
           gonidiaformans ATCC 25563]
 gi|313691326|gb|EFS28161.1| malonyl-CoA-[acyl-carrier-protein] transacylase [Fusobacterium
           gonidiaformans ATCC 25563]
          Length = 304

 Score =  193 bits (490), Expect = 3e-47,   Method: Composition-based stats.
 Identities = 103/308 (33%), Positives = 169/308 (54%), Gaps = 6/308 (1%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
                FPGQG+Q +GMG+DLY+  P A+ + +++  +L+ +L  +M+ G+ E+L  T   
Sbjct: 3   KVAFVFPGQGTQYVGMGKDLYEKSPRAKEILDKMFQSLDFDLKSIMFEGTAEDLKQTKYT 62

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPA+ A+S+  + + ++ G        YVAGHS+GEYTA  AA   S  + I L  ARG+
Sbjct: 63  QPAIVALSLTLMELAKEKG----LKADYVAGHSVGEYTAYGAAGMLSFEEAICLTAARGQ 118

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCA 181
            M +      G+M A++G+           A   G+ E  N N   Q VI+G +  V+ A
Sbjct: 119 IMNDVSEKVNGTMAAVLGMPA--EKIQEVLAGMDGVVEAVNFNEPNQTVIAGQKAVVEAA 176

Query: 182 ADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSS 241
                  GA+RA+ L VS PFHSSLM    + +K   +        + ++ N  A  ++S
Sbjct: 177 CLALKEAGARRALPLAVSGPFHSSLMKEAGEKLKEEAEKYHFSMTEIGLVANTTAEVLTS 236

Query: 242 IDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISK 301
           ++++   +  Q  G V W +TI++    GV ++YE+G GKVL+GL K+I+K ++  +I  
Sbjct: 237 VEDVKNEIYHQSFGPVYWVKTIEYLVAAGVDTIYEIGPGKVLSGLIKKINKEITVKNIET 296

Query: 302 VEDIDLAL 309
           +E+I+  +
Sbjct: 297 LEEIENLM 304


>gi|253681315|ref|ZP_04862113.1| malonyl CoA-acyl carrier protein transacylase [Clostridium
           botulinum D str. 1873]
 gi|253562553|gb|EES92004.1| malonyl CoA-acyl carrier protein transacylase [Clostridium
           botulinum D str. 1873]
          Length = 314

 Score =  193 bits (490), Expect = 3e-47,   Method: Composition-based stats.
 Identities = 116/313 (37%), Positives = 181/313 (57%), Gaps = 4/313 (1%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
                F GQG+Q +GMG++LYD+  E R VF + D  L   +SD+ + GS+EEL  T N 
Sbjct: 3   KIAFIFSGQGAQYVGMGKELYDNIEECREVFYKADKALGFPISDICFKGSKEELDRTENT 62

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPA+   S+A ++ +EK+G+        VAG SLGEY+AL  +  F   D + +V+ RGK
Sbjct: 63  QPAILTTSIAALKALEKSGV----KADIVAGLSLGEYSALVCSGVFDFQDAVTVVKKRGK 118

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCA 181
            MQE VP G+G+M AIIGLD   V   C +    GI E+AN N   Q+VI+G  +AV  A
Sbjct: 119 FMQEEVPEGVGAMAAIIGLDREKVSKACEECEEYGIVEVANYNCSSQIVIAGEINAVDKA 178

Query: 182 ADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSS 241
            ++    GAKR + L VSAPFH+S++    + +   L+ VT     +P++ N  A+ ++ 
Sbjct: 179 CESAKKLGAKRVIKLSVSAPFHTSMLKGAGEKLYKELEKVTLNHINIPVVTNVTANYITD 238

Query: 242 IDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISK 301
           I+++  +L  QV   V W + ++   N GV +  EVG GK L+G  K+I++ +  +++  
Sbjct: 239 INDVKDILRRQVMSSVLWEDIVKKMINEGVDTFIEVGPGKALSGFVKKINRKVKVLNVED 298

Query: 302 VEDIDLALRSIVG 314
           +  ++  +  + G
Sbjct: 299 LASLNKTIYELKG 311


>gi|89073425|ref|ZP_01159949.1| acyl carrier protein S-malonyltransferase [Photobacterium sp.
           SKA34]
 gi|89050912|gb|EAR56386.1| acyl carrier protein S-malonyltransferase [Photobacterium sp.
           SKA34]
          Length = 309

 Score =  193 bits (490), Expect = 3e-47,   Method: Composition-based stats.
 Identities = 119/309 (38%), Positives = 177/309 (57%), Gaps = 3/309 (0%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
              + FPGQGSQ +GM  +L + F   +  F E    L  +L  L+ NG  E+L  T   
Sbjct: 3   KFAIVFPGQGSQTVGMLAELAEQFDVVKETFSEASDALGYDLWALVQNGPVEDLNQTQRT 62

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPAL   S+A  R  ++ G       + +AGHSLGEY+AL  A        ++LV  RG+
Sbjct: 63  QPALLTASVAIWRAWQQQGGD---QPTLLAGHSLGEYSALVCAGVIDFKVAVKLVELRGQ 119

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCA 181
            MQEAVP G+G+M AIIGLD+  +   C +A++  +C   N N  GQVVI+G ++AV+ A
Sbjct: 120 LMQEAVPAGVGAMSAIIGLDNDAIAKACEEAAQGEVCSPVNFNSPGQVVIAGNKEAVERA 179

Query: 182 ADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSS 241
              C   GAKRA+ LPVS P H +LM P +  +   L+++    P VP++ N   +  + 
Sbjct: 180 NVLCKEAGAKRALPLPVSVPSHCALMKPAADKLAVALEAIEFNAPSVPVINNADVTTETD 239

Query: 242 IDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISK 301
              I   LV+Q+   VRW E+++  A  G++ + E+G GKVLTGL KRID++LS  +++ 
Sbjct: 240 PAAIKLALVKQLYSPVRWTESVELMAAEGIEELLEMGPGKVLTGLTKRIDRALSGAAVND 299

Query: 302 VEDIDLALR 310
           +  ++ A+ 
Sbjct: 300 IASLEAAMA 308


>gi|307730539|ref|YP_003907763.1| malonyl CoA-acyl carrier protein transacylase [Burkholderia sp.
           CCGE1003]
 gi|307585074|gb|ADN58472.1| malonyl CoA-acyl carrier protein transacylase [Burkholderia sp.
           CCGE1003]
          Length = 311

 Score =  193 bits (490), Expect = 3e-47,   Method: Composition-based stats.
 Identities = 135/310 (43%), Positives = 176/310 (56%), Gaps = 4/310 (1%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M     FPGQGSQ +GM     D     R   +E    LNQ+L  L+  G  E+L  T N
Sbjct: 1   MKFAFVFPGQGSQSVGMLNAFADQ-AIVRETVQEASDALNQDLGKLIAEGPAEDLNLTTN 59

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
            QP +   + A  R  ++ G       + VAGHSLGEYTAL AA A +  D + LVR R 
Sbjct: 60  TQPVMLTAAYAIYRAWQQAGG---PTPAIVAGHSLGEYTALVAAGAIAFRDAVPLVRFRA 116

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           ++MQ AVP G G M AI+GLDD  V ++CA+AS  G+ E  N N   QVVI+G + AV+ 
Sbjct: 117 QAMQTAVPVGEGGMAAILGLDDDTVRAVCAEASAAGVVEAVNFNAPAQVVIAGHKAAVEK 176

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A +    KGAKRA+ LPVSAPFHSSL+ P S  ++  L SV  Q P +P++ N   + V+
Sbjct: 177 ACEVAKAKGAKRALPLPVSAPFHSSLLKPASDQLREYLASVNVQVPSIPVINNVDVAIVN 236

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
              +I   LV Q  G VRW E++Q  A  GV  V E G GKVL GL KRID +L+  S+ 
Sbjct: 237 EPAQIKDALVRQAAGAVRWVESVQAMAAQGVTHVVECGPGKVLAGLTKRIDGNLTGASVF 296

Query: 301 KVEDIDLALR 310
               ++  L+
Sbjct: 297 DPASLEETLK 306


>gi|257452424|ref|ZP_05617723.1| malonyl-CoA-[acyl-carrier-protein] transacylase [Fusobacterium sp.
           3_1_5R]
 gi|317058967|ref|ZP_07923452.1| malonyl-CoA-[acyl-carrier-protein] transacylase [Fusobacterium sp.
           3_1_5R]
 gi|313684643|gb|EFS21478.1| malonyl-CoA-[acyl-carrier-protein] transacylase [Fusobacterium sp.
           3_1_5R]
          Length = 304

 Score =  193 bits (490), Expect = 3e-47,   Method: Composition-based stats.
 Identities = 104/308 (33%), Positives = 170/308 (55%), Gaps = 6/308 (1%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
                FPGQG+Q +GMG+DLY+  P A+ + +++  +L+ +L  +M+ G+ E+L  T   
Sbjct: 3   KVAFVFPGQGTQYVGMGKDLYEKSPRAKEILDKMFQSLDFDLKSIMFEGTAEDLKQTKYT 62

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPA+ A+S+  + + ++ G        YVAGHS+GEYTA  AA   S  + I L  ARG+
Sbjct: 63  QPAIVALSLTLMELAKEKG----LKADYVAGHSVGEYTAYGAAGMLSFEEAICLTAARGQ 118

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCA 181
            M +      G+M A++G+           A   G+ E  N N   Q VI+G + AV+ A
Sbjct: 119 IMNDVSEKVNGTMAAVLGMPA--EKIQEVLAGMDGVVEAVNFNEPNQTVIAGQKAAVEAA 176

Query: 182 ADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSS 241
                  GA+RA+ L VS PFHSSLM    + +K   +        + ++ N  A  ++S
Sbjct: 177 CLALKEAGARRALPLAVSGPFHSSLMKEAGEKLKEEAEKYHFSMTEIGLVANTTAEVLTS 236

Query: 242 IDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISK 301
           ++++   +  Q  G V W +TI++    GV ++YE+G GKVL+GL K+I+K ++  +I  
Sbjct: 237 VEDVKNEIYHQSFGPVYWVKTIEYLVAAGVDTIYEIGPGKVLSGLIKKINKEITVKNIET 296

Query: 302 VEDIDLAL 309
           +E+I+  +
Sbjct: 297 LEEIENLM 304


>gi|228922606|ref|ZP_04085906.1| Malonyl CoA-acyl carrier protein transacylase [Bacillus
           thuringiensis serovar huazhongensis BGSC 4BD1]
 gi|228837035|gb|EEM82376.1| Malonyl CoA-acyl carrier protein transacylase [Bacillus
           thuringiensis serovar huazhongensis BGSC 4BD1]
          Length = 314

 Score =  193 bits (490), Expect = 3e-47,   Method: Composition-based stats.
 Identities = 122/314 (38%), Positives = 181/314 (57%), Gaps = 5/314 (1%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
                FPGQGSQ +GMG+ L ++  E   VF + D  L  +LS++++ G QE+LT T NA
Sbjct: 3   KIAFLFPGQGSQAVGMGKQLAENNKEVAKVFAKADEVLQDSLSEVIFEGPQEKLTLTTNA 62

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPAL   S A +  +++  +       +VAGHSLGEY+AL AA A +  D +  VR RG+
Sbjct: 63  QPALLTTSFAILTALKEYDIT----PDFVAGHSLGEYSALVAAGALTFEDAVYAVRKRGE 118

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQAS-RVGICEIANDNGGGQVVISGLQDAVKC 180
            M+EAVP G G+M AI+G D  ++  +  + +      +IAN N   Q+VISG +  V+ 
Sbjct: 119 YMEEAVPGGEGAMAAILGADPHMLKQVTEEVTSEGYAVQIANMNSTKQIVISGTKQGVEV 178

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A+      GAKRA+ L VS PFHSSLM P ++  + +L+ +T  D  +P++ N  A  ++
Sbjct: 179 ASQRAKENGAKRAIPLKVSGPFHSSLMKPAAEKFQSVLNEITIHDTNIPVIANVTAEVIT 238

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
              +I   L+EQ+   V W  +I++  N GV    E+G GKVL GL K ID S+ A +I 
Sbjct: 239 RGADIQEKLIEQLYSPVLWYPSIEYMVNQGVDIFIEIGPGKVLAGLMKSIDSSVKAYAIY 298

Query: 301 KVEDIDLALRSIVG 314
             E +   + ++ G
Sbjct: 299 DEETLKDTISNLRG 312


>gi|229180128|ref|ZP_04307472.1| Malonyl CoA-acyl carrier protein transacylase [Bacillus cereus
           172560W]
 gi|228603337|gb|EEK60814.1| Malonyl CoA-acyl carrier protein transacylase [Bacillus cereus
           172560W]
          Length = 314

 Score =  193 bits (490), Expect = 3e-47,   Method: Composition-based stats.
 Identities = 121/314 (38%), Positives = 181/314 (57%), Gaps = 5/314 (1%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
                FPGQGSQ +GMG+ L ++  E   VF + D  L ++LS++++ G QE+LT T NA
Sbjct: 3   KIAFLFPGQGSQAVGMGKQLAENNKEVAKVFAKADEVLQESLSEVIFEGPQEKLTLTTNA 62

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPAL   S A +  +++  +       +VAGHSLGEY+AL AA A +  D +  VR RG+
Sbjct: 63  QPALLTTSFAILTALKEYDIT----PDFVAGHSLGEYSALVAAGALTFEDAVYAVRKRGE 118

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQAS-RVGICEIANDNGGGQVVISGLQDAVKC 180
            M+EAVP G G+M AI+G D  ++  +  + +      +IAN N   Q+VISG +  V+ 
Sbjct: 119 YMEEAVPGGEGAMAAILGADPHMLKQVTEEVTSEGYAVQIANMNSTKQIVISGTKQGVEV 178

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A+      GAKRA+ L VS PFHSSLM P ++  + +L+ +T  D  +P++ N  A  ++
Sbjct: 179 ASQRAKENGAKRAIPLKVSGPFHSSLMKPAAEKFQSVLNEITIHDTNIPVIANVTADVIT 238

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
              +I   L+EQ+   V W  +I+     GV +  E+G GKVL GL K ID S+ A +I 
Sbjct: 239 RGADIQEKLIEQLYSPVLWYPSIECMVKQGVDTFIEIGPGKVLAGLMKSIDSSVKAYAIY 298

Query: 301 KVEDIDLALRSIVG 314
             E +   + ++ G
Sbjct: 299 DEETLKDTISNLRG 312


>gi|27366282|ref|NP_761810.1| malonyl CoA-acyl carrier protein transacylase [Vibrio vulnificus
           CMCP6]
 gi|320156789|ref|YP_004189168.1| malonyl CoA-acyl carrier protein transacylase [Vibrio vulnificus
           MO6-24/O]
 gi|27362483|gb|AAO11337.1| malonyl CoA-acyl carrier protein transacylase [Vibrio vulnificus
           CMCP6]
 gi|319932101|gb|ADV86965.1| malonyl CoA-acyl carrier protein transacylase [Vibrio vulnificus
           MO6-24/O]
          Length = 307

 Score =  193 bits (490), Expect = 3e-47,   Method: Composition-based stats.
 Identities = 125/307 (40%), Positives = 177/307 (57%), Gaps = 3/307 (0%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
              + FPGQGSQ +GM  DL + +   +  F +    L  +L  L+ NG  E+L  T   
Sbjct: 3   KFAIVFPGQGSQAVGMLADLGEQYEIVKQTFAQASEALGYDLWALVQNGPAEDLNQTFRT 62

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPAL A S+A  RV ++ GL        +AGHSLGEY+AL  A      + I+LV  RG+
Sbjct: 63  QPALLASSVAIWRVWQELGLA---QPENLAGHSLGEYSALVCAGVIDFQEAIKLVELRGQ 119

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCA 181
            MQEAVP G G+M AIIGLDD  +   C +A++  +    N N  GQVVI+G +DAV+ A
Sbjct: 120 LMQEAVPAGTGAMYAIIGLDDEAIAKACEEAAQGEVVSPVNFNSPGQVVIAGSKDAVERA 179

Query: 182 ADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSS 241
              C   GAKRA+ LPVS P H +LM P ++ +   L+S+  + P +P++ N      + 
Sbjct: 180 GALCKEAGAKRALPLPVSVPSHCALMKPAAEKLAVALESIEFKAPQLPVINNVDVVAETD 239

Query: 242 IDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISK 301
             +I   LV Q+   VRW E+++  ++ GV+ + E+G GKVLTGL KRI KSL A +++ 
Sbjct: 240 PAKIKDALVRQLYSPVRWTESVELMSSQGVEKLLEMGPGKVLTGLTKRIVKSLEAAAVND 299

Query: 302 VEDIDLA 308
           V  +D  
Sbjct: 300 VASLDAV 306


>gi|219849849|ref|YP_002464282.1| malonyl CoA-acyl carrier protein transacylase [Chloroflexus
           aggregans DSM 9485]
 gi|219544108|gb|ACL25846.1| malonyl CoA-acyl carrier protein transacylase [Chloroflexus
           aggregans DSM 9485]
          Length = 319

 Score =  193 bits (489), Expect = 3e-47,   Method: Composition-based stats.
 Identities = 114/313 (36%), Positives = 164/313 (52%), Gaps = 5/313 (1%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           MS    FPGQGSQV+GMGRDL  + P AR +F   D TL+  LS+L ++G + +LTAT N
Sbjct: 1   MSIAWVFPGQGSQVVGMGRDLITASPAARQIFAIADETLDFGLSELCFSGPETDLTATEN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVR--- 117
           AQPAL   S+A +  + +           VAGHSLGEY+AL A  +      +RLVR   
Sbjct: 61  AQPALLTTSIALLAALREVSGDRLEPPIAVAGHSLGEYSALVAGGSLDFVTALRLVRRRG 120

Query: 118 --ARGKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQ 175
                                +  + D V  ++           IAN N   Q+VISG  
Sbjct: 121 ELMAAAHEGGMAAVIGLDADVLEQICDEVSATLQEHGVSQSTVVIANYNAPDQLVISGTS 180

Query: 176 DAVKCAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFC 235
            AV+ A+    ++GAKR + L VSA FHS LM   ++ M   +  V+ +D  +P++ N  
Sbjct: 181 VAVEHASLLAKSRGAKRVIPLKVSAAFHSPLMVDAAEGMAKAIAEVSIRDLDIPLIANVT 240

Query: 236 ASPVSSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLS 295
           A P+ S D++ R +V QV   VRW  ++++    GV++  E+G G+VLTGL +RI     
Sbjct: 241 AEPIRSTDDVRREIVAQVVAPVRWIASVRYMVAMGVETFIEIGPGRVLTGLIRRIAPEAR 300

Query: 296 AVSISKVEDIDLA 308
            ++I+  EDI   
Sbjct: 301 LINIATFEDIRAL 313


>gi|149183213|ref|ZP_01861659.1| acyl-carrier-protein S-malonyltransferase [Bacillus sp. SG-1]
 gi|148849078|gb|EDL63282.1| acyl-carrier-protein S-malonyltransferase [Bacillus sp. SG-1]
          Length = 315

 Score =  193 bits (489), Expect = 3e-47,   Method: Composition-based stats.
 Identities = 122/313 (38%), Positives = 182/313 (58%), Gaps = 5/313 (1%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
                FPGQGSQ  GMG++L + FP+    F++ D  L  +LS L++ G Q++LT T NA
Sbjct: 3   KIAFVFPGQGSQKAGMGKELSEKFPQVEEYFKKADQRLGFDLSTLIFEGPQDKLTLTENA 62

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPAL   S+AF++++E  G+       Y AGHSLGEY+AL AA A S  D +  VR RG+
Sbjct: 63  QPALLTTSIAFLQMLESEGV----KPDYTAGHSLGEYSALVAAGAISFEDGVYAVRKRGE 118

Query: 122 SMQEAVPPGLGSMVAII-GLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
            M+EAVP G G+M A++    D + +     ++      +AN N  GQ+VISG    V+ 
Sbjct: 119 YMEEAVPAGEGTMAAVLGMGRDQLSEITERISAEGNHVGLANLNCPGQIVISGSFRGVEL 178

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A+D    +GAKR + L VS PFHSS+M P ++    +LD +  +D  VP++ N  A P+ 
Sbjct: 179 ASDLAKEEGAKRVLPLQVSGPFHSSMMKPAAENFSGVLDEIAIRDAEVPVIANVNAEPMI 238

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
           S  EI   L++Q+   V W +T+    + GV +  E+G GKVL+GL K++++ ++  SIS
Sbjct: 239 SASEIKERLIQQLYSPVLWEDTVVKLLDAGVDTFIEIGPGKVLSGLIKKVNRRVNTFSIS 298

Query: 301 KVEDIDLALRSIV 313
             E     +  + 
Sbjct: 299 DEESFRDTVEKLK 311


>gi|209885491|ref|YP_002289348.1| malonyl CoA-acyl carrier protein transacylase [Oligotropha
           carboxidovorans OM5]
 gi|209873687|gb|ACI93483.1| malonyl CoA-acyl carrier protein transacylase [Oligotropha
           carboxidovorans OM5]
          Length = 318

 Score =  193 bits (489), Expect = 3e-47,   Method: Composition-based stats.
 Identities = 154/303 (50%), Positives = 208/303 (68%), Gaps = 1/303 (0%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M+   TFPGQGSQ +GMG+ L ++FP AR VF+EVD  L + LS ++W G  + L  T N
Sbjct: 1   MTAAFTFPGQGSQAVGMGKALAETFPAARAVFDEVDDALGEKLSTVIWEGPADALQLTEN 60

Query: 61  AQPALTAVSMAFIRVME-KNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRAR 119
            QPAL A+S+A +RV+E + G+ + RD ++VAGHSLGEY+AL AA++ S+ DT RL+R R
Sbjct: 61  TQPALMAMSLATLRVLETEAGIDLARDAAFVAGHSLGEYSALAAARSLSIVDTARLLRIR 120

Query: 120 GKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVK 179
           G +MQ+A P G+G+M A++GLD     ++  +A++  +C+ ANDNGGGQVV+SG + AV+
Sbjct: 121 GTAMQKATPVGVGAMAALLGLDYDTAVAVANEAAQGEVCQAANDNGGGQVVVSGDKAAVE 180

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            A +    KGA+RA+ L VSAPFH SLM P +  M   L  VT   PVVP++ N  ASPV
Sbjct: 181 RAVEIAKAKGARRAMLLQVSAPFHCSLMQPAADAMAEALGKVTVNKPVVPVVANMLASPV 240

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
           +  DEI + LVEQVTG VRWRE+I + A+ GV    E+GSGKVLTGL KRI      V++
Sbjct: 241 TDPDEIRKRLVEQVTGTVRWRESIAYMASQGVTHFLEIGSGKVLTGLVKRIADGAVGVAV 300

Query: 300 SKV 302
              
Sbjct: 301 GGP 303


>gi|325577416|ref|ZP_08147823.1| malonyl-CoA-[acyl-carrier-protein] transacylase [Haemophilus
           parainfluenzae ATCC 33392]
 gi|325160645|gb|EGC72768.1| malonyl-CoA-[acyl-carrier-protein] transacylase [Haemophilus
           parainfluenzae ATCC 33392]
          Length = 312

 Score =  193 bits (489), Expect = 3e-47,   Method: Composition-based stats.
 Identities = 127/312 (40%), Positives = 177/312 (56%), Gaps = 3/312 (0%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
              + FPGQGSQ +GM  DL + +P     F++    L  +L +L+  G  EEL  T   
Sbjct: 3   KFAMVFPGQGSQAVGMLADLANEYPVVTETFKQASEALGYDLWNLVQQGPAEELNKTWQT 62

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPAL A S+A  RV ++     +   S +AGHSLGEY+AL  A      D I+LV  RGK
Sbjct: 63  QPALLAASVAIFRVWQEK--YPQLQPSVMAGHSLGEYSALVCAGVIDFKDAIKLVELRGK 120

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCA 181
            MQ+AVP G G+M AIIGLD+  + + C QA +  +    N N  GQVVI+G ++AV+ A
Sbjct: 121 LMQQAVPEGTGAMYAIIGLDNEAIINACKQAEQGEVVSAVNFNSPGQVVIAGAKEAVERA 180

Query: 182 ADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSS 241
           A  C   GAKRA+ L VS P H +LM P +  +   L+ +T   P +P+L N      + 
Sbjct: 181 AALCKEAGAKRALPLAVSVPSHCALMKPAADQLAVTLEGITLNAPAIPVLNNVDVKAETE 240

Query: 242 IDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISK 301
             EI   L+ Q+   VRW ET++  A  GV+ + E+G GKVL GL KRI   L A S++ 
Sbjct: 241 SAEIRTALIRQLYSPVRWTETVEKMAQDGVEVLVEIGPGKVLNGLTKRIVAELQATSVND 300

Query: 302 VEDIDLALRSIV 313
           V  +D A+ +++
Sbjct: 301 VASLD-AVEALL 311


>gi|126452756|ref|YP_001067099.1| malonyl CoA-acyl carrier protein transacylase [Burkholderia
           pseudomallei 1106a]
 gi|167846669|ref|ZP_02472177.1| malonyl CoA-acyl carrier protein transacylase [Burkholderia
           pseudomallei B7210]
 gi|242317242|ref|ZP_04816258.1| malonyl CoA-acyl carrier protein transacylase [Burkholderia
           pseudomallei 1106b]
 gi|254195792|ref|ZP_04902218.1| malonyl CoA-acyl carrier protein transacylase [Burkholderia
           pseudomallei S13]
 gi|254296859|ref|ZP_04964312.1| malonyl CoA-acyl carrier protein transacylase [Burkholderia
           pseudomallei 406e]
 gi|126226398|gb|ABN89938.1| malonyl CoA-acyl carrier protein transacylase [Burkholderia
           pseudomallei 1106a]
 gi|157807915|gb|EDO85085.1| malonyl CoA-acyl carrier protein transacylase [Burkholderia
           pseudomallei 406e]
 gi|169652537|gb|EDS85230.1| malonyl CoA-acyl carrier protein transacylase [Burkholderia
           pseudomallei S13]
 gi|242140481|gb|EES26883.1| malonyl CoA-acyl carrier protein transacylase [Burkholderia
           pseudomallei 1106b]
          Length = 310

 Score =  193 bits (489), Expect = 3e-47,   Method: Composition-based stats.
 Identities = 132/313 (42%), Positives = 173/313 (55%), Gaps = 4/313 (1%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M     FPGQGSQ +GM     D     R   +E    L Q++  L+ +G  +EL  T N
Sbjct: 1   MKFAFVFPGQGSQSVGMLNAFAD-VAVVRETLDEASDALGQDIGKLIADGPADELNLTTN 59

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
            QP +   + A  R  ++ G       S VAGHSLGEYTAL AA A +  D + LVR R 
Sbjct: 60  TQPVMLTAAYACYRAWQQAGGA---QPSIVAGHSLGEYTALVAAGAIAFRDALPLVRFRA 116

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           ++MQ AVP G+G M AI+GLDD  V ++CA+AS  G+ E  N N   QVVI+G +  ++ 
Sbjct: 117 QAMQTAVPVGVGGMAAILGLDDDTVRAVCAEASATGVVEAVNFNAPAQVVIAGTKAGIEK 176

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A +    KGAKRA+ LPVSAPFHSSL+ P S  ++  L  V  + P + ++ N   + VS
Sbjct: 177 ACEIAKAKGAKRALPLPVSAPFHSSLLKPASDKLREYLAGVDVKAPKISVVNNIDVAVVS 236

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
               I   LV Q  G VRW E +Q  A  GV  V+E G GKVL GL KRID +L   S+ 
Sbjct: 237 DPAAIKDALVRQAAGPVRWVECVQHIAREGVTHVFECGPGKVLAGLTKRIDGNLVGASVF 296

Query: 301 KVEDIDLALRSIV 313
               +D AL+   
Sbjct: 297 DPASLDEALKLAA 309


>gi|170700229|ref|ZP_02891245.1| malonyl CoA-acyl carrier protein transacylase [Burkholderia
           ambifaria IOP40-10]
 gi|170134862|gb|EDT03174.1| malonyl CoA-acyl carrier protein transacylase [Burkholderia
           ambifaria IOP40-10]
          Length = 310

 Score =  193 bits (489), Expect = 3e-47,   Method: Composition-based stats.
 Identities = 135/310 (43%), Positives = 173/310 (55%), Gaps = 4/310 (1%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M     FPGQGSQ +GM     D     R   +E    LNQ+L  L+  G  EEL  T N
Sbjct: 1   MKFAFVFPGQGSQSVGMLNAFAD-LAIVRETLQEASDALNQDLGKLIAEGPAEELNLTTN 59

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
            QP +   +    R  ++ G       S VAGHSLGEYTAL AA A +  D + LVR R 
Sbjct: 60  TQPVMLTAAYVCYRAWQQAGG---PAPSIVAGHSLGEYTALVAAGAIAFKDAVPLVRFRA 116

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           ++MQ AVP G G M AI+GLDD  + ++CA+A+  G+ E  N N   QVVI+G + AV+ 
Sbjct: 117 QAMQTAVPVGQGGMAAILGLDDDTMRAVCAEAAEAGVVEAVNFNAPAQVVIAGAKAAVEK 176

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A +    KGAKRA+ LPVSAPFHSSL+ P S  ++  L +V  + P +P++ N   + VS
Sbjct: 177 ACEIAKAKGAKRALPLPVSAPFHSSLLKPASDQLRDYLANVDVKAPQIPVVNNIDVAVVS 236

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
               I   LV Q  G VRW E +Q  A  GV  V E G GKVL GL KRID +L   S+ 
Sbjct: 237 DPAAIKDALVRQAAGPVRWVECVQHIAGTGVTHVIECGPGKVLAGLTKRIDGNLVGASVF 296

Query: 301 KVEDIDLALR 310
               +D AL+
Sbjct: 297 DPASLDEALK 306


>gi|307544587|ref|YP_003897066.1| acyl carrier protein S-malonyltransferase [Halomonas elongata DSM
           2581]
 gi|307216611|emb|CBV41881.1| acyl carrier protein S-malonyltransferase [Halomonas elongata DSM
           2581]
          Length = 323

 Score =  193 bits (489), Expect = 3e-47,   Method: Composition-based stats.
 Identities = 114/304 (37%), Positives = 168/304 (55%), Gaps = 3/304 (0%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
           S  L FPGQGSQ IGM R+L + +      FEE    L  +L  ++  G  E L AT   
Sbjct: 4   SLALIFPGQGSQQIGMLRELAERYSVVGTTFEEASDALGYDLWQVVQEGPAESLNATACT 63

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPAL   S++  RV ++           +AGHSLGEY+A+  A A   ++ +RLV+ RG+
Sbjct: 64  QPALLTASVSIWRVWQE---LEGPRPVAMAGHSLGEYSAMVCAGALPFAEGVRLVKLRGE 120

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCA 181
           +MQ+AVP G G+M A++GLDD  V++ CA+A+   +    N N  GQVVI+G + AV  A
Sbjct: 121 AMQDAVPMGEGAMAAVLGLDDDTVEAACAKAAEGDVVAAVNYNAPGQVVIAGSKAAVDRA 180

Query: 182 ADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSS 241
              C   GAKRA+ LPVS P H  LM P +  +   + S+  + P   ++ N  A   + 
Sbjct: 181 IAACQEAGAKRAMPLPVSVPSHCDLMRPAADRLAEAMASIDLRAPRYTVIQNVDAEAHAD 240

Query: 242 IDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISK 301
           ++ +   L+EQ+   VRW   ++  +  G +   E G GKVLTGL KRI +    +S++ 
Sbjct: 241 VETLRTRLIEQLYQPVRWTSCVEALSGLGAEVFIECGPGKVLTGLNKRIARGSRGLSVND 300

Query: 302 VEDI 305
            + +
Sbjct: 301 PDSL 304


>gi|163847961|ref|YP_001636005.1| malonyl CoA-acyl carrier protein transacylase [Chloroflexus
           aurantiacus J-10-fl]
 gi|222525841|ref|YP_002570312.1| malonyl CoA-acyl carrier protein transacylase [Chloroflexus sp.
           Y-400-fl]
 gi|163669250|gb|ABY35616.1| malonyl CoA-acyl carrier protein transacylase [Chloroflexus
           aurantiacus J-10-fl]
 gi|222449720|gb|ACM53986.1| malonyl CoA-acyl carrier protein transacylase [Chloroflexus sp.
           Y-400-fl]
          Length = 318

 Score =  193 bits (489), Expect = 3e-47,   Method: Composition-based stats.
 Identities = 118/312 (37%), Positives = 171/312 (54%), Gaps = 4/312 (1%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           MS    FPGQGSQV+GMGRDL  + P AR +F   D TL+ NLS+L + G + +LTAT N
Sbjct: 1   MSIAWVFPGQGSQVVGMGRDLIAASPAARQIFATADETLDFNLSELCFCGPEADLTATAN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
           AQPAL   SMA +  M +           VAGHSLGEY+AL A  A      ++LVR RG
Sbjct: 61  AQPALLTTSMALLAAMTELLGDRLEQPIAVAGHSLGEYSALVAGGALDFKTALQLVRRRG 120

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICE----IANDNGGGQVVISGLQD 176
           + M  A    + +++ +       +    + A +         IAN N   Q+VISG   
Sbjct: 121 ELMAAAHEGSMAAVIGLDAAILEQICQEVSAALQNDHSHGTVVIANYNAPDQLVISGSVV 180

Query: 177 AVKCAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCA 236
           AV+ A+    ++GAKR + L VSA FHS LM   ++ M   +   T ++  +P++ N  A
Sbjct: 181 AVEHASMLAKSRGAKRVIPLKVSAAFHSPLMIEAAEGMAQAIAHATVRNLSIPLIANVTA 240

Query: 237 SPVSSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSA 296
            P+   D++ R +V QV   VRW  ++Q   + GV++  E+G GKVLTGL +RI  +   
Sbjct: 241 EPLYDADDVRREIVAQVVAPVRWIASVQRMVDLGVETFIEIGPGKVLTGLIRRIAPTARL 300

Query: 297 VSISKVEDIDLA 308
           ++++  ED+   
Sbjct: 301 INVATFEDVRAL 312


>gi|269139445|ref|YP_003296146.1| malonyl CoA-acyl carrier protein transacylase [Edwardsiella tarda
           EIB202]
 gi|267985106|gb|ACY84935.1| malonyl CoA-acyl carrier protein transacylase [Edwardsiella tarda
           EIB202]
 gi|304559341|gb|ADM42005.1| Malonyl CoA-acyl carrier protein transacylase [Edwardsiella tarda
           FL6-60]
          Length = 309

 Score =  193 bits (489), Expect = 4e-47,   Method: Composition-based stats.
 Identities = 128/312 (41%), Positives = 175/312 (56%), Gaps = 4/312 (1%)

Query: 1   MST-VLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATC 59
           MST  + FPGQGSQ +GM  DL   +P     F E    L  +L  L+  G  EEL  T 
Sbjct: 1   MSTFAMVFPGQGSQTVGMLADLAAQYPVVEQTFAEASEALGYDLWSLVQQGPAEELNKTW 60

Query: 60  NAQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRAR 119
             QPAL   S+A  RV ++N     +  + +AGHSLGEY+AL  A     +  +RLV  R
Sbjct: 61  QTQPALLTASVAIYRVWQQNHG---KQPAMMAGHSLGEYSALVCAGVLDFTQAVRLVELR 117

Query: 120 GKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVK 179
           GK MQ+AVP G G+M AIIGLD+  + + CA+A++  +    N N  GQVVI+G ++AV+
Sbjct: 118 GKLMQQAVPAGTGAMYAIIGLDNDAIAAACAEAAQGQVVAPVNFNSPGQVVIAGEKEAVE 177

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            A   C   GAKRA+ LPVS P H +LM P +  +   L ++    P  P++ N   +  
Sbjct: 178 RAGAACKAAGAKRALPLPVSVPSHCALMKPAADQLAEALKAIDFHAPSCPVINNVDVTAA 237

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
           S  D I   LV Q+   VRW ET+Q  A  GV  + E+G GKVLTGL KRI  +++A ++
Sbjct: 238 SDADAIRDALVRQLYSPVRWTETVQLMAAEGVDHLLEMGPGKVLTGLTKRIVDTMTAAAV 297

Query: 300 SKVEDIDLALRS 311
           +    +  AL  
Sbjct: 298 NDCASLTAALEQ 309


>gi|304316943|ref|YP_003852088.1| malonyl CoA-acyl carrier protein transacylase
           [Thermoanaerobacterium thermosaccharolyticum DSM 571]
 gi|302778445|gb|ADL69004.1| malonyl CoA-acyl carrier protein transacylase
           [Thermoanaerobacterium thermosaccharolyticum DSM 571]
          Length = 310

 Score =  193 bits (489), Expect = 4e-47,   Method: Composition-based stats.
 Identities = 126/312 (40%), Positives = 178/312 (57%), Gaps = 5/312 (1%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M     +PGQG+Q  GMG+++YD+F EAR +FEE + +L  +++ L + G  EEL  T N
Sbjct: 1   MKIAFIYPGQGAQYTGMGKEIYDNFSEAREIFEEANDSLGYDIARLCFEGPDEELMKTEN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
            QPA+  VS+A  +V+   G          AG SLGEY+AL  +   S  D +RLV+ RG
Sbjct: 61  TQPAILTVSIALTKVLSNKG----LKADVTAGLSLGEYSALVYSGVLSFKDAVRLVKKRG 116

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           + MQ AVP G+G M AIIGLD+  V++IC     VGI E AN N  GQ+ I+G   A++ 
Sbjct: 117 EYMQNAVPIGIGGMAAIIGLDNETVENICCDVKDVGIVEPANYNCPGQLSIAGEIKALEK 176

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A +    KGAK+AV LPVSAPFH S++      ++  L  +   D  VP++ N  A    
Sbjct: 177 AVEIAKAKGAKKAVMLPVSAPFHCSMLKEAGFKLEEDLKEIYTYDMSVPVITNVTADYER 236

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
             +    L V+QV+  V W ++I+      V +  E+G GK LTG  KRIDK+  AV+  
Sbjct: 237 IDEVKKML-VKQVSSPVLWEQSIRRMIEDHVDTFIEIGPGKTLTGFMKRIDKTKKAVNFE 295

Query: 301 KVEDIDLALRSI 312
            +  +D  L S+
Sbjct: 296 DMGTLDKLLSSL 307


>gi|241662593|ref|YP_002980953.1| cyclic nucleotide-binding protein [Ralstonia pickettii 12D]
 gi|309781175|ref|ZP_07675912.1| malonyl CoA-acyl carrier protein transacylase [Ralstonia sp.
           5_7_47FAA]
 gi|240864620|gb|ACS62281.1| cyclic nucleotide-binding protein [Ralstonia pickettii 12D]
 gi|308919996|gb|EFP65656.1| malonyl CoA-acyl carrier protein transacylase [Ralstonia sp.
           5_7_47FAA]
          Length = 309

 Score =  193 bits (489), Expect = 4e-47,   Method: Composition-based stats.
 Identities = 132/313 (42%), Positives = 170/313 (54%), Gaps = 4/313 (1%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M+    FPGQGSQ +GM     D  P       E    L Q++  L+  G  EEL  T N
Sbjct: 1   MTFAFVFPGQGSQSVGMLNAFAD-HPAVAATLAEASDALGQDIGKLIAEGPAEELNLTTN 59

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
            QP +   ++A  R  +  G       + VAGHSLGEY+AL AA A +  D + LVR R 
Sbjct: 60  TQPVMLTAAVAVYRAWQAAGG---PTPTVVAGHSLGEYSALVAAGAIAFKDAVPLVRFRA 116

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           K+MQEAVP G G M AI+GL D  V + CA+AS  G+ E  N N   QVVI+G + AV+ 
Sbjct: 117 KAMQEAVPVGEGGMAAILGLSDDDVRAACAEASVAGVVEAVNFNAPAQVVIAGAKAAVEK 176

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A +    KGAKRA+ LPVSAPFHSSL+ P S  ++  L +VT   PV+P++ N   + VS
Sbjct: 177 ACEIAKAKGAKRALPLPVSAPFHSSLLKPASDRLREYLANVTVNAPVIPVINNVDVAVVS 236

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
               I   LV Q    VRW ET+Q     G+  V E G GKVL GL KRID  +   +I 
Sbjct: 237 DPAAIKDALVRQAASPVRWVETVQKMKGDGITRVVECGPGKVLAGLVKRIDGEIVGDAIF 296

Query: 301 KVEDIDLALRSIV 313
               ++  L  + 
Sbjct: 297 DPASLEAVLGQLK 309


>gi|148255214|ref|YP_001239799.1| [acyl-carrier-protein] S-malonyltransferase [Bradyrhizobium sp.
           BTAi1]
 gi|146407387|gb|ABQ35893.1| [Acyl-carrier-protein] S-malonyltransferase [Bradyrhizobium sp.
           BTAi1]
          Length = 319

 Score =  193 bits (489), Expect = 4e-47,   Method: Composition-based stats.
 Identities = 159/303 (52%), Positives = 207/303 (68%), Gaps = 1/303 (0%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M+   TFPGQGSQ +GMG+ L D+FP AR VFEEVD  L + L+ ++W G  E L  T N
Sbjct: 1   MTAAFTFPGQGSQAVGMGKALADAFPVARAVFEEVDTALGEKLTAIIWEGPAETLQLTEN 60

Query: 61  AQPALTAVSMAFIRVME-KNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRAR 119
           AQPAL AVSMA +RV+E + G  V RD ++VAGHSLGEY+AL AA + S++DT RL+R R
Sbjct: 61  AQPALMAVSMAALRVLEAEAGFSVGRDAAFVAGHSLGEYSALAAAGSLSIADTARLLRTR 120

Query: 120 GKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVK 179
           G +MQ+AVP G+G+M A++G+D     ++  +A++  +C+ ANDNGGGQVV+SG + AV 
Sbjct: 121 GLAMQKAVPVGVGAMAALLGMDYETAVAVAEEAAQGEVCQAANDNGGGQVVVSGNKAAVD 180

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            A D    KGAKRA+ LPVSAPFH  LM P + VM   L  VT + P  P++ N  A+P+
Sbjct: 181 RAVDIARAKGAKRAMLLPVSAPFHCKLMQPAADVMAEALSKVTIKAPASPLVSNVLAAPI 240

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
           S  DEI R LVEQVTG VRWRE I + A  GV   +E+G+GKVL+GL KRI      V++
Sbjct: 241 SDPDEIRRRLVEQVTGTVRWREAIAYMAGQGVTRFFEIGAGKVLSGLVKRIADGAVGVAV 300

Query: 300 SKV 302
              
Sbjct: 301 GGP 303


>gi|172060057|ref|YP_001807709.1| malonyl CoA-acyl carrier protein transacylase [Burkholderia
           ambifaria MC40-6]
 gi|171992574|gb|ACB63493.1| malonyl CoA-acyl carrier protein transacylase [Burkholderia
           ambifaria MC40-6]
          Length = 310

 Score =  193 bits (489), Expect = 4e-47,   Method: Composition-based stats.
 Identities = 137/310 (44%), Positives = 173/310 (55%), Gaps = 4/310 (1%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M     FPGQGSQ +GM     D     R   +E    LNQ+L  L+  G  EEL  T N
Sbjct: 1   MKFAFVFPGQGSQSVGMLNAFAD-LAVVRETLQEASDALNQDLGKLIAEGPAEELNLTTN 59

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
            QP +   + A  R  ++ G       S VAGHSLGEYTAL AA A +  D + LVR R 
Sbjct: 60  TQPVMLTAAYACYRAWQQAGG---PAPSIVAGHSLGEYTALVAAGAIAFKDAVPLVRFRA 116

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           ++MQ AVP G G M AI+GLDD  V ++CA+A+  G+ E  N N   QVVI+G + AV+ 
Sbjct: 117 QAMQTAVPVGQGGMAAILGLDDDTVRAVCAEAAEAGVVEAVNFNAPAQVVIAGAKAAVEK 176

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A +    KGAKRA+ LPVSAPFHSSL+ P S  ++  L  V  + P +P++ N   + VS
Sbjct: 177 ACEIAKAKGAKRALPLPVSAPFHSSLLKPASDQLRDYLADVDVKAPQIPVVNNIDVAVVS 236

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
               I   LV Q  G VRW E +Q  A  GV  V E G GKVL GL KRID +L   S+ 
Sbjct: 237 DPAAIKDALVRQAAGPVRWVECMQHIAGTGVTHVIECGPGKVLAGLTKRIDGNLVGASVF 296

Query: 301 KVEDIDLALR 310
               +D AL+
Sbjct: 297 DPASLDEALK 306


>gi|270261344|ref|ZP_06189617.1| malonyl CoA-acyl carrier protein transacylase [Serratia odorifera
           4Rx13]
 gi|270044828|gb|EFA17919.1| malonyl CoA-acyl carrier protein transacylase [Serratia odorifera
           4Rx13]
          Length = 309

 Score =  192 bits (488), Expect = 4e-47,   Method: Composition-based stats.
 Identities = 126/312 (40%), Positives = 171/312 (54%), Gaps = 4/312 (1%)

Query: 1   MS-TVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATC 59
           M+     FPGQGSQ +GM  DL   FP     F E    L  +L  L+  G  EEL  T 
Sbjct: 1   MTQFAFVFPGQGSQALGMLADLAAQFPIVEETFSEASSALGYDLWQLVQQGPAEELNKTW 60

Query: 60  NAQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRAR 119
             QPAL A S+A  RV ++ G       + +AGHSLGEY+AL  A        IRLV  R
Sbjct: 61  QTQPALLAASVAIFRVWQQQGGKA---PAMMAGHSLGEYSALVCAGVLDFQAAIRLVELR 117

Query: 120 GKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVK 179
           GK MQEAVP G G+M AIIGL++  +   C ++++  +    N N  GQVVI+G ++AV+
Sbjct: 118 GKLMQEAVPEGTGAMFAIIGLNNEAIAKACEESAQGQVVSPVNFNSPGQVVIAGNKEAVE 177

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            A   C   GAKR++ LPVS P H +LM P +  +   L  +T   P V ++ N      
Sbjct: 178 RAGAACKAAGAKRSLPLPVSVPSHCALMKPAADKLAVALQEITFSAPQVAVVNNVDVRTE 237

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
           +  + I   LV Q+   VRW E++++ A  GV S+ EVG GKVLTGL KRI  +L+A ++
Sbjct: 238 TDPEAIRSALVRQLYSPVRWTESVEFMAAQGVTSLLEVGPGKVLTGLTKRIVDTLTAAAV 297

Query: 300 SKVEDIDLALRS 311
           +    +  AL  
Sbjct: 298 NDAASLSAALEQ 309


>gi|307704274|ref|ZP_07641193.1| malonyl CoA-acyl carrier protein transacylase [Streptococcus mitis
           SK597]
 gi|307622185|gb|EFO01203.1| malonyl CoA-acyl carrier protein transacylase [Streptococcus mitis
           SK597]
          Length = 307

 Score =  192 bits (488), Expect = 4e-47,   Method: Composition-based stats.
 Identities = 110/310 (35%), Positives = 166/310 (53%), Gaps = 6/310 (1%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
            T   F GQG+Q +GMGRDLYD +P  +   ++    L  +L  L+ +  +E+L  T   
Sbjct: 3   KTAFLFAGQGAQYLGMGRDLYDHYPIVKETIDQASQVLGYDLRHLI-DTEEEKLNQTRYT 61

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPA+ A S+A  R++++ G         VAG SLGEY+AL A+ A    D + LV  RG 
Sbjct: 62  QPAILATSVAIYRLLQEKGY----QPDMVAGLSLGEYSALVASGALDFEDAVALVAKRGA 117

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCA 181
            M+EA P G G MVA++     V++  C +A+ +G+   AN N   Q+VI G   AV  A
Sbjct: 118 FMEEAAPAGSGKMVAVLNTPVEVIEEACQKAAELGVVTPANYNTPAQIVIGGEVIAVDRA 177

Query: 182 ADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSS 241
            +     GAKR + L VS PFH++L+ P S+ +   L  V+  D     L     + V  
Sbjct: 178 VELLQEAGAKRLIPLKVSGPFHTALLEPASQKLAETLAQVSFSD-FTCPLVGNTEAAVMK 236

Query: 242 IDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISK 301
            ++I++LL  QV   VR+ E+I      GV +  E+G GKVL+G  K+IDK++   ++  
Sbjct: 237 KEDIAQLLTRQVKEPVRFYESIAVMQEAGVTNFIEIGPGKVLSGFVKKIDKTVKLANVED 296

Query: 302 VEDIDLALRS 311
              ++  L +
Sbjct: 297 QASLEALLEN 306


>gi|307131535|ref|YP_003883551.1| malonyl-CoA-[acyl-carrier-protein] transacylase [Dickeya dadantii
           3937]
 gi|306529064|gb|ADM98994.1| malonyl-CoA-[acyl-carrier-protein] transacylase [Dickeya dadantii
           3937]
          Length = 309

 Score =  192 bits (488), Expect = 4e-47,   Method: Composition-based stats.
 Identities = 131/312 (41%), Positives = 179/312 (57%), Gaps = 4/312 (1%)

Query: 1   MST-VLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATC 59
           M+T  + FPGQGSQ +GM  +L + FP  R  F+E    L  +L  L   G  EEL  T 
Sbjct: 1   MTTFAMVFPGQGSQSVGMLAELAEKFPLIRETFDEASSVLGYDLWQLSQQGPAEELNKTW 60

Query: 60  NAQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRAR 119
             QPAL   S+A  RV  + G  +    + ++GHSLGEY+AL  A        + LV  R
Sbjct: 61  QTQPALLTASVALWRVWRQQGGAL---PTLMSGHSLGEYSALVCAGVLEFKQAVSLVELR 117

Query: 120 GKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVK 179
           GK MQEAVP G G+M AIIGLD+  + + CA+A++  +    N N  GQVVI+G ++AV+
Sbjct: 118 GKLMQEAVPEGTGAMYAIIGLDNDAIAAACAEAAQGQVVSPVNFNSPGQVVIAGNKEAVE 177

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            A   C   GAKRA+ LPVS P H +LM P ++ +   L+++T   P VP++ N      
Sbjct: 178 RAGAACKAAGAKRALPLPVSVPSHCALMEPAARKLADALEAMTFNAPDVPVVNNVDVRAE 237

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
           S+ + I   LV Q+   VRW E +++ A  GV S+ EVG GKVLTGL KRI  SL+A +I
Sbjct: 238 SAPEAIRSALVRQLHNPVRWTECVEYMAAQGVVSLVEVGPGKVLTGLTKRIVDSLTATAI 297

Query: 300 SKVEDIDLALRS 311
           +    +  AL  
Sbjct: 298 NDPASLSAALEQ 309


>gi|296158246|ref|ZP_06841078.1| malonyl CoA-acyl carrier protein transacylase [Burkholderia sp.
           Ch1-1]
 gi|295891582|gb|EFG71368.1| malonyl CoA-acyl carrier protein transacylase [Burkholderia sp.
           Ch1-1]
          Length = 311

 Score =  192 bits (488), Expect = 4e-47,   Method: Composition-based stats.
 Identities = 135/313 (43%), Positives = 174/313 (55%), Gaps = 4/313 (1%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M     FPGQGSQ +GM     D     R   +E    LNQ+L  L+  G  E+L  T N
Sbjct: 1   MKFAFVFPGQGSQSVGMLNAFAD-HAVVRETVQEASDALNQDLGKLIAEGPAEDLNLTTN 59

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
            QP +   S A  R   + G       + VAGHSLGEYTAL AA A +  D + LVR R 
Sbjct: 60  TQPVMLTASYAMYRAWLQAGG---PKPAIVAGHSLGEYTALVAAGAIAFRDAVPLVRFRA 116

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           ++MQ AVP G G M AI+GLDD  V ++CA+AS  G+ E  N N   QVVI+G + AV+ 
Sbjct: 117 QAMQTAVPVGEGGMAAILGLDDDTVRAVCAEASAAGVVEAVNFNAPAQVVIAGNKAAVEK 176

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A +    KGAKRA+ LPVSAPFHSSL+ P S  ++  L SV  Q P +P++ N   + V+
Sbjct: 177 ACEVAKAKGAKRALPLPVSAPFHSSLLKPASDQLREYLASVDVQVPAIPVINNVDVAVVN 236

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
               I   LV Q  G VRW E+++  +  GV  V E G GKVL GL KRID +L   SI 
Sbjct: 237 EPAGIKDALVRQAAGAVRWVESVRAMSAQGVTHVIECGPGKVLAGLTKRIDGNLVGASIF 296

Query: 301 KVEDIDLALRSIV 313
               ++  L+ + 
Sbjct: 297 DPASLEETLKLVK 309


>gi|303237219|ref|ZP_07323789.1| [acyl-carrier-protein] S-malonyltransferase [Prevotella disiens
           FB035-09AN]
 gi|302482606|gb|EFL45631.1| [acyl-carrier-protein] S-malonyltransferase [Prevotella disiens
           FB035-09AN]
          Length = 295

 Score =  192 bits (488), Expect = 4e-47,   Method: Composition-based stats.
 Identities = 105/301 (34%), Positives = 152/301 (50%), Gaps = 7/301 (2%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M     FPGQGSQ +GMG+DLYD+ P A+ +F++ D  L   ++D+M+ G+ E+L  T  
Sbjct: 1   MK-AFVFPGQGSQFVGMGKDLYDTNPLAKELFDKADAILGFKITDIMFAGTDEQLKQTNV 59

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
            QPA+   S+     +       +     VAGHSLGE++AL AA A S  D ++LV  R 
Sbjct: 60  TQPAVFLHSVISALCL-----GDEFKPEMVAGHSLGEFSALVAAGALSFEDGLKLVALRA 114

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQV-VISGLQDAVK 179
             MQ+A     G+M AIIG+ D  V  IC Q +  G   +A +       VISG ++ + 
Sbjct: 115 NCMQKACELNPGTMAAIIGVADEKVVEICEQVTNEGKMVVAANFNCPGQLVISGSKEGID 174

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            A +     GAKRA+ L V   FHS  M      ++  +++     P   +  N  A P 
Sbjct: 175 AACELLKAAGAKRALPLKVGGAFHSPFMQSAKDELQAGIEATNIAAPKCAVYQNVDAKPH 234

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
           +   EI   L+ Q+T  VRW  ++Q     G     E G GK L G+  RIDK ++A  +
Sbjct: 235 TDPAEIKANLIAQLTSSVRWTASVQNMIADGATEFVECGPGKALQGMIGRIDKGVNAHGV 294

Query: 300 S 300
            
Sbjct: 295 E 295


>gi|298291084|ref|YP_003693023.1| malonyl CoA-acyl carrier protein transacylase [Starkeya novella DSM
           506]
 gi|296927595|gb|ADH88404.1| malonyl CoA-acyl carrier protein transacylase [Starkeya novella DSM
           506]
          Length = 316

 Score =  192 bits (488), Expect = 4e-47,   Method: Composition-based stats.
 Identities = 151/303 (49%), Positives = 202/303 (66%), Gaps = 1/303 (0%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           MS+   FPGQGSQ +GMG+ L D F  AR VFEEVD  L + LS +MW+G  E LT T N
Sbjct: 1   MSSAFVFPGQGSQAVGMGKALADEFAVARAVFEEVDEALGEKLSSVMWDGPIETLTLTAN 60

Query: 61  AQPALTAVSMAFIRVMEKN-GLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRAR 119
            QPAL A S+A +RV+E   GL +KRD ++VAGHSLGEY+AL AA + S++DT RL+R R
Sbjct: 61  TQPALMAASLAALRVLESEAGLDLKRDAAFVAGHSLGEYSALAAAGSISIADTARLLRLR 120

Query: 120 GKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVK 179
           G +MQ A P G G+M AI+GLD   V ++ A+A++  +C+IANDN  GQVV+SG   AV+
Sbjct: 121 GTAMQAATPVGTGAMAAILGLDFDKVAAVAAEAAQGEVCDIANDNAPGQVVVSGNAAAVE 180

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            A +    +GA RA+ L VSAPFH SL+   +  M+  L  V  + P V ++ N  A+PV
Sbjct: 181 RACEIAKREGAMRAILLTVSAPFHCSLIASAADAMREALAGVEVRAPKVLLVANVTAAPV 240

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
               EI  LLV+QVT  VRWRE++ + A  GV  + EVG+GKVL+GL KRI + ++A ++
Sbjct: 241 VDPAEIRALLVKQVTSTVRWRESVAFMAEQGVTRLVEVGTGKVLSGLTKRIARHVAAANV 300

Query: 300 SKV 302
              
Sbjct: 301 GTP 303


>gi|218230903|ref|YP_002368653.1| malonyl CoA-acyl carrier protein transacylase [Bacillus cereus
           B4264]
 gi|218158860|gb|ACK58852.1| malonyl CoA-acyl carrier protein transacylase [Bacillus cereus
           B4264]
          Length = 314

 Score =  192 bits (488), Expect = 4e-47,   Method: Composition-based stats.
 Identities = 121/314 (38%), Positives = 182/314 (57%), Gaps = 5/314 (1%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
                FPGQGSQ +GMG+ L ++  E   VF + D  L  +LS++++ G QE+LT T NA
Sbjct: 3   KIAFLFPGQGSQAVGMGKQLAENNKEVAKVFAKADEVLEDSLSEVIFEGPQEKLTLTTNA 62

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPAL   S A +  +++  +       +VAGHSLGEY+AL AA A +  D +  VR RG+
Sbjct: 63  QPALLTTSFAILTALKEYDIT----PDFVAGHSLGEYSALVAAGALTFEDAVYAVRKRGE 118

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQAS-RVGICEIANDNGGGQVVISGLQDAVKC 180
            M+EAVP G G+M AI+G D  ++  +  + +      +IAN N   Q+VISG +  V+ 
Sbjct: 119 YMEEAVPGGEGAMAAILGADPHMLKQVTEEVTSEGYAVQIANMNSTKQIVISGTKQGVEV 178

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A+      GAKRA+ L VS PFHSSLM P ++  + +L+ +T  D  +P++ N  A  ++
Sbjct: 179 ASQRAKENGAKRAIPLKVSGPFHSSLMKPAAEKFQSVLNEITIHDTNIPVIANVTAEVIT 238

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
              +I   L+EQ+   V W  +I++  + GV +  E+G GKVL GL K ID S+ A +I 
Sbjct: 239 RGADIQEKLIEQLYSPVLWYPSIEYMVSQGVDTFIEIGPGKVLAGLMKSIDSSVKAYAIY 298

Query: 301 KVEDIDLALRSIVG 314
             E +   + ++ G
Sbjct: 299 DEETLKDTISNLRG 312


>gi|300691985|ref|YP_003752980.1| Malonyl CoA-acyl carrier protein transacylase [Ralstonia
           solanacearum PSI07]
 gi|299079045|emb|CBJ51707.1| Malonyl CoA-acyl carrier protein transacylase [Ralstonia
           solanacearum PSI07]
          Length = 309

 Score =  192 bits (488), Expect = 4e-47,   Method: Composition-based stats.
 Identities = 129/313 (41%), Positives = 168/313 (53%), Gaps = 4/313 (1%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M+    FPGQGSQ +GM     D  P       E    L Q++  L+  G  +EL  T N
Sbjct: 1   MTFAFVFPGQGSQSVGMLNAFAD-HPAVAATLAEASDALGQDIGRLIAEGPADELNLTAN 59

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
            QP +   ++A  R  +  G       + VAGHSLGEY+AL AA A +  D + LVR R 
Sbjct: 60  TQPVMLTAAVAVYRAWQAAGG---PAPTVVAGHSLGEYSALVAAGAIAFKDAVPLVRFRA 116

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           K+MQEAVP G G M AI+GL D  V + CA+AS  G+ E  N N   QVVI+G + AV+ 
Sbjct: 117 KAMQEAVPVGEGGMAAILGLSDDDVRAACAEASIAGVVEAVNFNAPAQVVIAGAKAAVEK 176

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A +    KGAKRA+ LPVSAPFHSSL+ P S  ++  L +VT   P +P++ N     V+
Sbjct: 177 ACEVAKAKGAKRALPLPVSAPFHSSLLKPASDRLREHLANVTVSAPSIPVINNVDVVVVN 236

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
               I   LV Q    VRW ET+Q     G+  V E G GKVL GL KRID  +   +I 
Sbjct: 237 DPAAIKDALVRQAASPVRWVETVQKMKADGITRVVECGPGKVLAGLTKRIDGDIVGDAIF 296

Query: 301 KVEDIDLALRSIV 313
               ++  L  + 
Sbjct: 297 DPASLEAVLAQLK 309


>gi|221201339|ref|ZP_03574378.1| malonyl CoA-acyl carrier protein transacylase [Burkholderia
           multivorans CGD2M]
 gi|221208819|ref|ZP_03581817.1| malonyl CoA-acyl carrier protein transacylase [Burkholderia
           multivorans CGD2]
 gi|221171275|gb|EEE03724.1| malonyl CoA-acyl carrier protein transacylase [Burkholderia
           multivorans CGD2]
 gi|221178607|gb|EEE11015.1| malonyl CoA-acyl carrier protein transacylase [Burkholderia
           multivorans CGD2M]
          Length = 332

 Score =  192 bits (488), Expect = 5e-47,   Method: Composition-based stats.
 Identities = 137/310 (44%), Positives = 175/310 (56%), Gaps = 4/310 (1%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M     FPGQGSQ +GM     D     R   +E    LNQ+L  L+  G  EEL  T N
Sbjct: 23  MKFAFVFPGQGSQSVGMLNAFAD-LAVVRETLQEASDALNQDLGKLIAEGPAEELNLTTN 81

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
            QP +   + A  R  ++ G       S VAGHSLGEYTAL AA A +  D + LVR R 
Sbjct: 82  TQPVMLTAAYACYRAWQQAGG---PAPSIVAGHSLGEYTALVAAGAIAFKDAVPLVRFRA 138

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           ++MQ AVP G G M AI+GLDD  V ++CA+AS  G+ E  N N   QVVI+G + AV+ 
Sbjct: 139 QAMQTAVPVGQGGMAAILGLDDDTVRAVCAEASSEGVVEAVNFNAPAQVVIAGAKAAVEK 198

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A +    KGAKRA+ LPVSAPFHSSL+ P S  ++  L +V  + P +P++ N   + VS
Sbjct: 199 ACEVAKAKGAKRALPLPVSAPFHSSLLKPASDQLRDYLANVEVKAPQIPVVNNIDVAVVS 258

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
               I   LV Q  G VRW E ++  A  GV  V E G GKVL GL KRID +L+  S+ 
Sbjct: 259 DPAAIKDALVRQAAGPVRWVECVKHIAGTGVTHVIECGPGKVLAGLTKRIDGNLTGASVF 318

Query: 301 KVEDIDLALR 310
               +D AL+
Sbjct: 319 DPASLDEALK 328


>gi|77463234|ref|YP_352738.1| [Acyl-carrier-protein] S-malonyltransferase [Rhodobacter
           sphaeroides 2.4.1]
 gi|77387652|gb|ABA78837.1| [Acyl-carrier-protein] S-malonyltransferase [Rhodobacter
           sphaeroides 2.4.1]
          Length = 310

 Score =  192 bits (488), Expect = 5e-47,   Method: Composition-based stats.
 Identities = 157/311 (50%), Positives = 207/311 (66%), Gaps = 1/311 (0%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           MS    FPGQG+Q IGMGR L +++P AR VF+EVD  L + LS L+W+GS EELT T N
Sbjct: 1   MSRAFVFPGQGAQTIGMGRALAEAYPAARAVFDEVDEALGEKLSALIWDGSIEELTLTQN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
           AQPAL A SMA +  +E  GL +    S+VAGHSLGEY+ALCAAK+  LSDT RL+R RG
Sbjct: 61  AQPALMATSMAALAALEVEGLGI-ATASFVAGHSLGEYSALCAAKSLKLSDTARLLRIRG 119

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           ++MQEAVP G+G+M A++GLD      +  +A++  +C+ ANDN   QVV+SG + AV+ 
Sbjct: 120 QAMQEAVPVGVGAMAALLGLDYDTAVEVAHEAAQGEVCQAANDNDPAQVVVSGHKAAVER 179

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A +    +GAKRA+ LPVSAPFH +LM   + VM   L +V  + PV P++ N  A  VS
Sbjct: 180 AVEIAKGRGAKRAILLPVSAPFHCALMQHAASVMSEALAAVVIEAPVCPVVVNVRAEAVS 239

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
             D I  LLV QVTG VRWRE++ W  N GV   +E+G+GK L+G+ KRI K  +  +I 
Sbjct: 240 EPDRIRALLVAQVTGAVRWRESVMWMENAGVDEFWEIGAGKALSGMIKRIAKGAATRAIG 299

Query: 301 KVEDIDLALRS 311
             ED+  A  +
Sbjct: 300 TPEDVAAAATA 310


>gi|259418798|ref|ZP_05742715.1| malonyl CoA-acyl carrier protein transacylase [Silicibacter sp.
           TrichCH4B]
 gi|259345020|gb|EEW56874.1| malonyl CoA-acyl carrier protein transacylase [Silicibacter sp.
           TrichCH4B]
          Length = 311

 Score =  192 bits (488), Expect = 5e-47,   Method: Composition-based stats.
 Identities = 148/309 (47%), Positives = 204/309 (66%), Gaps = 2/309 (0%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           MS    FPGQG+Q IGMG+ L D++P A+ VF+EVD  L ++LS L+W G  E LT T N
Sbjct: 1   MSIAFVFPGQGAQTIGMGKALADAYPAAKAVFDEVDAALGESLSSLIWEGDIETLTLTQN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
           AQPAL A SMA +R +E  G+ +    ++VAGHSLGEY+AL A+ A S++DT RL+R RG
Sbjct: 61  AQPALMATSMAAMRALEAEGVSID-KAAFVAGHSLGEYSALAASGALSIADTARLLRTRG 119

Query: 121 KSMQEAVPPGLGSMVAIIGLD-DCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVK 179
           ++MQ AVP G+G+M A++GLD + V       A+   + + ANDN   QVV+SG + AV+
Sbjct: 120 QAMQSAVPVGVGAMAALLGLDFETVKAVAAEAAAEGEVVQAANDNDPTQVVVSGHKAAVE 179

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            AA+    KGAKRAV LPVSAPFH +LM P + VM   L  V  + P VP++ N  A  V
Sbjct: 180 RAAEIAKEKGAKRAVMLPVSAPFHCALMQPAADVMAEALAGVEIKAPAVPLIANVRADAV 239

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
           +  D I +LLVEQVTG VRWRE+++  A  GV   +E+G+GK L+G+ ++ID++L +  +
Sbjct: 240 TDPDTIRQLLVEQVTGSVRWRESVEAMAAKGVIEFWEIGAGKALSGMIRKIDRALVSKQV 299

Query: 300 SKVEDIDLA 308
               D+   
Sbjct: 300 GTDADVKAV 308


>gi|167619223|ref|ZP_02387854.1| malonyl CoA-acyl carrier protein transacylase [Burkholderia
           thailandensis Bt4]
          Length = 309

 Score =  192 bits (488), Expect = 5e-47,   Method: Composition-based stats.
 Identities = 131/313 (41%), Positives = 173/313 (55%), Gaps = 4/313 (1%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M     FPGQGSQ +GM     D     R   +E    L Q++  L+ +G  +EL  T N
Sbjct: 1   MKFAFVFPGQGSQSVGMLNAFAD-VAVVRETLDEASDALGQDIGKLIADGPADELNLTTN 59

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
            QP +   + A  R  ++ G       S VAGHSLGEYTAL AA A +  D + LVR R 
Sbjct: 60  TQPVMLTAAYACYRAWQQAGGA---QASIVAGHSLGEYTALVAAGAIAFRDALPLVRFRA 116

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           ++MQ AVP G+G M AI+GLDD  V ++CA+AS  G+ E  N N   QVVI+G +  ++ 
Sbjct: 117 QAMQTAVPVGVGGMAAILGLDDDTVRAVCAEASAAGVVEAVNFNAPAQVVIAGTKAGIEM 176

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A +    KGAKRA+ LPVSAPFHSSL+ P S  ++  L +V  + P +P++ N   + VS
Sbjct: 177 ACEIAKAKGAKRALPLPVSAPFHSSLLKPASDKLRDYLANVDVKTPRIPVVNNIDVAVVS 236

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
               I   LV Q  G VRW E ++  A  G   V E G GKVL GL KRID +L   S+ 
Sbjct: 237 DPAAIKDALVRQAAGPVRWVECVRHIAREGATHVIECGPGKVLAGLTKRIDSNLVGASVF 296

Query: 301 KVEDIDLALRSIV 313
               +D AL+   
Sbjct: 297 DPASLDEALKLAA 309


>gi|148381539|ref|YP_001256080.1| malonyl CoA-acyl carrier protein transacylase [Clostridium
           botulinum A str. ATCC 3502]
 gi|153931629|ref|YP_001385913.1| malonyl CoA-acyl carrier protein transacylase [Clostridium
           botulinum A str. ATCC 19397]
 gi|153937434|ref|YP_001389320.1| malonyl CoA-acyl carrier protein transacylase [Clostridium
           botulinum A str. Hall]
 gi|148291023|emb|CAL85160.1| malonyl CoA-acyl carrier protein transacylase [Clostridium
           botulinum A str. ATCC 3502]
 gi|152927673|gb|ABS33173.1| malonyl CoA-acyl carrier protein transacylase [Clostridium
           botulinum A str. ATCC 19397]
 gi|152933348|gb|ABS38847.1| malonyl CoA-acyl carrier protein transacylase [Clostridium
           botulinum A str. Hall]
          Length = 314

 Score =  192 bits (488), Expect = 5e-47,   Method: Composition-based stats.
 Identities = 113/312 (36%), Positives = 173/312 (55%), Gaps = 4/312 (1%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
                F GQG+Q +GMG+DLY + PE R +FE  +  L   L+ + + G ++E+  T N 
Sbjct: 3   KIAFIFSGQGAQYVGMGKDLYKNIPECRKIFEIAEEELQIPLTKICFQGPKDEIDKTENT 62

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPA+  +S+A ++ +EK G+         AG SLGEY+AL  +K     + + LVR RG+
Sbjct: 63  QPAILTLSIAAMKALEKYGI----KPDVTAGLSLGEYSALVCSKVIDFKEAVSLVRKRGQ 118

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCA 181
            M+ AVP G+G+M AIIGL    V  IC    +VGI EIAN N  GQ+VISG  +AV+ A
Sbjct: 119 YMEHAVPNGVGTMAAIIGLKKEKVKEICDDLKKVGIVEIANINCPGQIVISGEINAVEKA 178

Query: 182 ADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSS 241
            +    K A + V L VS PFHSS++    + +   L  +      VP + N     V +
Sbjct: 179 CEMAKEKRALKCVNLSVSGPFHSSMLKEAGENLYEELQKIRFNSIEVPFITNVTGDFVIN 238

Query: 242 IDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISK 301
             EI  LL +QV   V W  +I+   + GV +  E+G  KVL+G  K+ID+ ++ +++  
Sbjct: 239 TSEIKDLLKKQVMSTVLWEGSIKTMIDFGVDTFIEIGPSKVLSGFVKKIDRKVNILNVED 298

Query: 302 VEDIDLALRSIV 313
           ++ ++  +  + 
Sbjct: 299 IDSLNKTIEKLK 310


>gi|89054115|ref|YP_509566.1| [Acyl-carrier-protein] S-malonyltransferase [Jannaschia sp. CCS1]
 gi|88863664|gb|ABD54541.1| [Acyl-carrier-protein] S-malonyltransferase [Jannaschia sp. CCS1]
          Length = 313

 Score =  192 bits (488), Expect = 5e-47,   Method: Composition-based stats.
 Identities = 158/313 (50%), Positives = 210/313 (67%), Gaps = 1/313 (0%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M+    FPGQG+Q IGMGR L D++P AR VF EVD  L ++LS L+W G  E+LT T N
Sbjct: 1   MTRAFIFPGQGAQTIGMGRALADAYPAARAVFAEVDDALGESLSSLIWEGEIEDLTLTRN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
           AQPAL A S+A +  +   G+ V    SYVAGHSLGEY+AL AA A SL+DT RL+R RG
Sbjct: 61  AQPALMATSLAAMAALGAEGVEVTA-ASYVAGHSLGEYSALAAAGALSLADTARLLRLRG 119

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           ++MQ AVP G G+M AI+GLD   V+ + A+A++  +CE ANDN   QVVISG + AV+ 
Sbjct: 120 EAMQAAVPAGEGAMAAILGLDLANVEEVAAEAAQGDVCEAANDNDPAQVVISGTKAAVER 179

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A D    +GAKRA+ LPVSAPFH +LM P +  M   L  V  + PVVP++ N  A   S
Sbjct: 180 ACDIAKARGAKRALLLPVSAPFHCALMQPAADAMAQALSEVDMEAPVVPLVGNVIAQAES 239

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
           S   I   LV+QVTGRVRWRE++ W A  GV  V+E+G+GK L+G+ KRID++++  ++ 
Sbjct: 240 SAMVIRNNLVDQVTGRVRWRESVLWMAAEGVTEVFEIGAGKALSGMVKRIDRAVTPHAVG 299

Query: 301 KVEDIDLALRSIV 313
             ED+  A+ ++ 
Sbjct: 300 TPEDVTKAVEALA 312


>gi|168181069|ref|ZP_02615733.1| malonyl CoA-acyl carrier protein transacylase [Clostridium
           botulinum NCTC 2916]
 gi|226951054|ref|YP_002806145.1| malonyl CoA-acyl carrier protein transacylase [Clostridium
           botulinum A2 str. Kyoto]
 gi|182668053|gb|EDT80032.1| malonyl CoA-acyl carrier protein transacylase [Clostridium
           botulinum NCTC 2916]
 gi|226842124|gb|ACO84790.1| malonyl CoA-acyl carrier protein transacylase [Clostridium
           botulinum A2 str. Kyoto]
          Length = 314

 Score =  192 bits (488), Expect = 5e-47,   Method: Composition-based stats.
 Identities = 112/312 (35%), Positives = 172/312 (55%), Gaps = 4/312 (1%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
                F GQGSQ +GMG++LY++ PE R +F   +  L   L+ + + G ++E+  T N 
Sbjct: 3   KIAFIFSGQGSQYVGMGKELYENIPECRKIFHIAEKGLQIPLTKICFEGPKDEIDKTENT 62

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPA+   S+A ++ +EK G+         AG SLGEY+AL  +K     + + LVR RG+
Sbjct: 63  QPAILTFSIAAMKALEKYGI----KPDVTAGLSLGEYSALVCSKVIDFKEAVSLVRKRGQ 118

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCA 181
            M+ AVP G+G+M AIIGL    V  IC     VGI EIAN N  GQ+VISG  +AV+ A
Sbjct: 119 YMEHAVPSGVGTMAAIIGLKKEKVKEICDGLKEVGIVEIANINCPGQIVISGEINAVEKA 178

Query: 182 ADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSS 241
            +    K A + V L VS PFHSS++    + +   L  +  +   VP + N     V +
Sbjct: 179 CEMAKEKRALKCVNLSVSGPFHSSMLKEAGENLYEELQKIQFKSIEVPFITNVTGDFVIN 238

Query: 242 IDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISK 301
             EI  LL +QV   V W  +I+   + GV +  E+G  KVL+G  K+ID+ ++ +++  
Sbjct: 239 TSEIKDLLKKQVMSTVLWEGSIKTMIDFGVDTFIEIGPSKVLSGFVKKIDRKVNILNVED 298

Query: 302 VEDIDLALRSIV 313
           ++ ++  +  + 
Sbjct: 299 IDSLNKTIEKLK 310


>gi|91784719|ref|YP_559925.1| [Acyl-carrier-protein] S-malonyltransferase [Burkholderia
           xenovorans LB400]
 gi|91688673|gb|ABE31873.1| [Acyl-carrier-protein] S-malonyltransferase [Burkholderia
           xenovorans LB400]
          Length = 311

 Score =  192 bits (487), Expect = 5e-47,   Method: Composition-based stats.
 Identities = 136/313 (43%), Positives = 175/313 (55%), Gaps = 4/313 (1%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M     FPGQGSQ +GM     D     R   +E    LNQ+L  L+  G  E+L  T N
Sbjct: 1   MKFAFVFPGQGSQSVGMLNAFADQ-AVVRETVQEASDALNQDLGKLIAEGPAEDLNLTTN 59

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
            QP +   S A  R   + G       + VAGHSLGEYTAL AA A +  D + LVR R 
Sbjct: 60  TQPVMLTASYAMYRAWLQAGG---PKPAIVAGHSLGEYTALVAAGAIAFRDAVPLVRFRA 116

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           ++MQ AVP G G+M AI+GLDD  V ++CA+AS  G+ E  N N   QVVI+G + AV+ 
Sbjct: 117 QAMQTAVPVGEGAMAAILGLDDDTVRAVCAEASVAGVVEAVNFNAPAQVVIAGNKAAVEK 176

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A +    KGAKRA+ LPVSAPFHSSL+ P S  ++  L SV  Q P +P++ N   + V+
Sbjct: 177 ACEVAKAKGAKRALPLPVSAPFHSSLLKPASDQLREYLASVDVQVPAIPVINNVDVAVVN 236

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
               I   LV Q  G VRW E++Q  +  GV  V E G GKVL GL KRID +L   SI 
Sbjct: 237 EPAAIKDALVRQAAGAVRWVESVQAMSAQGVTHVIECGPGKVLAGLTKRIDGNLVGASIF 296

Query: 301 KVEDIDLALRSIV 313
               ++  L+ + 
Sbjct: 297 DPASLEETLKLVK 309


>gi|194333022|ref|YP_002014882.1| malonyl CoA-acyl carrier protein transacylase [Prosthecochloris
           aestuarii DSM 271]
 gi|194310840|gb|ACF45235.1| malonyl CoA-acyl carrier protein transacylase [Prosthecochloris
           aestuarii DSM 271]
          Length = 304

 Score =  192 bits (487), Expect = 6e-47,   Method: Composition-based stats.
 Identities = 127/310 (40%), Positives = 177/310 (57%), Gaps = 7/310 (2%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M     FPGQGSQ  GM +D+Y++FP+A+ V ++ +  L  +++D+M++  +EEL  T  
Sbjct: 1   MK-AFVFPGQGSQYCGMAKDIYNAFPQAKAVMDKANDILGYSITDIMFDAPEEELRKTQY 59

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
            QPA+   S+A   ++ K G      +   AGHSLGEYTALC A A S  D +++V  RG
Sbjct: 60  TQPAIFLHSIAVAELLGKEG------VDMAAGHSLGEYTALCFAGAMSFEDAMKIVARRG 113

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           + MQ A     GSM AIIG+ D V+D +  +A   GI + AN N  GQ+VISG   AVK 
Sbjct: 114 ELMQHAGTRNPGSMAAIIGMKDDVLDELLKEAGETGIVQAANFNSPGQIVISGEISAVKK 173

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A +    KGA+ A  LPVS  FHS LM P  + +K  LD++T  D  +P+  N  A PV 
Sbjct: 174 AVELAPLKGARMAKELPVSGAFHSPLMKPAEEELKAALDAITIHDAAIPVCMNVTAEPVC 233

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
              +I   LV Q+T  VRW ++++     GV    E+G  KVL GL KRID++++   I 
Sbjct: 234 KAADIRNNLVLQLTSPVRWTQSVETMIAGGVTLFSEIGPQKVLQGLIKRIDRNVTIQGID 293

Query: 301 KVEDIDLALR 310
             E I   L 
Sbjct: 294 NAEQIQQQLS 303


>gi|251789233|ref|YP_003003954.1| malonyl CoA-acyl carrier protein transacylase [Dickeya zeae
           Ech1591]
 gi|247537854|gb|ACT06475.1| malonyl CoA-acyl carrier protein transacylase [Dickeya zeae
           Ech1591]
          Length = 309

 Score =  192 bits (487), Expect = 6e-47,   Method: Composition-based stats.
 Identities = 129/310 (41%), Positives = 176/310 (56%), Gaps = 3/310 (0%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
              + FPGQGSQ +GM  +L + FP  +  F+E    L  +L  L   G  EEL  T   
Sbjct: 3   KFAMVFPGQGSQSVGMLAELAEQFPLIKETFDEASSVLGYDLWQLSQQGPAEELNKTWQT 62

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPAL   S+A  RV ++ G       + +AGHSLGEY+AL  A        + LV  RGK
Sbjct: 63  QPALLTASVALWRVWQQQGG---PLPALMAGHSLGEYSALVCAGVMDFRQAVSLVELRGK 119

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCA 181
            MQEAVP G G+M AIIGLD+  + + CA+A++  +    N N  GQVVI+G +DAV+ A
Sbjct: 120 LMQEAVPEGTGAMYAIIGLDNDAIAAACAEAAQGQVVSPVNFNSPGQVVIAGSKDAVERA 179

Query: 182 ADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSS 241
              C   GAKRA+ LPVS P H +LM P ++ +   L+++T   P VP++ N      S+
Sbjct: 180 GAACKAAGAKRALPLPVSVPSHCALMEPAARKLAEALEAITFNTPNVPVVNNVDVRAESA 239

Query: 242 IDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISK 301
            + I   LV Q+   VRW E +++ +  GV S+ EVG GKVLTGL KRI  SL+A +I+ 
Sbjct: 240 PEAIRSALVRQLHNPVRWTECVEYMSAQGVSSLLEVGPGKVLTGLTKRIVDSLTATAIND 299

Query: 302 VEDIDLALRS 311
              +  AL  
Sbjct: 300 PASLSAALEQ 309


>gi|293396576|ref|ZP_06640852.1| malonyl CoA-acyl carrier protein transacylase [Serratia odorifera
           DSM 4582]
 gi|291420840|gb|EFE94093.1| malonyl CoA-acyl carrier protein transacylase [Serratia odorifera
           DSM 4582]
          Length = 309

 Score =  192 bits (487), Expect = 6e-47,   Method: Composition-based stats.
 Identities = 127/312 (40%), Positives = 172/312 (55%), Gaps = 4/312 (1%)

Query: 1   MS-TVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATC 59
           M+   + FPGQGSQ +GM  +L   +P     F E    L  +L   +  G  EEL  T 
Sbjct: 1   MTQFAMVFPGQGSQTVGMLAELATQYPVVEQTFAEASDALGYDLWQRVQQGPAEELNKTW 60

Query: 60  NAQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRAR 119
             QPAL A S+A  RV ++ G    +  + +AGHSLGEY+AL  A        IRLV  R
Sbjct: 61  QTQPALLAASVAIFRVWQQQGG---KMPALMAGHSLGEYSALVCAGVLDFKAAIRLVELR 117

Query: 120 GKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVK 179
           GK MQEAVP G G+M AIIGLD+  +   C ++++  +    N N  GQVVI+G +DAV+
Sbjct: 118 GKLMQEAVPVGTGAMYAIIGLDNDAIAKACEESAQGEVVAPVNFNSPGQVVIAGNKDAVE 177

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            A   C   GAKRA+ LPVS P H +LM P +  +   L  VT   P +P++ N      
Sbjct: 178 RAGAACKAAGAKRALPLPVSVPSHCALMKPAADKLAEALKDVTFNAPQIPVINNVDVRSE 237

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
           +    I   LV Q+   VRW E++++ A  GV S+ EVG GKVLTGL KRI  +L+A ++
Sbjct: 238 TDPQAIRSALVRQLFSPVRWTESVEFIAAQGVDSLLEVGPGKVLTGLTKRIVDTLTAAAV 297

Query: 300 SKVEDIDLALRS 311
           +    +  AL  
Sbjct: 298 NDPASLSAALEQ 309


>gi|78043865|ref|YP_360280.1| malonyl CoA-acyl carrier protein transacylase [Carboxydothermus
           hydrogenoformans Z-2901]
 gi|77995980|gb|ABB14879.1| malonyl CoA-acyl carrier protein transacylase [Carboxydothermus
           hydrogenoformans Z-2901]
          Length = 312

 Score =  192 bits (487), Expect = 6e-47,   Method: Composition-based stats.
 Identities = 117/310 (37%), Positives = 169/310 (54%), Gaps = 5/310 (1%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
            T   FPGQGSQ +GMG+DLYD  P  R  F   +  L  +L+ +++ G +EEL  T N 
Sbjct: 3   KTAFVFPGQGSQYVGMGKDLYDELPVVRKYFNLANEILGYDLTKIIFEGPEEELNKTENT 62

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPA+  +S A    +E+ G+          GHSLGE+TAL AA   + +D +RLV  RGK
Sbjct: 63  QPAILTLSYALYVTLEEKGI----KAKIYGGHSLGEFTALTAAGVINFADAVRLVHVRGK 118

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCA 181
            MQEAVP G G M+A++G++   + +   +    GI EI N NGGGQ V++G     +  
Sbjct: 119 LMQEAVPLGQGVMLAVMGIEKEELVATVKKLQEYGIMEIVNFNGGGQYVLAGESKIKELT 178

Query: 182 ADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSS 241
                  GA++ V LPVSAPFHSSLM   +   +  L+ V    P VP++ N  A  ++ 
Sbjct: 179 KTQLKEVGARKIVELPVSAPFHSSLMRAAALKFQEYLEKVEFLPPKVPVISNVTAEILTD 238

Query: 242 IDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISK 301
             +I  LL +Q+   V W +++       V    E+G GKVLT L KRI   ++  S++ 
Sbjct: 239 PVKIKDLLSKQMASPVLWEQSVLEMVKVEVTKFIEIGPGKVLTNLIKRIVP-VATFSVNN 297

Query: 302 VEDIDLALRS 311
           +E +   L +
Sbjct: 298 LESLRFLLDN 307


>gi|300704620|ref|YP_003746223.1| malonyl CoA-acyl carrier protein transacylase [Ralstonia
           solanacearum CFBP2957]
 gi|299072284|emb|CBJ43617.1| Malonyl CoA-acyl carrier protein transacylase [Ralstonia
           solanacearum CFBP2957]
          Length = 309

 Score =  192 bits (487), Expect = 6e-47,   Method: Composition-based stats.
 Identities = 131/313 (41%), Positives = 170/313 (54%), Gaps = 4/313 (1%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M+    FPGQGSQ +GM     D  P       E    L Q++  L+  G  +EL  T N
Sbjct: 1   MTFAFVFPGQGSQSVGMLNAFAD-HPAVAATLAEASDALGQDIGKLIAEGPADELNLTTN 59

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
            QP +   ++A  R  +  G  V    + VAGHSLGEY+AL AA A +  D + LVR R 
Sbjct: 60  TQPVMLTAAVAVYRAWQAAGGPV---PTVVAGHSLGEYSALVAAGAIAFKDAVPLVRFRA 116

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           K+MQEAVP G G M AI+GL D  V + CA+AS  G+ E  N N   QVVI+G + AV+ 
Sbjct: 117 KAMQEAVPVGEGGMAAILGLSDDDVRAACAEASIAGVVEAVNFNAPAQVVIAGAKAAVEK 176

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A +    +GAKRA+ LPVSAPFHSSL+ P S  ++  L SVT   P +P++ N   + VS
Sbjct: 177 ACEVAKARGAKRALPLPVSAPFHSSLLKPASDRLRDYLASVTVSAPSIPVINNVDVAVVS 236

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
               I   LV Q    VRW ET+Q     G+  V E G GKVL GL KRID  +   +I 
Sbjct: 237 DPVAIKDALVRQAASPVRWVETVQKMKADGITRVVECGPGKVLAGLTKRIDGDIVGDAIF 296

Query: 301 KVEDIDLALRSIV 313
               ++  L  + 
Sbjct: 297 DPASLEAVLAQLK 309


>gi|83748454|ref|ZP_00945476.1| Malonyl-CoA-[acyl-carrier-protein] transacylase [Ralstonia
           solanacearum UW551]
 gi|207743602|ref|YP_002259994.1| malonyl coa-[acyl-carrier-protein] transacylase [Ralstonia
           solanacearum IPO1609]
 gi|83724865|gb|EAP72021.1| Malonyl-CoA-[acyl-carrier-protein] transacylase [Ralstonia
           solanacearum UW551]
 gi|206595001|emb|CAQ61928.1| malonyl coa-[acyl-carrier-protein] transacylase [Ralstonia
           solanacearum IPO1609]
          Length = 309

 Score =  192 bits (487), Expect = 6e-47,   Method: Composition-based stats.
 Identities = 132/313 (42%), Positives = 170/313 (54%), Gaps = 4/313 (1%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M+    FPGQGSQ +GM     D  P       E    L Q++  L+  G  +EL  T N
Sbjct: 1   MTFAFVFPGQGSQSVGMLNAFAD-HPAVAATLAEASDALGQDIGKLIAEGPADELNLTTN 59

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
            QP +   ++A  R  +  G  V    + VAGHSLGEY+AL AA A +  D + LVR R 
Sbjct: 60  TQPVMLTAAVAVYRAWQAAGGPV---PTVVAGHSLGEYSALVAAGAIAFKDAVPLVRFRA 116

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           K+MQEAVP G G M AI+GL D  V + CA+AS  G+ E  N N   QVVI+G + AV+ 
Sbjct: 117 KAMQEAVPVGEGGMAAILGLSDDDVRAACAEASIAGVVEAVNFNAPAQVVIAGAKAAVEK 176

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A +    KGAKRA+ LPVSAPFHSSL+ P S  ++  L SVT   P +P++ N   + VS
Sbjct: 177 ACEVAKAKGAKRALPLPVSAPFHSSLLKPASDRLRDYLASVTVSAPSIPVINNVDVAVVS 236

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
               I   LV Q    VRW ET+Q     G+  V E G GKVL GL KRID  +   +I 
Sbjct: 237 DPVTIKDALVRQAASPVRWVETVQKMKADGITRVVECGPGKVLAGLTKRIDGDIVGDAIF 296

Query: 301 KVEDIDLALRSIV 313
               ++  L  + 
Sbjct: 297 DPASLEAVLAQLK 309


>gi|228947571|ref|ZP_04109861.1| Malonyl CoA-acyl carrier protein transacylase [Bacillus
           thuringiensis serovar monterrey BGSC 4AJ1]
 gi|228812091|gb|EEM58422.1| Malonyl CoA-acyl carrier protein transacylase [Bacillus
           thuringiensis serovar monterrey BGSC 4AJ1]
          Length = 314

 Score =  192 bits (487), Expect = 6e-47,   Method: Composition-based stats.
 Identities = 122/314 (38%), Positives = 182/314 (57%), Gaps = 5/314 (1%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
                FPGQGSQ +GMG+ L ++  E   VF + D  L  +LS++++ G QE+LT T NA
Sbjct: 3   KLAFLFPGQGSQAVGMGKQLAENNKEVANVFAKADEVLQDSLSEVIFEGPQEKLTLTTNA 62

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPAL   S A +  +++  +       +VAGHSLGEY+AL AA A +  D +  VR RG+
Sbjct: 63  QPALLTTSFAILTALKEYDIT----PDFVAGHSLGEYSALVAAGALTFEDAVYAVRKRGE 118

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQAS-RVGICEIANDNGGGQVVISGLQDAVKC 180
            M+EAVP G G+M AI+G D  ++  +  + +      +IAN N   Q+VISG +  V+ 
Sbjct: 119 YMEEAVPGGEGAMAAILGADPHMLKQVTEEVTGEGYAVQIANMNSTKQIVISGTKQGVEI 178

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A+      GAKRA+ L VS PFHS+ M P ++  + +L+ +T QD  +P++ N  A  ++
Sbjct: 179 ASQRAKENGAKRAIPLKVSGPFHSAFMKPAAEKFQSVLNEITIQDTNIPVIANVTADVIT 238

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
           S   I   L+EQ+   V W  +I++  N GV +  E+G GKVL GL K ID S+ A +I 
Sbjct: 239 SGAHIQEKLIEQLYSPVLWYPSIEYMVNQGVDTFIEIGPGKVLAGLMKSIDSSVKAYAIY 298

Query: 301 KVEDIDLALRSIVG 314
             E +   + ++ G
Sbjct: 299 DEETLKDTISNLRG 312


>gi|148657572|ref|YP_001277777.1| malonyl CoA-acyl carrier protein transacylase [Roseiflexus sp.
           RS-1]
 gi|148569682|gb|ABQ91827.1| [Acyl-carrier-protein] S-malonyltransferase [Roseiflexus sp. RS-1]
          Length = 324

 Score =  192 bits (487), Expect = 6e-47,   Method: Composition-based stats.
 Identities = 118/307 (38%), Positives = 174/307 (56%), Gaps = 4/307 (1%)

Query: 1   MS--TVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTAT 58
           M     L FPGQGSQ +GMG++LY++ P AR +FE+ D  L   LS L + G QEEL  T
Sbjct: 1   MKKRIALVFPGQGSQYVGMGKELYEASPAARRIFEQADQVLGFELSKLCFEGPQEELDDT 60

Query: 59  CNAQPALTAVSMAFIRVMEKNGLCVKR--DISYVAGHSLGEYTALCAAKAFSLSDTIRLV 116
            NAQPA+  VS+A +  +++           S VAGHSLGE+TAL AA      D ++LV
Sbjct: 61  VNAQPAILTVSIACLEALKERFGPFGYLGAPSLVAGHSLGEFTALVAAGVLDFEDALKLV 120

Query: 117 RARGKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQD 176
           R RG+ M+E+     G M A++GLDD  ++ +  +A   G+  +AN N  GQ V+SG   
Sbjct: 121 RERGRLMKESGEQRPGGMAAVVGLDDKTLEEVVQEAQAEGVVSVANANSPGQTVLSGEHR 180

Query: 177 AVKCAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCA 236
           A++ A +    +GAK    L VS   HS LM   S     +LD    + P VP++ N   
Sbjct: 181 ALQRAMELAKARGAKLVQRLQVSIAAHSPLMQSASARFNELLDRFQLRPPEVPLIANISG 240

Query: 237 SPVSSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSA 296
             +++++E+ + L +Q+T  V+W  ++Q   +HGV ++ EVG  +VL+GL KRI      
Sbjct: 241 RALTTVEELRQELSQQLTRPVQWTRSVQEMVSHGVDTIVEVGPRQVLSGLIKRITPHARP 300

Query: 297 VSISKVE 303
           V ++  E
Sbjct: 301 VPLTDTE 307


>gi|295696061|ref|YP_003589299.1| malonyl CoA-acyl carrier protein transacylase [Bacillus tusciae DSM
           2912]
 gi|295411663|gb|ADG06155.1| malonyl CoA-acyl carrier protein transacylase [Bacillus tusciae DSM
           2912]
          Length = 314

 Score =  192 bits (487), Expect = 6e-47,   Method: Composition-based stats.
 Identities = 125/306 (40%), Positives = 181/306 (59%), Gaps = 5/306 (1%)

Query: 4   VLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQP 63
              FPGQG+Q +GMG+ +YD++ EA+  F+E D  L  +LSDL +NG +E+L  T   QP
Sbjct: 3   AWVFPGQGAQKVGMGKAVYDTYEEAKKTFQEADAALGFSLSDLCFNGPEEKLRQTTYTQP 62

Query: 64  ALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSM 123
           A+   S+A  RV+E  G+         AGHSLGEY+AL AA A   +D +R+V  RG+ M
Sbjct: 63  AILTASVAVWRVLEARGV----RPDVAAGHSLGEYSALVAAGALDFADAVRVVHRRGQYM 118

Query: 124 QEAVPPGLGSMVAIIGLDDCVVDSICAQASRVG-ICEIANDNGGGQVVISGLQDAVKCAA 182
           QEAVP G G+M A++  D   V  +CA+ SR     E+AN N  GQ+VISG  +AV+ A 
Sbjct: 119 QEAVPAGGGTMAAVLQADRDTVTEVCAEVSREVGPVELANVNCPGQLVISGRTEAVQEAG 178

Query: 183 DTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSI 242
              L +GAKR + L VS PFHSSLM P ++ +   L  V  +D + P++ N  A P    
Sbjct: 179 KRLLERGAKRVLPLEVSGPFHSSLMKPAAQRLAEDLARVPLRDAICPVVSNIDAKPRRKA 238

Query: 243 DEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKV 302
           DEI   L  QV G V W + ++     GV  V EVG G+V++GL +++D+++  ++    
Sbjct: 239 DEIREALARQVAGPVLWEDGVRTMLAMGVTRVAEVGPGRVVSGLVRKVDRNVEILAAEDP 298

Query: 303 EDIDLA 308
           + ++  
Sbjct: 299 DSLEAL 304


>gi|331268236|ref|YP_004394728.1| malonyl CoA-acyl carrier protein transacylase [Clostridium
           botulinum BKT015925]
 gi|329124786|gb|AEB74731.1| malonyl CoA-acyl carrier protein transacylase [Clostridium
           botulinum BKT015925]
          Length = 314

 Score =  192 bits (487), Expect = 7e-47,   Method: Composition-based stats.
 Identities = 114/313 (36%), Positives = 183/313 (58%), Gaps = 4/313 (1%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
                F GQG+Q +GMG++LYD+  E + VF + D  L  ++S++ + GS+EEL  T N 
Sbjct: 3   KIAFIFSGQGAQYVGMGKELYDNMEECKEVFLKADKALGFSISNICFEGSKEELDRTENT 62

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPA+   S+A ++ ++K+G+        VAG SLGEY+AL  +  F+  D +R+V+ RGK
Sbjct: 63  QPAILTTSIAALKALDKSGI----KADVVAGLSLGEYSALVCSGVFNFEDAVRVVKKRGK 118

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCA 181
            MQE VP G+G+M AIIGLD   V   C +    GI E+AN N   Q+VI+G  +AV  A
Sbjct: 119 FMQEEVPEGVGTMAAIIGLDREKVSKACEECREYGIVEVANYNCSSQIVIAGEINAVDKA 178

Query: 182 ADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSS 241
            ++    GAKR + L VSAPFH+S++    + +   L  VT  D  VPI+ N   + ++ 
Sbjct: 179 CESAKELGAKRVIKLSVSAPFHTSMLKGAGEKLYKELQDVTLNDIKVPIMTNVTGNYITD 238

Query: 242 IDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISK 301
           I+++  +L  QV   V W + ++   + GV +  E+G GK L+G  K+I++ +  +++  
Sbjct: 239 INDVKDILRRQVMSSVLWEDIVKNMISDGVDTFIEIGPGKALSGFVKKINRKVKVLNVED 298

Query: 302 VEDIDLALRSIVG 314
           +  ++  +  + G
Sbjct: 299 LTSLNKTIDELKG 311


>gi|308049108|ref|YP_003912674.1| (acyl-carrier-protein) S-malonyltransferase [Ferrimonas balearica
           DSM 9799]
 gi|307631298|gb|ADN75600.1| (Acyl-carrier-protein) S-malonyltransferase [Ferrimonas balearica
           DSM 9799]
          Length = 309

 Score =  192 bits (487), Expect = 7e-47,   Method: Composition-based stats.
 Identities = 125/312 (40%), Positives = 177/312 (56%), Gaps = 5/312 (1%)

Query: 1   MS--TVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTAT 58
           M+  T   FPGQGSQ +GM  +L   +P  +  F E    L  +L  ++ +G  E L +T
Sbjct: 1   MTQNTAFIFPGQGSQTVGMLAELAADYPIIQATFAEASEALGFDLWQMVQDGPAEALNST 60

Query: 59  CNAQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRA 118
            N QPAL   S+A  R   + G       + +AGHSLGEY+AL  A A    D ++LV  
Sbjct: 61  ENTQPALLTASVAIWRAYCEAGGVA---PTVMAGHSLGEYSALVCAGALKFDDAVKLVAL 117

Query: 119 RGKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAV 178
           RG++MQEAVP G G+M AIIGLDD  +   CA+A++  +    N N  GQVVI+G +DAV
Sbjct: 118 RGRAMQEAVPAGTGAMAAIIGLDDDAIAKACAEAAQGEVVSPVNFNSPGQVVIAGHKDAV 177

Query: 179 KCAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASP 238
             A + C   GAKRA+ LPVS P H  LM P ++ +   L ++    P +P++ N   + 
Sbjct: 178 ARAGEACKAAGAKRALPLPVSVPSHCELMKPAAEKLAAALANIDVVAPAIPVINNVDVAK 237

Query: 239 VSSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVS 298
             + + I   LV Q+   VRW ET+   A  G++ + E G GKVLTGL KRI+K+LS  +
Sbjct: 238 ADTAEAIKDALVRQLYCPVRWTETVNAMAEQGIEQLVECGPGKVLTGLTKRINKALSGTA 297

Query: 299 ISKVEDIDLALR 310
           +++  D+   L 
Sbjct: 298 VNQPADLQALLS 309


>gi|332976634|gb|EGK13475.1| malonyl-CoA-[acyl-carrier-protein] transacylase [Desmospora sp.
           8437]
          Length = 311

 Score =  192 bits (486), Expect = 7e-47,   Method: Composition-based stats.
 Identities = 139/310 (44%), Positives = 190/310 (61%), Gaps = 5/310 (1%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
            T   FPGQGSQ +GMG+D++D  P+ R VFE+ D  L  +LS L + G +EEL  T NA
Sbjct: 3   KTAFLFPGQGSQAVGMGKDVHDGDPQVREVFEQADEELGYSLSRLCFEGPEEELRLTANA 62

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPA+   S+A  R++E  GL       +VAGHSLGEY+AL AA+A S  D +R VR RG 
Sbjct: 63  QPAILTTSVALYRLVEAAGLTA----DFVAGHSLGEYSALVAAEALSFKDAVRTVRKRGL 118

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVG-ICEIANDNGGGQVVISGLQDAVKC 180
            M+EAVP G G+M A+IGLD   V+ IC +AS    + E AN N  GQ+VISG ++AV+ 
Sbjct: 119 LMEEAVPAGEGAMSAVIGLDRESVERICREASGEQGVVEPANYNCPGQLVISGSKEAVEA 178

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A       GA+R + L VS PFHSSLM P ++ MK +LD +  ++  VP++ N  A P  
Sbjct: 179 AGAKAKEAGARRVLPLSVSGPFHSSLMRPAAERMKEVLDRLEIREARVPVVANVSARPQQ 238

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
              +I + LVEQV   V W ++I+     GV +  E+G G VLTGL ++I + ++A+SI 
Sbjct: 239 EAADIRKALVEQVAAPVLWEDSIRRLIEEGVDTFVEIGPGNVLTGLVRKIQRGVTALSIQ 298

Query: 301 KVEDIDLALR 310
             E +   L 
Sbjct: 299 DGESMRKTLE 308


>gi|207725227|ref|YP_002255623.1| malonyl coa-[acyl-carrier-protein] transacylase [Ralstonia
           solanacearum MolK2]
 gi|206590461|emb|CAQ37423.1| malonyl coa-[acyl-carrier-protein] transacylase [Ralstonia
           solanacearum MolK2]
          Length = 309

 Score =  192 bits (486), Expect = 7e-47,   Method: Composition-based stats.
 Identities = 132/313 (42%), Positives = 170/313 (54%), Gaps = 4/313 (1%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M+    FPGQGSQ +GM     D  P       E    L Q++  L+  G  +EL  T N
Sbjct: 1   MTFAFVFPGQGSQSVGMLNAFAD-HPAVAATLAEASDALGQDIGKLIAEGPADELNLTTN 59

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
            QP +   ++A  R  +  G  V    + VAGHSLGEY+AL AA A +  D + LVR R 
Sbjct: 60  TQPVMLTAAVAVYRAWQAAGGPV---PTVVAGHSLGEYSALVAAGAIAFKDAVPLVRFRA 116

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           K+MQEAVP G G M AI+GL D  V + CA+AS  G+ E  N N   QVVI+G + AV+ 
Sbjct: 117 KAMQEAVPVGEGGMAAILGLSDDDVRAACAEASIAGVVEAVNFNAPAQVVIAGAKAAVEK 176

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A +    KGAKRA+ LPVSAPFHSSL+ P S  ++  L SVT   P +P++ N   + VS
Sbjct: 177 ACEVAKAKGAKRALPLPVSAPFHSSLLKPASDRLRDYLASVTVSAPSIPVINNVDVAVVS 236

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
               I   LV Q    VRW ET+Q     G+  V E G GKVL GL KRID  +   +I 
Sbjct: 237 DPVAIKDALVRQAASPVRWVETVQKMKADGITRVVECGPGKVLAGLTKRIDGDIVGDAIF 296

Query: 301 KVEDIDLALRSIV 313
               ++  L  + 
Sbjct: 297 DPASLEAVLAQLK 309


>gi|206559386|ref|YP_002230147.1| malonyl CoA-acyl carrier protein transacylase 2 [Burkholderia
           cenocepacia J2315]
 gi|206561212|ref|YP_002231977.1| malonyl CoA-acyl carrier protein transacylase 1 [Burkholderia
           cenocepacia J2315]
 gi|198035424|emb|CAR51300.1| malonyl CoA-acyl carrier protein transacylase 2 [Burkholderia
           cenocepacia J2315]
 gi|198037254|emb|CAR53176.1| malonyl CoA-acyl carrier protein transacylase 1 [Burkholderia
           cenocepacia J2315]
          Length = 310

 Score =  192 bits (486), Expect = 7e-47,   Method: Composition-based stats.
 Identities = 137/310 (44%), Positives = 175/310 (56%), Gaps = 4/310 (1%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M     FPGQGSQ IGM     D     R   +E    LNQ+L  L+  G  EEL  T N
Sbjct: 1   MKFAFVFPGQGSQAIGMLNAFAD-LAVVRETLQEASDALNQDLGKLIAEGPAEELNLTTN 59

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
            QP +   + A  R  ++ G       S VAGHSLGEYTAL AA A +  D + LVR R 
Sbjct: 60  TQPVMLTAAYACYRAWQQAGG---PAPSIVAGHSLGEYTALVAAGALAFKDAVPLVRFRA 116

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           ++MQ AVP G G M AI+GLDD  V ++CA+A+  G+ E  N N   QVVI+G + AV+ 
Sbjct: 117 QAMQTAVPVGQGGMAAILGLDDDTVRAVCAEAAEAGVVEAVNFNAPAQVVIAGSKAAVEK 176

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A +    KGAKRA+ LPVSAPFHSSL+ P S  ++  L +V  + P +P++ N   + VS
Sbjct: 177 ACEIAKAKGAKRALPLPVSAPFHSSLLKPASDQLRDYLANVDVKAPQIPVVNNIDVAVVS 236

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
               I   LV Q  G VRW E ++  A  GV  V E G GKVL GL KRID +L+  S+ 
Sbjct: 237 DPAAIKDALVRQAAGPVRWVECVRHIAGTGVTHVIECGPGKVLAGLTKRIDGNLTGASVF 296

Query: 301 KVEDIDLALR 310
               +D AL+
Sbjct: 297 DPASLDEALK 306


>gi|193211805|ref|YP_001997758.1| malonyl CoA-acyl carrier protein transacylase [Chlorobaculum parvum
           NCIB 8327]
 gi|193085282|gb|ACF10558.1| malonyl CoA-acyl carrier protein transacylase [Chlorobaculum parvum
           NCIB 8327]
          Length = 303

 Score =  192 bits (486), Expect = 7e-47,   Method: Composition-based stats.
 Identities = 127/308 (41%), Positives = 175/308 (56%), Gaps = 7/308 (2%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M     FPGQGSQ  GMGRDLY+ FPE + + ++ D  L  +++++M+NGS+EEL  T  
Sbjct: 1   MK-AFVFPGQGSQYCGMGRDLYERFPEVKALMDKADEILGFSITNIMFNGSEEELKQTRY 59

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
            Q A+   S A   ++ + G      +   AGHSLGEYTALC A A    D +RLV  RG
Sbjct: 60  TQLAIFLHSYAAATLLGREG------VEMAAGHSLGEYTALCFAGALDFEDAVRLVAKRG 113

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           + MQ A     G+M AIIG+ D  +D +  +A   GI + AN N  GQ+VISG  DAV+ 
Sbjct: 114 ELMQNAGQQNPGTMAAIIGMADEALDGLLQEAGSAGIVQAANFNSPGQIVISGDVDAVRK 173

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A +   +KGA+ A  L VS  FHS LM P  K +   LD++  +D  +P+  N  A PV+
Sbjct: 174 AVELAPSKGARMAKELVVSGAFHSPLMKPAEKELAETLDTIAIRDAEIPVCMNVVAKPVT 233

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
           +  EI   L+ Q+T  V W +++Q   + GV    EVG  KVL GL KRI K+ S   + 
Sbjct: 234 AAAEIRANLISQLTSSVLWSQSVQAMVDAGVTEFVEVGPQKVLQGLIKRISKAASIAGVD 293

Query: 301 KVEDIDLA 308
             + +D A
Sbjct: 294 TADQVDAA 301


>gi|229071350|ref|ZP_04204573.1| Malonyl CoA-acyl carrier protein transacylase [Bacillus cereus
           F65185]
 gi|229081107|ref|ZP_04213617.1| Malonyl CoA-acyl carrier protein transacylase [Bacillus cereus
           Rock4-2]
 gi|228702151|gb|EEL54627.1| Malonyl CoA-acyl carrier protein transacylase [Bacillus cereus
           Rock4-2]
 gi|228711804|gb|EEL63756.1| Malonyl CoA-acyl carrier protein transacylase [Bacillus cereus
           F65185]
          Length = 314

 Score =  192 bits (486), Expect = 7e-47,   Method: Composition-based stats.
 Identities = 121/314 (38%), Positives = 180/314 (57%), Gaps = 5/314 (1%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
                FPGQGSQ +GMG+ L ++  E   VF + D  L  +LS++++ G QE+LT T NA
Sbjct: 3   KIAFLFPGQGSQAVGMGKQLAENNKEVAKVFAKADEVLQDSLSEVIFEGPQEKLTLTTNA 62

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPAL   S A +  +++  +       +VAGHSLGEY+AL AA A +  D +  VR RG+
Sbjct: 63  QPALLTTSFAILTALKEYDIT----PDFVAGHSLGEYSALVAAGALTFEDAVYAVRKRGE 118

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQAS-RVGICEIANDNGGGQVVISGLQDAVKC 180
            M+EAVP G G+M AI+G D  ++  +  + +      +IAN N   Q+VISG +  V+ 
Sbjct: 119 YMEEAVPGGEGAMAAILGADPHMLKQVTEEVTSEGYAVQIANMNSTKQIVISGTKQGVEV 178

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A+      GAKRA+ L VS PFHSSLM P ++  + +L+ +T  D  +P++ N  A  ++
Sbjct: 179 ASQRAKENGAKRAIPLKVSGPFHSSLMKPAAEKFQSVLNEITIHDTNIPVIANVTADVIT 238

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
              +I   L+EQ+   V W  +I+     GV +  E+G GKVL GL K ID S+ A +I 
Sbjct: 239 RGADIQEKLIEQLYSPVLWYPSIECMVKQGVDTFIEIGPGKVLAGLMKSIDSSVKAYAIY 298

Query: 301 KVEDIDLALRSIVG 314
             E +   + ++ G
Sbjct: 299 DEETLKDTISNLRG 312


>gi|116689144|ref|YP_834767.1| malonyl CoA-acyl carrier protein transacylase [Burkholderia
           cenocepacia HI2424]
 gi|116647233|gb|ABK07874.1| [Acyl-carrier-protein] S-malonyltransferase [Burkholderia
           cenocepacia HI2424]
          Length = 310

 Score =  192 bits (486), Expect = 7e-47,   Method: Composition-based stats.
 Identities = 137/310 (44%), Positives = 175/310 (56%), Gaps = 4/310 (1%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M     FPGQGSQ IGM  D +      R   +E    LNQ+L  L+  G  EEL  T N
Sbjct: 1   MKFAFVFPGQGSQAIGML-DAFADLAVVRETLQEASDALNQDLGKLIAEGPAEELNLTTN 59

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
            QP +   + A  R  ++ G       S VAGHSLGEYTAL AA A +  D + LVR R 
Sbjct: 60  TQPVMLTAAYACYRAWQQAGG---PAPSIVAGHSLGEYTALVAAGALAFKDAVPLVRFRA 116

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           ++MQ AVP G G M AI+GLDD  V ++CA+A+  G+ E  N N   QVVI+G + AV+ 
Sbjct: 117 QAMQTAVPVGQGGMAAILGLDDDTVRAVCAEAAEAGVVEAVNFNAPAQVVIAGSKAAVEK 176

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A +    KGAKRA+ LPVSAPFHSSL+ P S  ++  L +V  + P +P++ N   + VS
Sbjct: 177 ACEIAKAKGAKRALPLPVSAPFHSSLLKPASDQLRDYLANVDVKAPQIPVVNNIDVAVVS 236

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
               I   LV Q  G VRW E ++  A  GV  V E G GKVL GL KRID +L   S+ 
Sbjct: 237 DPAAIKDALVRQAAGPVRWVECVRHIAGTGVTHVIECGPGKVLAGLTKRIDGNLVGASVF 296

Query: 301 KVEDIDLALR 310
               +D AL+
Sbjct: 297 DPASLDEALK 306


>gi|254718632|ref|ZP_05180443.1| malonyl CoA-acyl carrier protein transacylase [Brucella sp. 83/13]
 gi|265983611|ref|ZP_06096346.1| malonyl CoA-acyl carrier protein transacylase [Brucella sp. 83/13]
 gi|306839848|ref|ZP_07472646.1| malonyl CoA-acyl carrier protein transacylase [Brucella sp. NF
           2653]
 gi|264662203|gb|EEZ32464.1| malonyl CoA-acyl carrier protein transacylase [Brucella sp. 83/13]
 gi|306405034|gb|EFM61315.1| malonyl CoA-acyl carrier protein transacylase [Brucella sp. NF
           2653]
          Length = 314

 Score =  192 bits (486), Expect = 8e-47,   Method: Composition-based stats.
 Identities = 175/301 (58%), Positives = 223/301 (74%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M+   TFPGQGSQ +GMG+ L + F EAR VF+EVD  L + LS  M+ G ++ LT T N
Sbjct: 1   MAVAFTFPGQGSQTVGMGKALAEQFAEARAVFDEVDEALGEKLSATMFEGPEDVLTLTAN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
           AQPAL AVSMA  R+ME  G  +K  +SYVAGHSLGEY+ALCAA  FSL+DT RL+R RG
Sbjct: 61  AQPALMAVSMAVQRIMEARGFSLKDKVSYVAGHSLGEYSALCAAGTFSLADTARLLRIRG 120

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
            +MQ+AVP G G+M AIIGL+   V+++C +A   G  +IANDNGGGQ+VISG + AV+ 
Sbjct: 121 NAMQKAVPVGEGAMAAIIGLEHGDVEAVCMEAKASGPVQIANDNGGGQLVISGAKAAVEL 180

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           AA     KGAKRA+ LPVSAPFHS+LM P +  M+  L +V KQDPVVP++ N  A+PV+
Sbjct: 181 AAKLGSEKGAKRAIMLPVSAPFHSTLMAPAADAMREALAAVEKQDPVVPLIANVRAAPVT 240

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
             +EI+ LLVEQVTG+VRWRETI+WF+ +GV ++YEVG GKVLTGLA+RI K +S  ++ 
Sbjct: 241 DANEIATLLVEQVTGQVRWRETIEWFSANGVTTLYEVGCGKVLTGLARRISKDVSGAAVG 300

Query: 301 K 301
            
Sbjct: 301 S 301


>gi|254994670|ref|ZP_05276860.1| malonyl CoA-acyl carrier protein transacylase (fabD) [Anaplasma
           marginale str. Mississippi]
 gi|255002778|ref|ZP_05277742.1| malonyl CoA-acyl carrier protein transacylase (fabD) [Anaplasma
           marginale str. Puerto Rico]
          Length = 325

 Score =  192 bits (486), Expect = 8e-47,   Method: Composition-based stats.
 Identities = 137/308 (44%), Positives = 184/308 (59%), Gaps = 1/308 (0%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           MS V  FPGQGSQ +GMGR++YDS P AR VF EVD TL ++LS +++ G +E LT+TCN
Sbjct: 1   MSVVFMFPGQGSQFVGMGREVYDSSPAARRVFHEVDETLGRHLSRIIFQGPEEALTSTCN 60

Query: 61  AQPALTAVSMAFIRVMEKN-GLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRAR 119
           AQ AL  VS+A +R +E+N G  +   + YV GHS+GEYTAL  +K   L    RL+  R
Sbjct: 61  AQLALMTVSVALVRALEENLGGPITDAVKYVLGHSVGEYTALHVSKVIGLPSVARLLDVR 120

Query: 120 GKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVK 179
           GK+M  A     G M A+IG     V+++ A+AS  GICE+ANDN  GQVV+SG + A++
Sbjct: 121 GKAMHRASSLCCGGMAALIGGSLSEVEAVAARASEYGICEVANDNCTGQVVVSGTESALQ 180

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
                    G K+ + L VS PFHSSLM      +   +D +    P V ++ N  AS  
Sbjct: 181 QLPKLIEGTGIKKVIRLRVSGPFHSSLMRLACNEIGDFVDQLEMNPPEVEMVFNVSASTH 240

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
           S  + I  L+V QV  RVRWRE+I++    G     EVG G+VL GL KRID S+    +
Sbjct: 241 SDCNAIRNLMVRQVVSRVRWRESIEYLIGCGCSEFIEVGPGQVLVGLLKRIDNSVRGFGV 300

Query: 300 SKVEDIDL 307
             +E +  
Sbjct: 301 DSMESVRA 308


>gi|254703807|ref|ZP_05165635.1| malonyl CoA-acyl carrier protein transacylase [Brucella suis bv. 3
           str. 686]
 gi|261754455|ref|ZP_05998164.1| malonyl CoA-acyl carrier protein transacylase [Brucella suis bv. 3
           str. 686]
 gi|261744208|gb|EEY32134.1| malonyl CoA-acyl carrier protein transacylase [Brucella suis bv. 3
           str. 686]
          Length = 314

 Score =  192 bits (486), Expect = 8e-47,   Method: Composition-based stats.
 Identities = 173/301 (57%), Positives = 221/301 (73%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M+   TFPGQGSQ +GMG+ L + F EAR VF+EVD  L + LS  M+ G ++ LT T N
Sbjct: 1   MAVAFTFPGQGSQAVGMGKALAEQFAEARAVFDEVDEALGEKLSATMFEGPEDVLTLTAN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
           AQPAL AVSMA  R+ME  G  +K  +SYVAGHSLGEY+ALCAA  FSL+DT RL+  RG
Sbjct: 61  AQPALMAVSMAVQRIMEARGFSLKDKVSYVAGHSLGEYSALCAAGTFSLADTARLLCIRG 120

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
            +MQ+AVP G G+M AIIGL+   V+++C +A   G  +IANDNGGGQ+VISG + AV+ 
Sbjct: 121 NAMQKAVPVGEGAMAAIIGLEHGDVEAVCMEAKASGPVQIANDNGGGQLVISGARAAVEL 180

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           AA     KGAKRA+ LPVSAPFHS+LM P +  M+  L +V K DPVVP++ N  A+PV+
Sbjct: 181 AAKLGSEKGAKRAIMLPVSAPFHSTLMAPAADAMREALAAVEKHDPVVPLIANVRAAPVT 240

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
             +EI+ LLVEQVTG+VRWRETI+WF+ +GV ++YEVG GKVLTGLA+RI K +S  ++ 
Sbjct: 241 DANEIAALLVEQVTGQVRWRETIEWFSANGVTTLYEVGCGKVLTGLARRISKDVSGAAVG 300

Query: 301 K 301
            
Sbjct: 301 S 301


>gi|332799143|ref|YP_004460642.1| malonyl CoA-acyl carrier protein transacylase [Tepidanaerobacter
           sp. Re1]
 gi|332696878|gb|AEE91335.1| malonyl CoA-acyl carrier protein transacylase [Tepidanaerobacter
           sp. Re1]
          Length = 311

 Score =  192 bits (486), Expect = 8e-47,   Method: Composition-based stats.
 Identities = 126/309 (40%), Positives = 187/309 (60%), Gaps = 4/309 (1%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
                FPGQG+Q +GMG+DLYD+FP AR +F+E D +L + +S++ +NG  E+L  T N 
Sbjct: 3   KIAFIFPGQGAQNVGMGKDLYDNFPTARRIFDEADKSLKEKISEICFNGPDEKLQETINT 62

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPA+   S+A   ++   G+        VAG S+GEY+AL AA++   +  + LV+ RGK
Sbjct: 63  QPAILTHSIACFSILRDKGI----MPDIVAGLSIGEYSALVAAESIEFNQAVPLVQKRGK 118

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCA 181
            MQEAVP G G+M AI+GL+   V  IC  AS  GI + AN N  GQ+V++G   AVK A
Sbjct: 119 YMQEAVPLGEGTMAAILGLEREEVLQICDTASEEGIVQAANFNCPGQIVLAGEVKAVKKA 178

Query: 182 ADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSS 241
            +    +GAK+AV L VSAPFH SL+ P +  +   L+ V   D  +P++ N  A  V +
Sbjct: 179 IELAKARGAKKAVILAVSAPFHCSLLKPAADKLANELEKVEIMDSKIPVVSNVNAEIVRN 238

Query: 242 IDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISK 301
             EI +LL++QV   V W + I+   ++G +   EVG G+VL+G  K+I+KSL+ +++  
Sbjct: 239 NCEIKQLLIKQVFSPVFWEDCIRCMIDYGAEIFIEVGPGRVLSGFMKKINKSLTVLNVED 298

Query: 302 VEDIDLALR 310
            E +   + 
Sbjct: 299 AESLYKTIN 307


>gi|163941590|ref|YP_001646474.1| malonyl CoA-acyl carrier protein transacylase [Bacillus
           weihenstephanensis KBAB4]
 gi|229013035|ref|ZP_04170200.1| Malonyl CoA-acyl carrier protein transacylase [Bacillus mycoides
           DSM 2048]
 gi|163863787|gb|ABY44846.1| malonyl CoA-acyl carrier protein transacylase [Bacillus
           weihenstephanensis KBAB4]
 gi|228748289|gb|EEL98149.1| Malonyl CoA-acyl carrier protein transacylase [Bacillus mycoides
           DSM 2048]
          Length = 314

 Score =  192 bits (486), Expect = 8e-47,   Method: Composition-based stats.
 Identities = 123/314 (39%), Positives = 184/314 (58%), Gaps = 5/314 (1%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
                FPGQGSQ +GMGR L ++  E   VF + D  L+ +LS++++ G QE+LT T NA
Sbjct: 3   KIAFLFPGQGSQAVGMGRQLAENNKEVAKVFAKADEVLHDSLSEVIFEGPQEKLTLTTNA 62

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPAL   S A +  +++  +       +VAGHSLGEY+AL AA A +  D +  VR RG+
Sbjct: 63  QPALLTTSFAILTALKEYDIT----PDFVAGHSLGEYSALVAAGALTFEDAVYAVRKRGE 118

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQAS-RVGICEIANDNGGGQVVISGLQDAVKC 180
            M+EAVP G G+M AI+G D  ++  +  + +      +IAN N   Q+VISG +  V+ 
Sbjct: 119 YMEEAVPGGEGAMAAILGADPDMLKRVTEEVTSEGYAVQIANMNSTKQIVISGTKQGVEL 178

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A+      GAKRA+ L VS PFHSSLM P ++  + +L+ +T QD  +P++ N  A  ++
Sbjct: 179 ASQRAKENGAKRAIPLKVSGPFHSSLMKPAAEKFQSVLNEITIQDTNIPVIANVTADVIT 238

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
              +I   L+EQ+   V W  +I++  N GV +  E+G GKVL GL K ID S+ A ++ 
Sbjct: 239 RGTDIQAKLIEQLYSPVLWYPSIEYMVNQGVDTFIEIGPGKVLAGLMKSIDSSVKAYAVY 298

Query: 301 KVEDIDLALRSIVG 314
             E +   + ++ G
Sbjct: 299 DEETLKDTISNLRG 312


>gi|161525352|ref|YP_001580364.1| malonyl CoA-acyl carrier protein transacylase [Burkholderia
           multivorans ATCC 17616]
 gi|189349911|ref|YP_001945539.1| [acyl-carrier-protein] S-malonyltransferase [Burkholderia
           multivorans ATCC 17616]
 gi|160342781|gb|ABX15867.1| malonyl CoA-acyl carrier protein transacylase [Burkholderia
           multivorans ATCC 17616]
 gi|189333933|dbj|BAG43003.1| [acyl-carrier-protein] S-malonyltransferase [Burkholderia
           multivorans ATCC 17616]
          Length = 310

 Score =  192 bits (486), Expect = 8e-47,   Method: Composition-based stats.
 Identities = 137/310 (44%), Positives = 175/310 (56%), Gaps = 4/310 (1%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M     FPGQGSQ +GM     D     R   +E    LNQ+L  L+  G  EEL  T N
Sbjct: 1   MKFAFVFPGQGSQAVGMLNAFAD-LAVVRETLQEASDALNQDLGKLIAEGPAEELNLTTN 59

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
            QP +   + A  R  ++ G       S VAGHSLGEYTAL AA A +  D + LVR R 
Sbjct: 60  TQPVMLTAAYACYRAWQQAGG---PAPSIVAGHSLGEYTALVAAGAIAFKDAVPLVRFRA 116

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           ++MQ AVP G G M AI+GLDD  V ++CA+AS  G+ E  N N   QVVI+G + AV+ 
Sbjct: 117 QAMQTAVPVGQGGMAAILGLDDDTVRAVCAEASSEGVVEAVNFNAPAQVVIAGAKAAVEK 176

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A +    KGAKRA+ LPVSAPFHSSL+ P S  ++  L +V  + P +P++ N   + VS
Sbjct: 177 ACEVAKAKGAKRALPLPVSAPFHSSLLKPASDQLRDYLANVEVKAPQIPVVNNIDVAVVS 236

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
               I   LV Q  G VRW E ++  A  GV  V E G GKVL GL KRID +L+  S+ 
Sbjct: 237 DPAAIKDALVRQAAGPVRWVECVKHIAGTGVTHVIECGPGKVLAGLTKRIDGNLTGASVF 296

Query: 301 KVEDIDLALR 310
               +D AL+
Sbjct: 297 DPASLDEALK 306


>gi|260597463|ref|YP_003210034.1| malonyl CoA-acyl carrier protein transacylase [Cronobacter
           turicensis z3032]
 gi|260216640|emb|CBA29952.1| Malonyl CoA-acyl carrier protein transacylase [Cronobacter
           turicensis z3032]
          Length = 324

 Score =  192 bits (486), Expect = 8e-47,   Method: Composition-based stats.
 Identities = 130/312 (41%), Positives = 177/312 (56%), Gaps = 4/312 (1%)

Query: 1   MS-TVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATC 59
           M+     FPGQGSQ +GM  D+  +FP     F E    L  +L  L+  G  EEL  T 
Sbjct: 16  MTQFAFVFPGQGSQAVGMLSDMAANFPVIEATFREASAALGYDLWALVQQGPAEELNKTW 75

Query: 60  NAQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRAR 119
             QPAL   S+A  RV ++ G       + +AGHSLGEY+AL  A     +D +RLV  R
Sbjct: 76  QTQPALLTASVALWRVWQEQGGKA---PALMAGHSLGEYSALVCAGVIDFADAVRLVELR 132

Query: 120 GKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVK 179
           GK MQEAVP G G+M AIIGLDD  +   C  A+   +    N N  GQVVI+G +DAV+
Sbjct: 133 GKFMQEAVPEGTGAMAAIIGLDDDAIAKACQDAAEGQVVSPVNFNSPGQVVIAGHKDAVE 192

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            A   C   GAKRA+ LPVS P H +LM P ++ +   L+ +T   P +P++ N      
Sbjct: 193 RAGAACKAAGAKRALPLPVSVPSHCALMKPAAEKLAAELEKITFNAPQIPVVNNVDVKCE 252

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
           +S + I   LV Q+   V+W +++++ A  GV  +YEVG GKVLTGLAKRI  +L+A +I
Sbjct: 253 TSPEAIRDALVRQLYSPVQWTKSVEFIAAQGVTQLYEVGPGKVLTGLAKRIVDTLTAAAI 312

Query: 300 SKVEDIDLALRS 311
           ++   +  AL  
Sbjct: 313 NEPASLSAALAQ 324


>gi|228954129|ref|ZP_04116157.1| Malonyl CoA-acyl carrier protein transacylase [Bacillus
           thuringiensis serovar kurstaki str. T03a001]
 gi|228805449|gb|EEM52040.1| Malonyl CoA-acyl carrier protein transacylase [Bacillus
           thuringiensis serovar kurstaki str. T03a001]
          Length = 314

 Score =  192 bits (486), Expect = 8e-47,   Method: Composition-based stats.
 Identities = 120/314 (38%), Positives = 178/314 (56%), Gaps = 5/314 (1%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
                FPGQGSQ +GMG+ L ++  E   VF + D  L  +LS++++ G QE+LT T NA
Sbjct: 3   KIAFLFPGQGSQAVGMGKQLAENNKEVAKVFAKADEVLQDSLSEVIFEGPQEKLTLTTNA 62

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPAL   S A +  +++  +       +VAGHSLGEY+AL AA A +  D +  VR RG+
Sbjct: 63  QPALLTTSFAILTALKEYDIT----PDFVAGHSLGEYSALVAAGALTFEDAVYAVRKRGE 118

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQAS-RVGICEIANDNGGGQVVISGLQDAVKC 180
            M+EAVP   G+M AI+G D  ++  +  + +      +IAN N   Q+VISG +  V+ 
Sbjct: 119 YMEEAVPGREGAMAAILGADPHMLKQVTEEVTSEGYAVQIANMNSTKQIVISGTKQGVEV 178

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A+      GAKRA+ L VS PFHSSLM P ++  + +L+ +T  D  +P++ N  A  ++
Sbjct: 179 ASQRAKENGAKRAIPLKVSGPFHSSLMKPAAEKFQSVLNEITIHDTNIPVIANVTADVIT 238

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
              +I   L+EQ+   V W  +I+     GV +  E+G GKVL GL K ID S  A +I 
Sbjct: 239 RGADIQEKLIEQLYSPVLWYPSIECMVKQGVDTFIEIGPGKVLAGLMKSIDSSAKAYAIY 298

Query: 301 KVEDIDLALRSIVG 314
             E +   + ++ G
Sbjct: 299 DEETLKDTISNLRG 312


>gi|56964067|ref|YP_175798.1| acyl-carrier-protein S-malonyltransferase [Bacillus clausii
           KSM-K16]
 gi|56910310|dbj|BAD64837.1| malonyl CoA-acyl carrier protein transacylase [Bacillus clausii
           KSM-K16]
          Length = 317

 Score =  192 bits (486), Expect = 8e-47,   Method: Composition-based stats.
 Identities = 116/314 (36%), Positives = 175/314 (55%), Gaps = 5/314 (1%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
                FPGQGSQ +GMG  L+     A+ V E  D  L   LS+++ +G +E+L  T  A
Sbjct: 3   KIAFLFPGQGSQKVGMGATLFAEDSLAKEVLERADKALGFPLSEIIEHGPEEKLKQTAYA 62

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPAL  +S A +++    G+       +VAGHSLGEY+AL A K+ +  D + LV  RG 
Sbjct: 63  QPALVTMSTAVLQLFRDAGI----QADFVAGHSLGEYSALVACKSLTFEDAVTLVHQRGT 118

Query: 122 SMQEAVPPGLGSMVAIIGLD-DCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
            M+EAVP G G+M A++GL+ + + +     A+   + E+AN N  GQ+V+SG    ++ 
Sbjct: 119 LMEEAVPQGQGAMAAVLGLNKEELEEVASEIAADGEVAELANLNCPGQIVLSGTAKGIEQ 178

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           AA     KGAKR + L VS PFHSSLM P +   K  L+     +P VP++ N  A    
Sbjct: 179 AAVLAKQKGAKRVLPLAVSGPFHSSLMKPAADQFKQALEQAPFANPTVPLIANVTAEVTD 238

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
           + + I   L EQ+   VR+ E+++     GV +  E+G+G VL GL ++ID++L   ++S
Sbjct: 239 APEVIREQLAEQIYSPVRFEESVRRMIELGVDTFIEIGAGNVLCGLVRKIDRNLRTFAVS 298

Query: 301 KVEDIDLALRSIVG 314
             E  +    ++ G
Sbjct: 299 DRESFEKMAAALKG 312


>gi|42782944|ref|NP_980191.1| acyl-carrier-protein S-malonyltransferase [Bacillus cereus ATCC
           10987]
 gi|42738871|gb|AAS42799.1| malonyl CoA-acyl carrier protein transacylase [Bacillus cereus ATCC
           10987]
          Length = 314

 Score =  192 bits (486), Expect = 8e-47,   Method: Composition-based stats.
 Identities = 122/314 (38%), Positives = 183/314 (58%), Gaps = 5/314 (1%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
                FPGQGSQ +GMG+ L ++  E   VF + D  L  +LS++++ G QE+LT T NA
Sbjct: 3   KLAFLFPGQGSQAVGMGKQLAENNKEVANVFAKADEVLQDSLSEVIFEGPQEKLTLTTNA 62

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPAL   S A +  +++  +       +VAGHSLGEY+AL AA A +  D +  VR RG+
Sbjct: 63  QPALLTTSFAILTALKEYDIT----PDFVAGHSLGEYSALVAAGALTFEDAVYAVRKRGE 118

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQAS-RVGICEIANDNGGGQVVISGLQDAVKC 180
            M+EAVP G G+M AI+G D  ++  +  + +      +IAN N   Q+VISG +  V+ 
Sbjct: 119 YMEEAVPGGEGAMAAILGADPHMLKQVTEEVTSEGHAVQIANMNSTKQIVISGTKQGVEI 178

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A+      GAKRA+ L VS PFHS+LM P ++  + +L+ +T QD  +P++ N  A  ++
Sbjct: 179 ASQRAKENGAKRAIPLKVSGPFHSALMKPAAEKFQSVLNEITIQDTNIPVIANVTADVIT 238

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
           S   I   L+EQ+   V W  +I++  + GV +  E+G GKVL GL K ID S+ A +I 
Sbjct: 239 SGAHIQEKLIEQLYSPVLWYPSIEYMVSQGVDTFIEIGPGKVLAGLMKSIDSSVKAYAIY 298

Query: 301 KVEDIDLALRSIVG 314
             E +   + ++ G
Sbjct: 299 DEETLQDTISNLRG 312


>gi|254245923|ref|ZP_04939244.1| Malonyl CoA-acyl carrier protein transacylase [Burkholderia
           cenocepacia PC184]
 gi|124870699|gb|EAY62415.1| Malonyl CoA-acyl carrier protein transacylase [Burkholderia
           cenocepacia PC184]
          Length = 322

 Score =  192 bits (486), Expect = 8e-47,   Method: Composition-based stats.
 Identities = 137/310 (44%), Positives = 175/310 (56%), Gaps = 4/310 (1%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M     FPGQGSQ IGM  D +      R   +E    LNQ+L  L+  G  EEL  T N
Sbjct: 13  MKFAFVFPGQGSQAIGML-DAFADLAVVRETLQEASDALNQDLGKLIAEGPAEELNLTTN 71

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
            QP +   + A  R  ++ G       S VAGHSLGEYTAL AA A +  D + LVR R 
Sbjct: 72  TQPVMLTAAYACYRAWQQAGG---PAPSIVAGHSLGEYTALVAAGALAFKDAVPLVRFRA 128

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           ++MQ AVP G G M AI+GLDD  V ++CA+A+  G+ E  N N   QVVI+G + AV+ 
Sbjct: 129 QAMQTAVPVGQGGMAAILGLDDDTVRAVCAEAAEAGVVEAVNFNAPAQVVIAGSKAAVEK 188

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A +    KGAKRA+ LPVSAPFHSSL+ P S  ++  L +V  + P +P++ N   + VS
Sbjct: 189 ACEIAKAKGAKRALPLPVSAPFHSSLLKPASDQLRDYLANVDVKAPQIPVVNNIDVAVVS 248

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
               I   LV Q  G VRW E ++  A  GV  V E G GKVL GL KRID +L   S+ 
Sbjct: 249 DPAAIKDALVRQAAGPVRWVECVRHIAGTGVTHVVECGPGKVLAGLTKRIDGNLVGASVF 308

Query: 301 KVEDIDLALR 310
               +D AL+
Sbjct: 309 DPASLDEALK 318


>gi|170732432|ref|YP_001764379.1| malonyl CoA-acyl carrier protein transacylase [Burkholderia
           cenocepacia MC0-3]
 gi|169815674|gb|ACA90257.1| malonyl CoA-acyl carrier protein transacylase [Burkholderia
           cenocepacia MC0-3]
          Length = 310

 Score =  192 bits (486), Expect = 8e-47,   Method: Composition-based stats.
 Identities = 137/310 (44%), Positives = 175/310 (56%), Gaps = 4/310 (1%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M     FPGQGSQ IGM  D +      R   +E    LNQ+L  L+  G  EEL  T N
Sbjct: 1   MKFAFVFPGQGSQAIGML-DAFADLAVVRETLQEASDALNQDLGKLIAEGPAEELNLTTN 59

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
            QP +   + A  R  ++ G       S VAGHSLGEYTAL AA A +  D + LVR R 
Sbjct: 60  TQPVMLTAAYACYRAWQQAGG---PAPSIVAGHSLGEYTALVAAGALAFKDAVPLVRFRA 116

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           ++MQ AVP G G M AI+GLDD  V ++CA+A+  G+ E  N N   QVVI+G + AV+ 
Sbjct: 117 QAMQTAVPVGQGGMAAILGLDDDTVRAVCAEAAEAGVVEAVNFNAPAQVVIAGSKAAVEK 176

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A +    KGAKRA+ LPVSAPFHSSL+ P S  ++  L +V  + P +P++ N   + VS
Sbjct: 177 ACEIAKAKGAKRALPLPVSAPFHSSLLKPASDQLRDYLANVDVKAPQIPVVNNIDVAVVS 236

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
               I   LV Q  G VRW E ++  A  GV  V E G GKVL GL KRID +L   S+ 
Sbjct: 237 DPAAIKDALVRQAAGPVRWVECVRHIAGTGVTHVVECGPGKVLAGLTKRIDGNLVGASVF 296

Query: 301 KVEDIDLALR 310
               +D AL+
Sbjct: 297 DPASLDEALK 306


>gi|224023767|ref|ZP_03642133.1| hypothetical protein BACCOPRO_00483 [Bacteroides coprophilus DSM
           18228]
 gi|224016989|gb|EEF75001.1| hypothetical protein BACCOPRO_00483 [Bacteroides coprophilus DSM
           18228]
          Length = 295

 Score =  192 bits (486), Expect = 8e-47,   Method: Composition-based stats.
 Identities = 101/300 (33%), Positives = 147/300 (49%), Gaps = 7/300 (2%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M     FPGQG+Q +GMG+DLY++ P A+ +FE+ +  L   ++D+M+ G+ E+L  T  
Sbjct: 1   MK-AFVFPGQGAQFVGMGKDLYENSPLAKELFEKANDILGYRITDIMFEGTDEDLRQTKV 59

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVR-AR 119
            QP     ++    V+    +         AGHSLGE++AL AA A S  D ++LV    
Sbjct: 60  TQP-----AVFLHSVISALCMGEDFKPEMTAGHSLGEFSALVAAGALSFEDGLKLVYARA 114

Query: 120 GKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVK 179
               +            I   D+ V +   + A+   +C  AN N  GQ+VISG  + + 
Sbjct: 115 MAMQKACEMQPSTMAAIIALPDEKVEEICASVAAEGEVCVAANYNCPGQIVISGSIEGIN 174

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            A +     GAKRA+ L V   FHS LM P    ++  +++     P  PI  N  A P 
Sbjct: 175 KACELMKAAGAKRALPLKVGGAFHSPLMDPAKVELEAAINATEFHTPKCPIYQNVDAKPH 234

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
           +   EI   LV Q+T  VRW +T+Q     G     E G G VL GL K+I+K  +A  I
Sbjct: 235 TDPAEIKTNLVAQLTASVRWTQTVQNMIADGADDFTECGPGAVLQGLIKKINKEANAHGI 294


>gi|229031482|ref|ZP_04187482.1| Malonyl CoA-acyl carrier protein transacylase [Bacillus cereus
           AH1271]
 gi|228729771|gb|EEL80751.1| Malonyl CoA-acyl carrier protein transacylase [Bacillus cereus
           AH1271]
          Length = 314

 Score =  192 bits (486), Expect = 8e-47,   Method: Composition-based stats.
 Identities = 124/314 (39%), Positives = 182/314 (57%), Gaps = 5/314 (1%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
                FPGQGSQ +GMG+ L ++  E   VF + D  L  +LS++++ G QE+LT T NA
Sbjct: 3   KLAFLFPGQGSQAVGMGKQLAENNKEVANVFAKADEVLQDSLSEVIFEGPQEKLTLTTNA 62

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPAL   S A +  +++  +       +VAGHSLGEY+AL AA A +  D +  VR RG+
Sbjct: 63  QPALLTTSFAILTALKEYDIT----PDFVAGHSLGEYSALVAAGAITFEDAVYAVRKRGE 118

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQAS-RVGICEIANDNGGGQVVISGLQDAVKC 180
            M+EAVP G G+M AI+G D  ++  +  + +      +IAN N   Q+VISG +  V+ 
Sbjct: 119 YMEEAVPGGEGAMAAILGADPHMLKQVTEEVTSEGYAVQIANMNSTKQIVISGTKQGVEI 178

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A+      GAKRA+ L VS PFHSSLM P ++  + +L+ +T QD  +P++ N  A  ++
Sbjct: 179 ASQRAKENGAKRAIPLKVSGPFHSSLMKPAAEKFQSVLNEITIQDTNIPVIANVTADVIT 238

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
           S   I   L+EQ+   V W  +I+   N GV +  E+G GKVL GL K ID S+ A +I 
Sbjct: 239 SGAHIQEKLIEQLYSPVLWYPSIENMVNQGVDTFIEIGPGKVLAGLMKSIDSSVKAYAIY 298

Query: 301 KVEDIDLALRSIVG 314
             E +   + ++ G
Sbjct: 299 DEETLKDTISNLRG 312


>gi|16125920|ref|NP_420484.1| acyl-carrier-protein S-malonyltransferase [Caulobacter crescentus
           CB15]
 gi|221234683|ref|YP_002517119.1| malonyl-CoA-(acyl-carrier-protein) transacylase [Caulobacter
           crescentus NA1000]
 gi|13423084|gb|AAK23652.1| malonyl CoA-acyl carrier protein transacylase [Caulobacter
           crescentus CB15]
 gi|220963855|gb|ACL95211.1| malonyl-CoA-(acyl-carrier-protein) transacylase [Caulobacter
           crescentus NA1000]
          Length = 314

 Score =  192 bits (486), Expect = 8e-47,   Method: Composition-based stats.
 Identities = 147/315 (46%), Positives = 190/315 (60%), Gaps = 4/315 (1%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           MS    FPGQGSQ +GMG DL ++F  AR VF+EVD  L Q L  LM  G + +LT T N
Sbjct: 1   MSIAFIFPGQGSQSVGMGADLAEAFSAAREVFQEVDDALGQKLFALMKEGPEGDLTLTEN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
           AQPAL AVS+A  R +EK         ++VAGHSLGEY+AL AA A SLSDT RL++ RG
Sbjct: 61  AQPALMAVSLAVTRTLEKEFGVGIDKAAFVAGHSLGEYSALAAAGAISLSDTARLLKLRG 120

Query: 121 KSMQEAVPPGL--GSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAV 178
           ++MQ AVP G    + +     D  + ++  A  S VG+C +ANDN  G VVISG + AV
Sbjct: 121 QAMQRAVPVGEGAMASLIGPKTDLALAEAAAAAGSEVGVCVVANDNNNGNVVISGAKAAV 180

Query: 179 KCAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASP 238
             A +     GA+    L VSAPFH  LM P +  M   L + T   P  P++ N  A+P
Sbjct: 181 DKAIEKAKELGARAI-PLNVSAPFHCPLMQPAADEMATALAAATIVAPRAPLVANVTAAP 239

Query: 239 VSSIDEISRLLVEQVTGRVRWRETIQWFANH-GVKSVYEVGSGKVLTGLAKRIDKSLSAV 297
           +   D I +LLVEQVTGRVRWRE++ W A   GV    E G+GKVL+G+AKRI     AV
Sbjct: 240 IHDPDVIRKLLVEQVTGRVRWRESMTWMATEGGVTRFAEAGAGKVLSGMAKRIAPDAEAV 299

Query: 298 SISKVEDIDLALRSI 312
            ++   D++   +S+
Sbjct: 300 PLNTPADLEAFAKSL 314


>gi|197334405|ref|YP_002156563.1| malonyl CoA-acyl carrier protein transacylase [Vibrio fischeri
           MJ11]
 gi|197315895|gb|ACH65342.1| malonyl CoA-acyl carrier protein transacylase [Vibrio fischeri
           MJ11]
          Length = 307

 Score =  192 bits (486), Expect = 9e-47,   Method: Composition-based stats.
 Identities = 130/309 (42%), Positives = 178/309 (57%), Gaps = 4/309 (1%)

Query: 1   MS-TVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATC 59
           MS   + FPGQGSQ +GM  +L +        F E    L  +L  L+ NG  E+L  T 
Sbjct: 1   MSNFAIVFPGQGSQAVGMLAELGEQHEVVTQTFAEASDALGYDLWSLVQNGPAEDLNQTF 60

Query: 60  NAQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRAR 119
             QPAL A S+A  RV ++ GL      S +AGHSLGEY+AL  A      + I+LV  R
Sbjct: 61  RTQPALLATSVALWRVWQEQGLA---QPSVLAGHSLGEYSALVCAGVIDFKEAIKLVELR 117

Query: 120 GKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVK 179
           G+ MQEAVP G+G+M AIIGLD+  +   C +A++  +    N N  GQVVI+G +DAV+
Sbjct: 118 GQLMQEAVPAGIGAMYAIIGLDNESIAKACEEAAQGEVVSPVNFNSPGQVVIAGNKDAVE 177

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            A   C   GAKRA+ LPVS P H +LM P +  +   L+++    P +P++ N      
Sbjct: 178 RAGALCKEAGAKRALPLPVSVPSHCALMKPAADKLAVALENIEFNTPTLPVINNVDVIAE 237

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
           +   +I   LV Q+ G VRW E ++  A  GV+++YEVG GKVLTGL KRI KSLSA  +
Sbjct: 238 TDPAKIKDALVRQLYGPVRWTEVVEKMAEQGVETLYEVGPGKVLTGLTKRIVKSLSAAEV 297

Query: 300 SKVEDIDLA 308
           +    ++ A
Sbjct: 298 NDAASLEAA 306


>gi|107022198|ref|YP_620525.1| malonyl CoA-acyl carrier protein transacylase [Burkholderia
           cenocepacia AU 1054]
 gi|105892387|gb|ABF75552.1| [Acyl-carrier-protein] S-malonyltransferase [Burkholderia
           cenocepacia AU 1054]
          Length = 310

 Score =  192 bits (486), Expect = 9e-47,   Method: Composition-based stats.
 Identities = 137/310 (44%), Positives = 175/310 (56%), Gaps = 4/310 (1%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M     FPGQGSQ IGM  D +      R   +E    LNQ+L  L+  G  EEL  T N
Sbjct: 1   MKFAFVFPGQGSQAIGML-DAFADLAVVRETLQEASDALNQDLGKLIAEGPAEELNLTTN 59

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
            QP +   + A  R  ++ G       S VAGHSLGEYTAL AA A +  D + LVR R 
Sbjct: 60  TQPVMLTAAYACYRAWQQAGG---PAPSIVAGHSLGEYTALVAAGALAFKDAVPLVRFRA 116

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           ++MQ AVP G G M AI+GLDD  V ++CA+A+  G+ E  N N   QVVI+G + AV+ 
Sbjct: 117 QAMQTAVPVGQGGMAAILGLDDDAVRAVCAEAAEAGVVEAVNFNAPAQVVIAGSKAAVEK 176

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A +    KGAKRA+ LPVSAPFHSSL+ P S  ++  L +V  + P +P++ N   + VS
Sbjct: 177 ACEIAKAKGAKRALPLPVSAPFHSSLLKPASDQLRDYLANVDVKAPQIPVVNNIDVAVVS 236

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
               I   LV Q  G VRW E ++  A  GV  V E G GKVL GL KRID +L   S+ 
Sbjct: 237 DPAAIKDALVRQAAGPVRWVECVRHIAGTGVTHVIECGPGKVLAGLTKRIDGNLVGASVF 296

Query: 301 KVEDIDLALR 310
               +D AL+
Sbjct: 297 DPASLDEALK 306


>gi|288553098|ref|YP_003425033.1| acyl-carrier-protein S-malonyltransferase [Bacillus pseudofirmus
           OF4]
 gi|288544258|gb|ADC48141.1| acyl-carrier-protein S-malonyltransferase [Bacillus pseudofirmus
           OF4]
          Length = 315

 Score =  192 bits (486), Expect = 9e-47,   Method: Composition-based stats.
 Identities = 121/314 (38%), Positives = 186/314 (59%), Gaps = 5/314 (1%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
                FPGQGSQ +GMG +L  + P+ + + +  D  L  +L+ +M  G +E+L  T N 
Sbjct: 3   KIAFLFPGQGSQAVGMGVELRTNEPKCKEILDRADSRLGYSLTKIMAEGPEEKLRRTENT 62

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPAL  +S+A + ++++  +       YVAGHSLGEY+AL AA + S  D +  V  RG 
Sbjct: 63  QPALVTMSIAVLELLKEENIT----PDYVAGHSLGEYSALVAAGSLSFEDAVYAVHNRGL 118

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQAS-RVGICEIANDNGGGQVVISGLQDAVKC 180
            M+EAVP G G+M A++G++  ++  +C +   +  + E+AN N  GQ+VISG  + V  
Sbjct: 119 FMEEAVPYGEGAMSAVLGMEADLLAEVCKEIQAKGHVAELANLNCPGQIVISGCSEGVAL 178

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
             +    KGAKR + LPVS PFHSSLM P +  ++ +L  +T +D  VP++ N  A   +
Sbjct: 179 CGELAKEKGAKRVIPLPVSGPFHSSLMKPAADKLEGVLKEITIKDAKVPVIANVTAKAQT 238

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
             +EI + LVEQV   VRW ETI+   + GV +  EVGSG VLTGL K++++   A +++
Sbjct: 239 DANEIEQKLVEQVYSPVRWEETIRELQDLGVDTFIEVGSGNVLTGLVKKVNRRAQAFAVN 298

Query: 301 KVEDIDLALRSIVG 314
             E ++  +  + G
Sbjct: 299 DRESLNKVVAKLEG 312


>gi|317047706|ref|YP_004115354.1| malonyl CoA-acyl carrier protein transacylase [Pantoea sp. At-9b]
 gi|316949323|gb|ADU68798.1| malonyl CoA-acyl carrier protein transacylase [Pantoea sp. At-9b]
          Length = 310

 Score =  192 bits (486), Expect = 9e-47,   Method: Composition-based stats.
 Identities = 129/312 (41%), Positives = 179/312 (57%), Gaps = 4/312 (1%)

Query: 1   MS-TVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATC 59
           M+   L FPGQGSQ +GM  DL   +P+    F E    L  +L  L+  G  EEL  T 
Sbjct: 1   MTQFALVFPGQGSQTVGMLADLAAEYPQVEATFREASDVLGYDLWQLVQQGPAEELNKTW 60

Query: 60  NAQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRAR 119
             QPAL A S+A  RV +          + +AGHSLGEY+AL  A   + +D I+LV  R
Sbjct: 61  QTQPALLAASVAIYRVWQSK---NAPQPAIMAGHSLGEYSALVCAGVLNFADAIKLVELR 117

Query: 120 GKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVK 179
           GK MQEAVP G G+M AIIGLDD  +   C ++++  +    N N  GQVVI+G ++AV+
Sbjct: 118 GKLMQEAVPEGTGAMQAIIGLDDAAIRKACEESAQGQVVSPVNFNSPGQVVIAGNKEAVE 177

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            A   C   GAKRA+ LPVS P H +LM P ++ +   L++++   P VP++ N      
Sbjct: 178 RAGAACKAAGAKRALPLPVSVPSHCALMKPAAEKLAVALEAISFNAPSVPVVNNVDVQCE 237

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
           +S D I   LV Q+   VRW E++++ A+ GV  + E+G GKVLTGL KRI  SL+A ++
Sbjct: 238 TSADAIRSALVRQLYSPVRWTESVEFIASQGVTQLLEIGPGKVLTGLTKRIVDSLTAAAV 297

Query: 300 SKVEDIDLALRS 311
           +    +  AL  
Sbjct: 298 NDPASLTAALTQ 309


>gi|194290165|ref|YP_002006072.1| malonyl CoA-acyl carrier protein transacylase [Cupriavidus
           taiwanensis LMG 19424]
 gi|193224000|emb|CAQ70009.1| Malonyl CoA-acyl carrier protein transacylase [Cupriavidus
           taiwanensis LMG 19424]
          Length = 309

 Score =  191 bits (485), Expect = 9e-47,   Method: Composition-based stats.
 Identities = 128/313 (40%), Positives = 168/313 (53%), Gaps = 4/313 (1%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M     FPGQGSQ +GM     D+    R   EE    L Q+L  L+  G  EEL  T N
Sbjct: 1   MKFAFVFPGQGSQSVGMLNAFADN-AVVRATVEEASAALGQDLGRLIAEGPAEELNLTTN 59

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
            QP +   ++A  R     G       + VAGHSLGEY+AL AA     +D + LVR R 
Sbjct: 60  TQPVMLTAAVAIYRAWLDAGG---PAPALVAGHSLGEYSALVAAGVIPFADAVPLVRFRA 116

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           ++MQEAVP G G M AI+GL D  V + CA+AS  G+ E  N N   QVVI+G + AV+ 
Sbjct: 117 QAMQEAVPVGEGGMAAILGLSDDDVRAACAEASATGVVEAVNFNAPSQVVIAGHKGAVEK 176

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A +    KGAKRA+ LPVSAPFHSSL+ P S  ++  +  +    P +P++ N   + V+
Sbjct: 177 ACEIAKAKGAKRALPLPVSAPFHSSLLKPASDRLRERMAGLAFSAPSIPLVNNVDVAIVN 236

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
             + I   LV Q    VRW E +Q  A  G+  V E G GKVL G+ KRID +LS  +I 
Sbjct: 237 DPEGIKDALVRQAAAPVRWVECVQKMAAEGITHVIECGPGKVLAGMTKRIDGNLSGGAIF 296

Query: 301 KVEDIDLALRSIV 313
               +   L  + 
Sbjct: 297 DPASLQDTLALLK 309


>gi|170741385|ref|YP_001770040.1| malonyl CoA-acyl carrier protein transacylase [Methylobacterium sp.
           4-46]
 gi|168195659|gb|ACA17606.1| malonyl CoA-acyl carrier protein transacylase [Methylobacterium sp.
           4-46]
          Length = 311

 Score =  191 bits (485), Expect = 9e-47,   Method: Composition-based stats.
 Identities = 160/309 (51%), Positives = 200/309 (64%), Gaps = 1/309 (0%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           MS    FPGQGSQ +GMG  L  S   AR VF EVD  L Q+LS LM+ G  EELT T N
Sbjct: 1   MSRAFIFPGQGSQAVGMGAALGQSHAAARAVFAEVDEALGQSLSRLMFEGPAEELTLTAN 60

Query: 61  AQPALTAVSMAFIRVME-KNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRAR 119
           AQPAL A S+A +RV+E + GL + RD+++VAGHSLGEY+AL AA A S++DT RL+R R
Sbjct: 61  AQPALMAASLAVLRVLEAERGLDLARDVAFVAGHSLGEYSALAAAGALSVADTARLLRLR 120

Query: 120 GKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVK 179
           G++MQ AVP G G+M A++GL    V+ I  +A +  +C++ANDNG GQVV+SG   AV+
Sbjct: 121 GEAMQRAVPVGTGAMAALLGLPIETVEEIAGEAEQGEVCDVANDNGAGQVVVSGHVAAVE 180

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            A      +GAKRAV L VSAPFH  LM+P ++ M+  LD V      VP++ N  A+P+
Sbjct: 181 RAVALAQARGAKRAVMLNVSAPFHCRLMSPAAETMRAALDQVQLGAAKVPVVANILAAPI 240

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
                I   LV QVTG VRWRE +   A  GV +  EVGSGKVLTGL KRI     AV+I
Sbjct: 241 REPAAIRDALVRQVTGTVRWRECVAAMAASGVDAFCEVGSGKVLTGLVKRIAPGAGAVAI 300

Query: 300 SKVEDIDLA 308
               DID  
Sbjct: 301 GAPADIDAF 309


>gi|258511325|ref|YP_003184759.1| malonyl CoA-acyl carrier protein transacylase [Alicyclobacillus
           acidocaldarius subsp. acidocaldarius DSM 446]
 gi|257478051|gb|ACV58370.1| malonyl CoA-acyl carrier protein transacylase [Alicyclobacillus
           acidocaldarius subsp. acidocaldarius DSM 446]
          Length = 319

 Score =  191 bits (485), Expect = 9e-47,   Method: Composition-based stats.
 Identities = 121/314 (38%), Positives = 172/314 (54%), Gaps = 5/314 (1%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M+    FPGQG+Q +GMGR ++D +P AR + EE D  L   LSD+++ G ++ L  T  
Sbjct: 1   MNVAFVFPGQGAQYVGMGRAIFDEYPVARALLEEADEALGMKLSDIIFEGPEDTLRLTYY 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
            QPAL  VS+A           V      VAGHSLGEY+AL AAK+ S +D ++LV  RG
Sbjct: 61  TQPALLTVSVAV---WRALVDRVDIQPLAVAGHSLGEYSALVAAKSISFADAVKLVYQRG 117

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQA--SRVGICEIANDNGGGQVVISGLQDAV 178
           K M EA P G G+M A++GLD+  +  +C +A      I E+AN N  GQ+VISG + AV
Sbjct: 118 KLMDEAYPAGQGTMAAVLGLDEEPLREVCKRASEETGEIVELANVNCPGQIVISGAKAAV 177

Query: 179 KCAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASP 238
           + A+      GA+R + L VS PFHSSLM P +  +  +LD +   D   P++ N    P
Sbjct: 178 ERASLLAKEAGARRVMPLNVSGPFHSSLMQPAADRLGALLDEIEFADAETPVVANVDGHP 237

Query: 239 VSSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVS 298
                ++   L +Q+   VR+ + +      GV  V E+G G VL+GL ++IDKSL    
Sbjct: 238 RRMASDLRDALKKQLVMPVRFVDCVLSMKRLGVDCVVELGPGTVLSGLVRKIDKSLETAH 297

Query: 299 ISKVEDIDLALRSI 312
                 +D     +
Sbjct: 298 AEDPATLDEVCALL 311


>gi|118479074|ref|YP_896225.1| [Acyl-carrier-protein] S-malonyltransferase [Bacillus thuringiensis
           str. Al Hakam]
 gi|196047423|ref|ZP_03114635.1| malonyl CoA-acyl carrier protein transacylase [Bacillus cereus
           03BB108]
 gi|225865833|ref|YP_002751211.1| malonyl CoA-acyl carrier protein transacylase [Bacillus cereus
           03BB102]
 gi|229186092|ref|ZP_04313261.1| Malonyl CoA-acyl carrier protein transacylase [Bacillus cereus BGSC
           6E1]
 gi|118418299|gb|ABK86718.1| [Acyl-carrier-protein] S-malonyltransferase [Bacillus thuringiensis
           str. Al Hakam]
 gi|196021731|gb|EDX60426.1| malonyl CoA-acyl carrier protein transacylase [Bacillus cereus
           03BB108]
 gi|225789525|gb|ACO29742.1| malonyl CoA-acyl carrier protein transacylase [Bacillus cereus
           03BB102]
 gi|228597268|gb|EEK54919.1| Malonyl CoA-acyl carrier protein transacylase [Bacillus cereus BGSC
           6E1]
          Length = 314

 Score =  191 bits (485), Expect = 9e-47,   Method: Composition-based stats.
 Identities = 123/314 (39%), Positives = 183/314 (58%), Gaps = 5/314 (1%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
                FPGQGSQ +GMG+ L ++  E   VF + D  L  +LS++++ G QE+LT T NA
Sbjct: 3   KLAFLFPGQGSQAVGMGKQLAENNKEVANVFAKADEVLQDSLSEVIFEGPQEKLTLTTNA 62

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPAL   S A +  +++  +       +VAGHSLGEY+AL AA A +  D +  VR RG+
Sbjct: 63  QPALLTTSFAILTALKEYDIT----PDFVAGHSLGEYSALVAAGALTFEDAVYAVRKRGE 118

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQAS-RVGICEIANDNGGGQVVISGLQDAVKC 180
            M+EAVP G G+M AI+G D  ++  +  + +      +IAN N   Q+VISG +  V+ 
Sbjct: 119 YMEEAVPGGEGAMAAILGADPHMLKQVTEEVTGEGYAVQIANMNSTKQIVISGTKQGVEI 178

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A+      GAKRA+ L VS PFHS+LM P ++  + +L+ +T QD  +P++ N  A  ++
Sbjct: 179 ASQRSKENGAKRAIPLKVSGPFHSALMKPAAEKFQSVLNEITIQDTNIPVIANVTADVIT 238

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
           S   I   L+EQ+   V W  +I++  N GV +  E+G GKVL GL K ID S+ A +I 
Sbjct: 239 SGAHIQEKLIEQLYSPVLWYPSIEYMVNQGVDTFIEIGPGKVLAGLMKSIDSSVKAYAIY 298

Query: 301 KVEDIDLALRSIVG 314
             E +   + ++ G
Sbjct: 299 DEETLKDTISNLRG 312


>gi|217961272|ref|YP_002339840.1| malonyl CoA-acyl carrier protein transacylase [Bacillus cereus
           AH187]
 gi|228986995|ref|ZP_04147121.1| Malonyl CoA-acyl carrier protein transacylase [Bacillus
           thuringiensis serovar tochigiensis BGSC 4Y1]
 gi|229140497|ref|ZP_04269052.1| Malonyl CoA-acyl carrier protein transacylase [Bacillus cereus
           BDRD-ST26]
 gi|217063459|gb|ACJ77709.1| malonyl CoA-acyl carrier protein transacylase [Bacillus cereus
           AH187]
 gi|228643058|gb|EEK99334.1| Malonyl CoA-acyl carrier protein transacylase [Bacillus cereus
           BDRD-ST26]
 gi|228772773|gb|EEM21213.1| Malonyl CoA-acyl carrier protein transacylase [Bacillus
           thuringiensis serovar tochigiensis BGSC 4Y1]
          Length = 314

 Score =  191 bits (485), Expect = 9e-47,   Method: Composition-based stats.
 Identities = 122/314 (38%), Positives = 183/314 (58%), Gaps = 5/314 (1%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
                FPGQGSQ +GMG+ L ++  E   VF + D  L  +LS++++ G QE+LT T NA
Sbjct: 3   KLAFLFPGQGSQAVGMGKQLAENNKEVANVFAKADEVLQDSLSEVIFEGPQEKLTLTTNA 62

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPAL   S A +  +++  +       +VAGHSLGEY+AL AA A +  D +  VR RG+
Sbjct: 63  QPALLTTSFAILTALKEYDIT----PDFVAGHSLGEYSALVAAGALTFEDAVYAVRKRGE 118

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQAS-RVGICEIANDNGGGQVVISGLQDAVKC 180
            M+EAVP G G+M AI+G D  ++  +  + +      +IAN N   Q+VISG +  V+ 
Sbjct: 119 YMEEAVPGGEGAMAAILGADPHMLKQVTEEVTSEGYAVQIANMNSTKQIVISGTKQGVEI 178

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A+      GAKRA+ L VS PFHS+LM P ++  + +L+ +T QD  +P++ N  A  ++
Sbjct: 179 ASQRAKEHGAKRAIPLKVSGPFHSALMKPAAEKFQSVLNEITIQDTNIPVIANVTADVIT 238

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
           S   I   L+EQ+   V W  +I++  + GV +  E+G GKVL GL K ID S+ A +I 
Sbjct: 239 SGAHIQEKLIEQLYSPVLWYPSIEYMVSQGVDTFIEIGPGKVLAGLMKSIDSSVKAYAIY 298

Query: 301 KVEDIDLALRSIVG 314
             E +   + ++ G
Sbjct: 299 DEETLQDTISNLRG 312


>gi|254510229|ref|ZP_05122296.1| malonyl CoA-acyl carrier protein transacylase [Rhodobacteraceae
           bacterium KLH11]
 gi|221533940|gb|EEE36928.1| malonyl CoA-acyl carrier protein transacylase [Rhodobacteraceae
           bacterium KLH11]
          Length = 317

 Score =  191 bits (485), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 155/311 (49%), Positives = 214/311 (68%), Gaps = 1/311 (0%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M+    FPGQG+Q IGMG+ L +++P AR VF+EVD  L + LSDL+W+G   +LT T N
Sbjct: 6   MTRAFVFPGQGAQTIGMGKALAEAYPAARAVFDEVDEALGEKLSDLIWDGDIADLTLTQN 65

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
           AQPAL A S+A +R +E  G  +    SYVAGHSLGEY+AL AA A S++DT RL+R RG
Sbjct: 66  AQPALMATSIAALRALEAEGASISM-ASYVAGHSLGEYSALAAAGALSVADTARLLRTRG 124

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           ++MQ AVP G G+M AI+GLD   V ++ A+A++  +C+ ANDN   QVV+SG + AV+ 
Sbjct: 125 QAMQSAVPVGEGAMAAILGLDLEAVRAVAAEAAQGEVCQAANDNDPTQVVVSGDKAAVER 184

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           AA+    KGAKRA+ LPVSAPFH +LM P + VM   L +V  + P VP++ N  A  VS
Sbjct: 185 AAEIAKEKGAKRAIMLPVSAPFHCALMQPAADVMAEALAAVEIKAPAVPLVANVRAEAVS 244

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
             D I +LLVEQVTG VRWRE++Q+    GV   +E+G+GK L+G+ ++ID++LS  ++ 
Sbjct: 245 DPDTIRQLLVEQVTGAVRWRESVQYMVAQGVTEAWEIGAGKALSGMIRKIDRALSFQAVG 304

Query: 301 KVEDIDLALRS 311
             ED+  A+ +
Sbjct: 305 SPEDVQKAVAT 315


>gi|126462108|ref|YP_001043222.1| malonyl CoA-acyl carrier protein transacylase [Rhodobacter
           sphaeroides ATCC 17029]
 gi|126103772|gb|ABN76450.1| [Acyl-carrier-protein] S-malonyltransferase [Rhodobacter
           sphaeroides ATCC 17029]
          Length = 310

 Score =  191 bits (485), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 158/311 (50%), Positives = 207/311 (66%), Gaps = 1/311 (0%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           MS    FPGQG+Q IGMGR L +++P AR VFEEVD  L + LS L+W+GS EELT T N
Sbjct: 1   MSRAFVFPGQGAQTIGMGRALAEAYPAARAVFEEVDEALGEKLSALIWDGSIEELTLTQN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
           AQPAL A SMA +  +E  GL +    S+VAGHSLGEY+ALCAAK+  LSDT RL+R RG
Sbjct: 61  AQPALMATSMAALAALEVEGLGI-ATASFVAGHSLGEYSALCAAKSLKLSDTARLLRIRG 119

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           ++MQEAVP G+G+M A++GLD      +  +A++  +C+ ANDN   QVV+SG + AV+ 
Sbjct: 120 QAMQEAVPVGVGAMAALLGLDYDTAVEVAHEAAQGEVCQAANDNDPAQVVVSGHKAAVER 179

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A +    +GAKRA+ LPVSAPFH +LM   + VM   L +V  + PV P++ N  A  VS
Sbjct: 180 AVEIAKGRGAKRAILLPVSAPFHCALMQHAASVMSEALAAVVIEAPVCPVVVNVRAEAVS 239

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
             D I  LLV QVTG VRWRE++ W  N GV   +E+G+GK L+G+ KRI K  +  +I 
Sbjct: 240 EPDRIRALLVAQVTGAVRWRESVMWMENAGVDEFWEIGAGKALSGMIKRIAKGAATRAIG 299

Query: 301 KVEDIDLALRS 311
             ED+  A  +
Sbjct: 300 TPEDVAAAATA 310


>gi|229157428|ref|ZP_04285506.1| Malonyl CoA-acyl carrier protein transacylase [Bacillus cereus ATCC
           4342]
 gi|228626155|gb|EEK82904.1| Malonyl CoA-acyl carrier protein transacylase [Bacillus cereus ATCC
           4342]
          Length = 314

 Score =  191 bits (485), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 123/314 (39%), Positives = 183/314 (58%), Gaps = 5/314 (1%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
                FPGQGSQ +GMG+ L ++  E   VF + D  L  +LS++++ G QE+LT T NA
Sbjct: 3   KLAFLFPGQGSQAVGMGKQLAENNKEVANVFAKADEVLQDSLSEVIFEGPQEKLTLTTNA 62

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPAL   S A +  +++  +       +VAGHSLGEY+AL AA A +  D +  VR RG+
Sbjct: 63  QPALLTTSFAILTALKEYDIT----PDFVAGHSLGEYSALVAAGALTFEDAVYAVRKRGE 118

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQAS-RVGICEIANDNGGGQVVISGLQDAVKC 180
            M+EAVP G G+M AI+G D  ++  +  + +      +IAN N   Q+VISG +  V+ 
Sbjct: 119 YMEEAVPGGEGAMAAILGADPHMLKQVTEEVTSEGYAVQIANMNSTKQIVISGTKQGVEI 178

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A+      GAKRA+ L VS PFHS+LM P ++  + +L+ +T QD  +P++ N  A  ++
Sbjct: 179 ASQRAKENGAKRAIPLKVSGPFHSALMKPAAEKFQSVLNEITIQDTNIPVIANVTADVIT 238

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
           S   I   L+EQ+   V W  +I++  N GV +  E+G GKVL GL K ID S+ A +I 
Sbjct: 239 SGAHIQEKLIEQLYSPVLWYPSIEYMVNQGVDTFIEIGPGKVLAGLMKSIDSSVKAYAIY 298

Query: 301 KVEDIDLALRSIVG 314
             E +   + ++ G
Sbjct: 299 DEETLKDTISNLRG 312


>gi|49478416|ref|YP_037913.1| acyl-carrier-protein S-malonyltransferase [Bacillus thuringiensis
           serovar konkukian str. 97-27]
 gi|52141637|ref|YP_085193.1| acyl-carrier-protein S-malonyltransferase [Bacillus cereus E33L]
 gi|167636664|ref|ZP_02394954.1| malonyl CoA-acyl carrier protein transacylase [Bacillus anthracis
           str. A0442]
 gi|170689650|ref|ZP_02880831.1| malonyl CoA-acyl carrier protein transacylase [Bacillus anthracis
           str. A0465]
 gi|196035786|ref|ZP_03103188.1| malonyl CoA-acyl carrier protein transacylase [Bacillus cereus W]
 gi|196042320|ref|ZP_03109596.1| [acyl-carrier-protein] S-malonyltransferase [Bacillus cereus
           NVH0597-99]
 gi|228916489|ref|ZP_04080055.1| Malonyl CoA-acyl carrier protein transacylase [Bacillus
           thuringiensis serovar pulsiensis BGSC 4CC1]
 gi|228928900|ref|ZP_04091932.1| Malonyl CoA-acyl carrier protein transacylase [Bacillus
           thuringiensis serovar pondicheriensis BGSC 4BA1]
 gi|228935166|ref|ZP_04097993.1| Malonyl CoA-acyl carrier protein transacylase [Bacillus
           thuringiensis serovar andalousiensis BGSC 4AW1]
 gi|229123366|ref|ZP_04252570.1| Malonyl CoA-acyl carrier protein transacylase [Bacillus cereus
           95/8201]
 gi|254683440|ref|ZP_05147300.1| acyl-carrier-protein S-malonyltransferase [Bacillus anthracis str.
           CNEVA-9066]
 gi|254721383|ref|ZP_05183172.1| acyl-carrier-protein S-malonyltransferase [Bacillus anthracis str.
           A1055]
 gi|254739523|ref|ZP_05197220.1| acyl-carrier-protein S-malonyltransferase [Bacillus anthracis str.
           Kruger B]
 gi|301055343|ref|YP_003793554.1| acyl-carrier-protein S-malonyltransferase [Bacillus anthracis CI]
 gi|49329972|gb|AAT60618.1| malonyl CoA-acyl carrier protein transacylase [Bacillus
           thuringiensis serovar konkukian str. 97-27]
 gi|51975106|gb|AAU16656.1| malonyl CoA-acyl carrier protein transacylase [Bacillus cereus
           E33L]
 gi|167527915|gb|EDR90731.1| malonyl CoA-acyl carrier protein transacylase [Bacillus anthracis
           str. A0442]
 gi|170666395|gb|EDT17177.1| malonyl CoA-acyl carrier protein transacylase [Bacillus anthracis
           str. A0465]
 gi|195991435|gb|EDX55401.1| malonyl CoA-acyl carrier protein transacylase [Bacillus cereus W]
 gi|196026842|gb|EDX65473.1| [acyl-carrier-protein] S-malonyltransferase [Bacillus cereus
           NVH0597-99]
 gi|228660142|gb|EEL15778.1| Malonyl CoA-acyl carrier protein transacylase [Bacillus cereus
           95/8201]
 gi|228824531|gb|EEM70336.1| Malonyl CoA-acyl carrier protein transacylase [Bacillus
           thuringiensis serovar andalousiensis BGSC 4AW1]
 gi|228830707|gb|EEM76312.1| Malonyl CoA-acyl carrier protein transacylase [Bacillus
           thuringiensis serovar pondicheriensis BGSC 4BA1]
 gi|228843068|gb|EEM88150.1| Malonyl CoA-acyl carrier protein transacylase [Bacillus
           thuringiensis serovar pulsiensis BGSC 4CC1]
 gi|300377512|gb|ADK06416.1| acyl-carrier-protein S-malonyltransferase [Bacillus cereus biovar
           anthracis str. CI]
          Length = 314

 Score =  191 bits (485), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 123/314 (39%), Positives = 183/314 (58%), Gaps = 5/314 (1%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
                FPGQGSQ +GMG+ L ++  E   VF + D  L  +LS++++ G QE+LT T NA
Sbjct: 3   KLAFLFPGQGSQAVGMGKQLAENNKEVANVFAKADEVLQDSLSEVIFEGPQEKLTLTTNA 62

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPAL   S A +  +++  +       +VAGHSLGEY+AL AA A +  D +  VR RG+
Sbjct: 63  QPALLTTSFAILTALKEYDIT----PDFVAGHSLGEYSALVAAGALTFEDAVYAVRKRGE 118

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQAS-RVGICEIANDNGGGQVVISGLQDAVKC 180
            M+EAVP G G+M AI+G D  ++  +  + +      +IAN N   Q+VISG +  V+ 
Sbjct: 119 YMEEAVPGGEGAMAAILGADPHMLKQVTEEVTGEGYAVQIANMNSTKQIVISGTKQGVEI 178

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A+      GAKRA+ L VS PFHS+LM P ++  + +L+ +T QD  +P++ N  A  ++
Sbjct: 179 ASQRAKENGAKRAIPLKVSGPFHSALMKPAAEKFQSVLNEITIQDTNIPVIANVTADVIT 238

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
           S   I   L+EQ+   V W  +I++  N GV +  E+G GKVL GL K ID S+ A +I 
Sbjct: 239 SGAHIQEKLIEQLYSPVLWYPSIEYMVNQGVDTFIEIGPGKVLAGLMKSIDSSVKAYAIY 298

Query: 301 KVEDIDLALRSIVG 314
             E +   + ++ G
Sbjct: 299 DEETLKDTISNLRG 312


>gi|114320578|ref|YP_742261.1| [Acyl-carrier-protein] S-malonyltransferase [Alkalilimnicola
           ehrlichii MLHE-1]
 gi|114226972|gb|ABI56771.1| [Acyl-carrier-protein] S-malonyltransferase [Alkalilimnicola
           ehrlichii MLHE-1]
          Length = 314

 Score =  191 bits (485), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 119/307 (38%), Positives = 166/307 (54%), Gaps = 3/307 (0%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
                FPGQGSQ +GM  DL  + P     F E    L  +L DL+ NG ++ L  T   
Sbjct: 7   KLAFVFPGQGSQSVGMMDDLASASPVVEQTFREAGDALGADLWDLVRNGPEDTLNRTDYT 66

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPA+ A  +A  R     G     + + +AGHSLGEYTAL  A A    D +RLV  RG+
Sbjct: 67  QPAMLAAGVATWRAWRSEGGA---EPTVLAGHSLGEYTALVCAGALGFQDAVRLVAQRGR 123

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCA 181
            MQEAVP G G+M A++GL+D  V   CA A+   +    N N  GQVVI+G + AV+ A
Sbjct: 124 FMQEAVPAGQGAMAAVLGLNDQAVIDACAAAAGDEVVSAVNFNAPGQVVIAGARAAVERA 183

Query: 182 ADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSS 241
              C + GAK+ + LPVS P H +LM P ++ +  +L  +  + P +P++ N      S 
Sbjct: 184 MAACESAGAKKVMPLPVSVPSHCALMKPAAERLAEVLADIPLEAPAIPVVHNVDVQTASD 243

Query: 242 IDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISK 301
            + I   L+ Q+   VRW ETI    + GV  V E G GKVL GL +RI + L  V+++ 
Sbjct: 244 PNAIRERLIAQLHNPVRWVETIHALVDQGVTQVVECGPGKVLAGLNRRIQRRLPVVALAD 303

Query: 302 VEDIDLA 308
            + ++ A
Sbjct: 304 AKSLEKA 310


>gi|260776334|ref|ZP_05885229.1| malonyl CoA-acyl carrier protein transacylase [Vibrio
           coralliilyticus ATCC BAA-450]
 gi|260607557|gb|EEX33822.1| malonyl CoA-acyl carrier protein transacylase [Vibrio
           coralliilyticus ATCC BAA-450]
          Length = 307

 Score =  191 bits (485), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 125/309 (40%), Positives = 175/309 (56%), Gaps = 4/309 (1%)

Query: 1   MS-TVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATC 59
           MS   + FPGQGSQ +GM  +L + +   +  F E    L  +L  L+ NG  E+L  T 
Sbjct: 1   MSNFAIVFPGQGSQAVGMLAELGEQYEVVKNTFSEASEALGYDLWALVQNGPAEDLNQTF 60

Query: 60  NAQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRAR 119
             QPAL A S+A  RV ++ GL      + +AGHSLGEY+AL  A      + I+LV  R
Sbjct: 61  RTQPALLASSVAIWRVWQELGL---EQPANLAGHSLGEYSALVCAGVIDFKEAIKLVELR 117

Query: 120 GKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVK 179
           G+ MQEAVP G G+M AIIGLDD  +   C  A++  +    N N  GQVVI+G +DAV+
Sbjct: 118 GQLMQEAVPAGSGAMFAIIGLDDESIAKACEDAAQGEVVSPVNYNSPGQVVIAGSKDAVE 177

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            A   C   GAKRA+ LPVS P H +LM P +  +   L+ +    P +P++ N      
Sbjct: 178 RAGALCKEAGAKRALPLPVSVPSHCALMKPAADKLAVALEEIEFNAPQLPVINNVDVVAE 237

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
           +   +I   LV Q+   VRW E++Q  +  GV+ + E+G GKVLTGL KRI K+LS  ++
Sbjct: 238 TDPAKIKNALVRQLYSPVRWTESVQLMSEQGVEKLLELGPGKVLTGLTKRIVKTLSGAAV 297

Query: 300 SKVEDIDLA 308
           +    ++ A
Sbjct: 298 NDAASLEAA 306


>gi|229168591|ref|ZP_04296314.1| Malonyl CoA-acyl carrier protein transacylase [Bacillus cereus
           AH621]
 gi|228614997|gb|EEK72099.1| Malonyl CoA-acyl carrier protein transacylase [Bacillus cereus
           AH621]
          Length = 314

 Score =  191 bits (485), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 122/314 (38%), Positives = 183/314 (58%), Gaps = 5/314 (1%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
                FPGQGSQ +GMGR L ++  E   VF + D  L+ +LS++++ G QE+LT T NA
Sbjct: 3   KIAFLFPGQGSQAVGMGRQLAENNKEVAKVFAKADEVLHDSLSEVIFEGPQEKLTLTTNA 62

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPAL   S A +  +++  +       +VAGHSLGEY+AL AA A +  D +  VR RG+
Sbjct: 63  QPALLTTSFAILTALKEYDIT----PDFVAGHSLGEYSALVAAGALTFEDAVYAVRKRGE 118

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQAS-RVGICEIANDNGGGQVVISGLQDAVKC 180
            M+EAVP G G+M AI+G D  ++  +  + +      +IAN N   Q+VISG +  V+ 
Sbjct: 119 YMEEAVPGGEGAMAAILGADPDMLKRVTEEVTSEGYAVQIANMNSTKQIVISGTKQGVEL 178

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A+      GAKRA+ L VS PFHSSLM P ++  + +L+ +T QD  +P++ N  A  ++
Sbjct: 179 ASQRAKENGAKRAIPLKVSGPFHSSLMKPAAEKFQSVLNEITIQDTNIPVIANVTADVIT 238

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
              +I   L+EQ+   V W  +I++  N GV +  E+G GKVL GL K ID S+   ++ 
Sbjct: 239 RGTDIQAKLIEQLYSPVLWYPSIEYMVNQGVDTFIEIGPGKVLAGLMKSIDSSVKVYAVY 298

Query: 301 KVEDIDLALRSIVG 314
             E +   + ++ G
Sbjct: 299 DEETLRDTISNLRG 312


>gi|27379193|ref|NP_770722.1| acyl-carrier-protein S-malonyltransferase [Bradyrhizobium japonicum
           USDA 110]
 gi|27352344|dbj|BAC49347.1| malonyl-CoA:acyl carrier protein transacylase [Bradyrhizobium
           japonicum USDA 110]
          Length = 319

 Score =  191 bits (485), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 155/306 (50%), Positives = 205/306 (66%), Gaps = 1/306 (0%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M+   TFPGQGSQ +GMG+ L D+FP AR VF+EVD  L + L+  +W+G  E L  T N
Sbjct: 1   MTAAFTFPGQGSQAVGMGKALADAFPVARAVFDEVDAALGEKLTATIWDGPAETLQLTEN 60

Query: 61  AQPALTAVSMAFIRVME-KNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRAR 119
           AQPAL AVS+A +RV+E + G  V RD ++VAGHSLGEY+ L AA + ++SDT RL+R R
Sbjct: 61  AQPALMAVSVATLRVLEAEAGFSVGRDAAFVAGHSLGEYSGLAAAGSLTVSDTARLLRTR 120

Query: 120 GKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVK 179
           G +MQ+AVP G G+M A++GLD      +  +A++  +C+ ANDNGGGQVV+SG + AV 
Sbjct: 121 GLAMQKAVPVGAGAMAALLGLDYEAAMEVANEAAQGQVCQAANDNGGGQVVVSGDKAAVD 180

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            A +    KGAKRA+ LPVSAPFH  LM P +  M   L  VT + P  P++ N  A+ +
Sbjct: 181 RAVEIAKTKGAKRAMLLPVSAPFHCKLMQPAADAMAEALAKVTIKAPAAPLVSNVLATAI 240

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
           +  DEI R LVEQVTG VRWRE++ + A  GV   +E+G+GKVLTGL KRI      V++
Sbjct: 241 TDPDEIRRRLVEQVTGTVRWRESVAYMAGQGVTRFFEIGAGKVLTGLVKRIADGAVGVAV 300

Query: 300 SKVEDI 305
               DI
Sbjct: 301 GGPNDI 306


>gi|229092894|ref|ZP_04224028.1| Malonyl CoA-acyl carrier protein transacylase [Bacillus cereus
           Rock3-42]
 gi|228690516|gb|EEL44299.1| Malonyl CoA-acyl carrier protein transacylase [Bacillus cereus
           Rock3-42]
          Length = 314

 Score =  191 bits (485), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 123/314 (39%), Positives = 183/314 (58%), Gaps = 5/314 (1%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
                FPGQGSQ +GMG+ L ++  E   VF + D  L  +LS++++ G QE+LT T NA
Sbjct: 3   KLAFLFPGQGSQAVGMGKQLAENNKEVANVFAKADEVLQDSLSEVIFEGPQEKLTLTTNA 62

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPAL   S A +  +++  +       +VAGHSLGEY+AL AA A +  D +  VR RG+
Sbjct: 63  QPALLTTSFAILTALKEYDVT----PDFVAGHSLGEYSALVAAGALTFEDAVYAVRKRGE 118

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQAS-RVGICEIANDNGGGQVVISGLQDAVKC 180
            M+EAVP G G+M AI+G D  ++  +  + +      +IAN N   Q+VISG +  V+ 
Sbjct: 119 YMEEAVPGGEGAMAAILGADPHMLKQVTEEVTGEGYAVQIANMNSTKQIVISGTKQGVEI 178

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A+      GAKRA+ L VS PFHS+LM P ++  + +L+ +T QD  +P++ N  A  ++
Sbjct: 179 ASQRAKENGAKRAIPLKVSGPFHSALMKPAAEKFQSVLNEITIQDTNIPVIANVTADVIT 238

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
           S   I   L+EQ+   V W  +I++  N GV +  E+G GKVL GL K ID S+ A +I 
Sbjct: 239 SGAHIQEKLIEQLYSPVLWYPSIEYMVNQGVDTFIEIGPGKVLAGLMKSIDSSVKAYAIY 298

Query: 301 KVEDIDLALRSIVG 314
             E +   + ++ G
Sbjct: 299 DEETLKDTISNLRG 312


>gi|323705475|ref|ZP_08117050.1| malonyl CoA-acyl carrier protein transacylase
           [Thermoanaerobacterium xylanolyticum LX-11]
 gi|323535377|gb|EGB25153.1| malonyl CoA-acyl carrier protein transacylase
           [Thermoanaerobacterium xylanolyticum LX-11]
          Length = 310

 Score =  191 bits (485), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 121/312 (38%), Positives = 181/312 (58%), Gaps = 5/312 (1%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M     +PGQG+Q  GMG+++Y+++ EAR VFEE +  L  +++ L + G  EEL  T N
Sbjct: 1   MKIAFIYPGQGAQYTGMGKEIYENYAEAREVFEEANDALRYDITRLCFEGPDEELMKTEN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
            QPA+  VS+A  +V+ K G          AG SLGEY++L  +   S  D ++LV+ RG
Sbjct: 61  TQPAILTVSIALTKVLSKRG----LKADVTAGLSLGEYSSLVYSGVLSFKDAVKLVKKRG 116

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           + MQ AVP G+G M AIIGLD+ VV++IC      G+ E AN N  GQ+ I+G   A++ 
Sbjct: 117 EYMQNAVPIGIGGMAAIIGLDNEVVENICYNIREFGVVEPANYNCPGQLSIAGEIKALEK 176

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A +    KGAK+AV LPVSAPFH S++      ++  L  V   D +VP++ N  A  + 
Sbjct: 177 AVELAKEKGAKKAVMLPVSAPFHCSMLKDAGIKLEEDLKQVPIFDMLVPVITNVTADYLK 236

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
             +    L V+QV+  V W ++++   +  V+   E+G GK LTG  KRIDK+  A++  
Sbjct: 237 IDEVKKTL-VKQVSSPVLWEQSVRKMIDDQVEVFIEIGPGKTLTGFMKRIDKTKKAINFE 295

Query: 301 KVEDIDLALRSI 312
            +  +D  L ++
Sbjct: 296 DMSSLDKLLSTL 307


>gi|218904982|ref|YP_002452816.1| malonyl CoA-acyl carrier protein transacylase [Bacillus cereus
           AH820]
 gi|218538226|gb|ACK90624.1| malonyl CoA-acyl carrier protein transacylase [Bacillus cereus
           AH820]
          Length = 314

 Score =  191 bits (485), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 123/314 (39%), Positives = 184/314 (58%), Gaps = 5/314 (1%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
                FPGQGSQ +GMG+ L ++  E   VF + D  L  +LS++++ G QE+LT T NA
Sbjct: 3   KLAFLFPGQGSQAVGMGKQLAENNKEVANVFAKADEVLQDSLSEVIFEGPQEKLTLTTNA 62

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPAL   S A +  +++  +       +VAGHSLGEY+AL AA A + +D +  VR RG+
Sbjct: 63  QPALLTTSFAILTALKEYDIT----PDFVAGHSLGEYSALVAAGALTFADAVYAVRKRGE 118

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQAS-RVGICEIANDNGGGQVVISGLQDAVKC 180
            M+EAVP G G+M AI+G D  ++  +  + +      +IAN N   Q+VISG +  V+ 
Sbjct: 119 YMEEAVPGGEGAMAAILGADPHMLKQVTEEVTGEGYAVQIANMNSTKQIVISGTKQGVEI 178

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A+      GAKRA+ L VS PFHS+LM P ++  + +L+ +T QD  +P++ N  A  ++
Sbjct: 179 ASQRAKENGAKRAIPLKVSGPFHSALMKPAAEKFQSVLNEITIQDTNIPVIANVTADVIT 238

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
           S   I   L+EQ+   V W  +I++  N GV +  E+G GKVL GL K ID S+ A +I 
Sbjct: 239 SGAHIQEKLIEQLYSPVLWYPSIEYMVNQGVDTFIEIGPGKVLAGLMKSIDSSVKAYAIY 298

Query: 301 KVEDIDLALRSIVG 314
             E +   + ++ G
Sbjct: 299 DEETLKDTISNLRG 312


>gi|170695410|ref|ZP_02886555.1| malonyl CoA-acyl carrier protein transacylase [Burkholderia
           graminis C4D1M]
 gi|170139601|gb|EDT07784.1| malonyl CoA-acyl carrier protein transacylase [Burkholderia
           graminis C4D1M]
          Length = 311

 Score =  191 bits (485), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 133/310 (42%), Positives = 175/310 (56%), Gaps = 4/310 (1%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M     FPGQGSQ +GM     D     R   +E    L+Q+L  L+  G  E+L  T N
Sbjct: 1   MKFAFVFPGQGSQSVGMLNAFAD-HAIVRETVQEASDALSQDLGKLIAEGPAEDLNLTTN 59

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
            QP +   + A  R  ++ G       + VAGHSLGEYTAL AA A +  D + LVR R 
Sbjct: 60  TQPVMLTAAYAIYRAWQQAGG---PAPAIVAGHSLGEYTALVAAGAIAFRDAVPLVRFRA 116

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           ++MQ AVP G G M AI+GLDD  V ++CA+AS  G+ E  N N   QVVI+G + AV+ 
Sbjct: 117 QAMQTAVPVGEGGMAAILGLDDDTVRAVCAEASVAGVVEAVNFNAPAQVVIAGHKAAVEK 176

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A +    KGAKRA+ LPVSAPFHSSL+ P S  ++  L SV  + P +P++ N   + V+
Sbjct: 177 ACEVAKAKGAKRALPLPVSAPFHSSLLKPASDQLREYLASVDVKVPSIPVINNVDVAIVN 236

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
              +I   LV Q  G VRW E++Q  A  GV  V E G GKVL GL KRID +L   S+ 
Sbjct: 237 EPAQIKDALVRQAAGAVRWVESVQAMAAQGVTHVVECGPGKVLAGLTKRIDGNLVGASVF 296

Query: 301 KVEDIDLALR 310
               ++  L+
Sbjct: 297 DPASLEGTLK 306


>gi|317492370|ref|ZP_07950799.1| malonyl CoA-acyl carrier protein transacylase [Enterobacteriaceae
           bacterium 9_2_54FAA]
 gi|316919709|gb|EFV41039.1| malonyl CoA-acyl carrier protein transacylase [Enterobacteriaceae
           bacterium 9_2_54FAA]
          Length = 309

 Score =  191 bits (484), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 127/310 (40%), Positives = 170/310 (54%), Gaps = 3/310 (0%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
              + FPGQGSQ +GM  DL   FP     F E    L  +L  L+  G  EEL  T   
Sbjct: 3   KFAMVFPGQGSQTVGMLADLATQFPIVEQTFAEASDALGYDLWKLVQEGPAEELNKTWQT 62

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPAL A S+A  RV ++         + +AGHSLGEY+AL  A        IRLV  RGK
Sbjct: 63  QPALLAASVAIYRVWQQQ---NGAQPAMMAGHSLGEYSALVCAGVLDFKQAIRLVELRGK 119

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCA 181
            MQEAVP G G+M AIIGLD+  +   C ++++  +    N N  GQVVI+G +DAV+ A
Sbjct: 120 LMQEAVPAGTGAMSAIIGLDNDAIAKACEESAQGEVVSPVNFNSPGQVVIAGNKDAVERA 179

Query: 182 ADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSS 241
              C   GAKRA+ LPVS P H +LM P ++ +   L  VT   P   ++ N      +S
Sbjct: 180 GAACKAAGAKRALPLPVSVPSHCALMKPAAEKLAVALQEVTFNAPKFAVINNVDVKTETS 239

Query: 242 IDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISK 301
            + I   LV Q+   VRW E++++ A  GV+ + EVG GKVLTGL KRI  +++A +I+ 
Sbjct: 240 PEAIRDALVRQLYSPVRWSESVEFMAGEGVEHLLEVGPGKVLTGLTKRIVDTMTAAAIND 299

Query: 302 VEDIDLALRS 311
              +  AL  
Sbjct: 300 AASVSAALAQ 309


>gi|229104414|ref|ZP_04235083.1| Malonyl CoA-acyl carrier protein transacylase [Bacillus cereus
           Rock3-28]
 gi|228679112|gb|EEL33320.1| Malonyl CoA-acyl carrier protein transacylase [Bacillus cereus
           Rock3-28]
          Length = 314

 Score =  191 bits (484), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 122/314 (38%), Positives = 179/314 (57%), Gaps = 5/314 (1%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
                FPGQGSQ +GMGR L ++  E   VF + D  L  +LS++++ G QE+LT T NA
Sbjct: 3   KIAFLFPGQGSQAVGMGRQLAENNNEVAKVFAKADEVLQDSLSEVIFEGPQEKLTLTTNA 62

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPAL   S A +  +++  +       +VAGHSLGEY+AL AA A +  D +  VR RG+
Sbjct: 63  QPALLTTSFAILTALKEYDIT----PDFVAGHSLGEYSALVAAGAITFEDAVYAVRKRGE 118

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQAS-RVGICEIANDNGGGQVVISGLQDAVKC 180
            M+EAVP G G+M AI+G D  ++  +  + +      +IAN N   Q+VISG    V+ 
Sbjct: 119 YMEEAVPGGEGAMAAILGADPDMLKRVTEEVTSEGYAVQIANMNSTKQIVISGTNQGVEL 178

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A+      GAKRA+ L VS PFHSSLM P ++  + +L+ +T QD  +P++ N  A  ++
Sbjct: 179 ASQRAKENGAKRAIPLKVSGPFHSSLMKPAAEKFQSVLNEITIQDTNIPVIANVTADVIT 238

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
              +I   L+EQ+   V W  +I+     GV +  E+G GKVL GL K ID S+ A +I 
Sbjct: 239 RGADIQEKLIEQLYSPVLWYPSIETMVKQGVDTFIEIGPGKVLAGLMKSIDSSVKAYAIY 298

Query: 301 KVEDIDLALRSIVG 314
               +   + ++ G
Sbjct: 299 DEATLKETISNLRG 312


>gi|229197963|ref|ZP_04324677.1| Malonyl CoA-acyl carrier protein transacylase [Bacillus cereus
           m1293]
 gi|228585442|gb|EEK43546.1| Malonyl CoA-acyl carrier protein transacylase [Bacillus cereus
           m1293]
          Length = 314

 Score =  191 bits (484), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 122/314 (38%), Positives = 184/314 (58%), Gaps = 5/314 (1%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
                FPGQGSQ +GMG+ L ++  E   VF + D  L  +LS++++ G QE+LT T NA
Sbjct: 3   KLAFLFPGQGSQAVGMGKQLAENNKEVANVFAKADEVLQDSLSEVIFEGPQEKLTLTTNA 62

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPAL   S+A +  +++  +       +VAGHSLGEY+AL AA A +  D +  VR RG+
Sbjct: 63  QPALLTTSLAILTALKEYDIT----PDFVAGHSLGEYSALVAAGALTFEDAVYAVRKRGE 118

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQAS-RVGICEIANDNGGGQVVISGLQDAVKC 180
            M+EAVP G G+M AI+G D  ++  +  + +      +IAN N   Q+VISG +  V+ 
Sbjct: 119 YMEEAVPGGEGAMAAILGADPHMLKQVTEEVTSEGYAVQIANMNSTKQIVISGTKQGVEI 178

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A+      GAKRA+ L VS PFHS+LM P ++  + +L+ +T QD  +P++ N  A  ++
Sbjct: 179 ASQRAKEHGAKRAIPLKVSGPFHSALMKPAAEKFQSVLNEITIQDTNIPVIANVTADVIT 238

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
           S   I   L+EQ+   V W  +I++  + GV +  E+G GKVL GL K ID S+ A +I 
Sbjct: 239 SGAHIQEKLIEQLYSPVLWYPSIEYMVSQGVDTFIEIGPGKVLAGLMKSIDSSVKAYAIY 298

Query: 301 KVEDIDLALRSIVG 314
             E +   + ++ G
Sbjct: 299 DEETLQDTISNLRG 312


>gi|303240741|ref|ZP_07327254.1| malonyl CoA-acyl carrier protein transacylase [Acetivibrio
           cellulolyticus CD2]
 gi|302591629|gb|EFL61364.1| malonyl CoA-acyl carrier protein transacylase [Acetivibrio
           cellulolyticus CD2]
          Length = 324

 Score =  191 bits (484), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 115/311 (36%), Positives = 175/311 (56%), Gaps = 4/311 (1%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
                F GQG+Q +GMG+++ +++  +  VF +    L  ++  +++    E L  T N 
Sbjct: 3   KLAFIFSGQGAQYVGMGKEIAEAYKASDEVFNQASEALGFDVKKMVFESDDETLKITENT 62

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QP +   S+A ++ + +NG+        VAG SLGEY+A  AA   S  D + LVR RGK
Sbjct: 63  QPTIVTTSIACLQPLLENGI----KPDVVAGLSLGEYSAHVAAGTMSFKDAVALVRKRGK 118

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCA 181
            MQEAVP G+G+M AI+GLD+  V   C  A+  GI   AN N  GQVVI+G   AV+ A
Sbjct: 119 FMQEAVPVGVGAMAAILGLDNEKVIECCKTAASDGIVGPANFNCPGQVVIAGEVKAVERA 178

Query: 182 ADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSS 241
           A+     GAKRA+ LPVSAPFH S++ P  + +   LD +   D  +P++ N  A  +  
Sbjct: 179 AELAKEAGAKRAMMLPVSAPFHCSMLKPAGEKLSAELDKIMFNDMKIPVVTNVTAEYILD 238

Query: 242 IDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISK 301
              +  LLV QV+  V + E+I+   + GV +  E+G GK L G  K+I+K +  +++  
Sbjct: 239 KSVVKDLLVSQVSSPVLFEESIRKMIDDGVDTFVEIGPGKTLIGFVKKINKDVKTLNVDD 298

Query: 302 VEDIDLALRSI 312
           +E ++  LR +
Sbjct: 299 LESLNTTLREL 309


>gi|39996702|ref|NP_952653.1| malonyl CoA-acyl carrier protein transacylase [Geobacter
           sulfurreducens PCA]
 gi|39983583|gb|AAR34976.1| malonyl CoA-acyl carrier protein transacylase [Geobacter
           sulfurreducens PCA]
 gi|298505713|gb|ADI84436.1| malonyl-CoA--acyl carrier protein transacylase [Geobacter
           sulfurreducens KN400]
          Length = 307

 Score =  191 bits (484), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 132/304 (43%), Positives = 181/304 (59%), Gaps = 3/304 (0%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
                FPGQGSQ  GMG+DL D+FP AR VFEE D  L  +LS L + G +E+L  T N 
Sbjct: 3   KRAFIFPGQGSQYAGMGKDLADTFPVARQVFEEADDALGSSLSRLCFEGPEEQLKLTANT 62

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPA+   S+A  RV++           ++AGHSLGEY+AL AA A   +D +R VRARG 
Sbjct: 63  QPAILTTSVAAFRVLQA---ETGLTADFLAGHSLGEYSALVAAGALGFADAVRTVRARGT 119

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCA 181
            MQEAVP G G+M A++G++  V+  ICA+A++  +   AN N  GQ+VI+G   AV  A
Sbjct: 120 FMQEAVPVGEGAMAAMLGIEPAVLAEICAEAAQGEVVSPANFNSPGQIVIAGNTGAVNRA 179

Query: 182 ADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSS 241
            +    KG ++A+ LPVSAPFHSSLM P  + +  +L +V   D V P++ N  A+P S 
Sbjct: 180 IEIAKAKGFRKAMLLPVSAPFHSSLMVPAGERLAEVLAAVAVGDLVAPVVTNVEATPNSD 239

Query: 242 IDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISK 301
              +  LLV QV+  V W  +++   + GV    E+G GKVL+GL KRI+K     ++  
Sbjct: 240 KGRVKELLVRQVSAPVLWDASVREMVSLGVTRFVEIGPGKVLSGLVKRIEKEAGTANVED 299

Query: 302 VEDI 305
              I
Sbjct: 300 TAGI 303


>gi|218290498|ref|ZP_03494618.1| malonyl CoA-acyl carrier protein transacylase [Alicyclobacillus
           acidocaldarius LAA1]
 gi|218239519|gb|EED06714.1| malonyl CoA-acyl carrier protein transacylase [Alicyclobacillus
           acidocaldarius LAA1]
          Length = 319

 Score =  191 bits (484), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 122/314 (38%), Positives = 173/314 (55%), Gaps = 5/314 (1%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M+    FPGQG+Q +GMGR ++D +P AR + EE D  L   LSD++++G +E L  T  
Sbjct: 1   MNVAFVFPGQGAQYVGMGRAIFDEYPVARALLEEADEALGMKLSDIIFHGPEETLRLTYY 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
            QPAL  VS+A           V      VAGHSLGEY+AL AAK+ S +D ++LV  RG
Sbjct: 61  TQPALLTVSVAV---WRALVDRVDIQPLAVAGHSLGEYSALVAAKSISFADAVKLVYQRG 117

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQA--SRVGICEIANDNGGGQVVISGLQDAV 178
           K M EA P G G+M A++GLD+  +  +C +A      I E+AN N  GQ+VISG + AV
Sbjct: 118 KLMDEAYPAGQGTMAAVLGLDEEPLREVCKRASEETGEIVELANVNCPGQIVISGAKAAV 177

Query: 179 KCAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASP 238
           + A+      GA+R + L VS PFHSSLM P +  +  +LD +   D   P++ N    P
Sbjct: 178 ERASVLAKEAGARRVMPLNVSGPFHSSLMQPAADRLGALLDEIEFADAETPVVANVDGHP 237

Query: 239 VSSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVS 298
                ++   L +Q+   VR+ + +      GV  V E+G G VL+GL ++IDKSL    
Sbjct: 238 RRMASDLRDALKKQLVMPVRFVDCVLSMKRLGVDCVVELGPGTVLSGLVRKIDKSLQTAH 297

Query: 299 ISKVEDIDLALRSI 312
                 +D     +
Sbjct: 298 AEDPATLDEVCALL 311


>gi|159044726|ref|YP_001533520.1| malonyl CoA-acyl carrier protein transacylase [Dinoroseobacter
           shibae DFL 12]
 gi|157912486|gb|ABV93919.1| malonyl CoA-acyl carrier protein transacylase [Dinoroseobacter
           shibae DFL 12]
          Length = 315

 Score =  191 bits (484), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 154/311 (49%), Positives = 214/311 (68%), Gaps = 1/311 (0%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           MS    FPGQG+Q IGMGRDL +++P AR VFEEVD  L + LS L+W G  + LT T N
Sbjct: 1   MSRAFVFPGQGAQTIGMGRDLAEAYPAARAVFEEVDDALGEALSALIWEGEADRLTLTEN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
           AQPAL A S+A +R +E  G     ++S  AGHSLGEY+AL AA A S+ DT RL+RARG
Sbjct: 61  AQPALMATSLAALRALEAEG-LDWAEVSCAAGHSLGEYSALAAAGALSVGDTARLLRARG 119

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           ++MQEAVP G+G+M A++GL+   V ++  +A++  +CE ANDN  GQVV+SG + AV+ 
Sbjct: 120 RAMQEAVPVGVGAMAALLGLNFETVCAVAEEAAQGEVCEAANDNDPGQVVVSGHKAAVER 179

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A D    +GAKRAV LPVSAPFH +LM P ++ MK  L +V    P VP++ N  A+PV+
Sbjct: 180 AVDLAKARGAKRAVLLPVSAPFHCALMAPAAETMKDALAAVEIATPRVPVIANVLAAPVT 239

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
           + ++I  LL+ Q+TG VRWRE++ W A +GV  ++E+G+GK L G+ +RID+S++  +I 
Sbjct: 240 APEQIRDLLIRQITGSVRWRESVGWMAQNGVTEIWEIGAGKALIGMVRRIDRSIATQAIG 299

Query: 301 KVEDIDLALRS 311
             ED+     +
Sbjct: 300 TSEDVRKVCTT 310


>gi|256060589|ref|ZP_05450757.1| malonyl CoA-acyl carrier protein transacylase [Brucella neotomae
           5K33]
 gi|261324586|ref|ZP_05963783.1| malonyl CoA-acyl carrier protein transacylase [Brucella neotomae
           5K33]
 gi|261300566|gb|EEY04063.1| malonyl CoA-acyl carrier protein transacylase [Brucella neotomae
           5K33]
          Length = 314

 Score =  191 bits (484), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 174/301 (57%), Positives = 221/301 (73%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M+   TFPGQGSQ +GMG+ L + F EAR VF+EVD  L + LS  M+ G ++ LT T N
Sbjct: 1   MAVAFTFPGQGSQAVGMGKALAEQFAEARAVFDEVDEALGEKLSATMFEGPEDVLTLTAN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
           AQPAL AVSMA  R+ME  G  +K  +SYVAGHSLGEY+ALCAA  FSL+DT RL+R RG
Sbjct: 61  AQPALMAVSMAVQRIMEARGFSLKDKVSYVAGHSLGEYSALCAAGTFSLADTARLLRIRG 120

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
             MQ+AVP G G+M AIIGL+   V+++C +A   G  +IANDNGGGQ+VISG + AV+ 
Sbjct: 121 NVMQKAVPVGEGAMAAIIGLEHGDVEAVCMEAKASGPVQIANDNGGGQLVISGARAAVEL 180

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           AA     KGAKRA+ LPVSAPFHS+LM P +  M+  L +V K DPVVP++ N  A+PV+
Sbjct: 181 AAKLGSEKGAKRAIMLPVSAPFHSTLMAPAADAMREALAAVEKHDPVVPLIANVRAAPVT 240

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
             +EI+ LLVEQVTG+VRWRETI+WF+ +GV ++YEVG GKVLTGLA+RI K +S  ++ 
Sbjct: 241 DANEIAALLVEQVTGQVRWRETIEWFSANGVTTLYEVGCGKVLTGLARRISKDVSGAAVG 300

Query: 301 K 301
            
Sbjct: 301 S 301


>gi|333030514|ref|ZP_08458575.1| malonyl CoA-acyl carrier protein transacylase [Bacteroides
           coprosuis DSM 18011]
 gi|332741111|gb|EGJ71593.1| malonyl CoA-acyl carrier protein transacylase [Bacteroides
           coprosuis DSM 18011]
          Length = 292

 Score =  191 bits (484), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 115/299 (38%), Positives = 161/299 (53%), Gaps = 7/299 (2%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M     FPGQG+Q +GMG+DLY++ P A+ +FE+ +  L   ++D+M++G+ EEL  T  
Sbjct: 1   MK-AFVFPGQGAQFVGMGKDLYENSPLAKDLFEKANDILGYRITDIMFSGTDEELRQTKV 59

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
            QP     ++    V+       + +    AGHSLGE++AL AA A S  D +RLV AR 
Sbjct: 60  TQP-----AVFLHSVISALCADGEFNPDMTAGHSLGEFSALVAAGALSFEDGLRLVYARA 114

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
            +MQ+A     G+M AII L D  V+ ICA  +       AN N  GQVVISG    ++ 
Sbjct: 115 MAMQKACEAAPGTMAAIIALPDDKVEEICASITDEVCI-AANYNCPGQVVISGSMAGIEK 173

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A +     GAKRA+ L V   FHS LM P    ++  + + T   P  P+  N  A P +
Sbjct: 174 ACELMKEAGAKRALPLKVGGAFHSPLMEPARVELEAAIKATTINTPKCPVYQNVDAKPHT 233

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
              EI   LV Q+T  VRW +++Q     G     E G G VL GL ++IDK++SA  I
Sbjct: 234 DPAEIKENLVAQLTSSVRWTQSVQNMIADGATEFIECGPGAVLQGLIRKIDKAVSAKGI 292


>gi|37679458|ref|NP_934067.1| acyl carrier protein S-malonyltransferase [Vibrio vulnificus YJ016]
 gi|37198202|dbj|BAC94038.1| S-malonyltransferase [Vibrio vulnificus YJ016]
          Length = 307

 Score =  191 bits (484), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 125/307 (40%), Positives = 175/307 (57%), Gaps = 3/307 (0%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
              + FPGQGSQ +GM  DL + +   +  F +    L  +L  L+ NG  E+L  T   
Sbjct: 3   KFAIVFPGQGSQAVGMLADLGEQYEIVKQTFAQASEALGYDLWALVQNGPAEDLNQTFRT 62

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPAL A S+A  RV ++ GL        +AGHSLGEY+AL  A      + I+LV  RG+
Sbjct: 63  QPALLASSVAIWRVWQELGLA---QPENLAGHSLGEYSALVCAGVIDFQEAIKLVELRGQ 119

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCA 181
            MQEAVP G G+M AIIGLDD  +   C +A++  +    N N  GQVVI+G +DAV+ A
Sbjct: 120 LMQEAVPAGTGAMYAIIGLDDEAIAKACEEAAQGEVVSPVNFNSPGQVVIAGSKDAVERA 179

Query: 182 ADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSS 241
              C   GAKRA+ LPVS P H +LM P ++ +   L+S+  + P +P++ N      + 
Sbjct: 180 GALCKEAGAKRALPLPVSVPSHCALMKPAAEKLAVALESIEFKAPQLPVINNVDVVAETD 239

Query: 242 IDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISK 301
              I   LV Q+   VRW E+++  ++ GV+ + E+G GKVLTGL KRI KSL A  ++ 
Sbjct: 240 PARIKDALVRQLYSPVRWTESVELMSSQGVEKLLEMGPGKVLTGLTKRIVKSLEAAVVND 299

Query: 302 VEDIDLA 308
           V  +D  
Sbjct: 300 VASLDAV 306


>gi|218899005|ref|YP_002447416.1| malonyl CoA-acyl carrier protein transacylase [Bacillus cereus
           G9842]
 gi|228902355|ref|ZP_04066512.1| Malonyl CoA-acyl carrier protein transacylase [Bacillus
           thuringiensis IBL 4222]
 gi|228966800|ref|ZP_04127844.1| Malonyl CoA-acyl carrier protein transacylase [Bacillus
           thuringiensis serovar sotto str. T04001]
 gi|218542537|gb|ACK94931.1| malonyl CoA-acyl carrier protein transacylase [Bacillus cereus
           G9842]
 gi|228792899|gb|EEM40457.1| Malonyl CoA-acyl carrier protein transacylase [Bacillus
           thuringiensis serovar sotto str. T04001]
 gi|228857324|gb|EEN01827.1| Malonyl CoA-acyl carrier protein transacylase [Bacillus
           thuringiensis IBL 4222]
          Length = 314

 Score =  191 bits (484), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 121/314 (38%), Positives = 181/314 (57%), Gaps = 5/314 (1%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
                FPGQGSQ +GMG+ L ++  E   VF + D  L  +LS++++ G QE+LT T NA
Sbjct: 3   KIAFLFPGQGSQAVGMGKQLAENNKEVAKVFAKADEVLQDSLSEVIFEGPQEKLTLTTNA 62

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPAL   S A +  +++  +      ++VAGHSLGEY+AL AA A +  D +  VR RG+
Sbjct: 63  QPALLTTSFAILTALKEYDIT----PNFVAGHSLGEYSALVAAGALTFEDAVYAVRKRGE 118

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQAS-RVGICEIANDNGGGQVVISGLQDAVKC 180
            M+EAVP G G+M AI+G D  ++  +  + +      +IAN N   Q+VISG +  V+ 
Sbjct: 119 YMEEAVPDGEGAMAAILGADLDMLKQVTEEVTSEGYAVQIANMNSTKQIVISGTKQGVEV 178

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A+      GAKRA+ L VS PFHSSLM P ++  + +L+ +T  D  +P++ N  A  ++
Sbjct: 179 ASQRAKENGAKRAIPLKVSGPFHSSLMKPAAEKFQSVLNEITIHDTNIPVIANVTADVIT 238

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
              +I   L+EQ+   V W  +I+     GV +  E+G GKVL GL K ID S+ A +I 
Sbjct: 239 RGADIQEKLIEQLYSPVLWYPSIECMVQQGVDTFIEIGPGKVLAGLMKSIDSSVKAYAIY 298

Query: 301 KVEDIDLALRSIVG 314
             E +   + ++ G
Sbjct: 299 DEETLKDTISNLRG 312


>gi|253699785|ref|YP_003020974.1| malonyl CoA-acyl carrier protein transacylase [Geobacter sp. M21]
 gi|251774635|gb|ACT17216.1| malonyl CoA-acyl carrier protein transacylase [Geobacter sp. M21]
          Length = 311

 Score =  191 bits (484), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 126/307 (41%), Positives = 179/307 (58%), Gaps = 3/307 (0%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
           S    FPGQGSQ  GMG++L ++F  AR+ FEE D  L  +LS L + G +EEL  T N 
Sbjct: 3   SYAFIFPGQGSQHAGMGKELAENFKSARISFEEADDALGFSLSRLCFEGPEEELKLTANT 62

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPA+ A S+A +RV+ +         S++AGHSLGEY+AL A+ A   +D +R VRARG 
Sbjct: 63  QPAILAASVAALRVLRE---ETPLTPSFLAGHSLGEYSALVASGALDFADALRTVRARGS 119

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCA 181
            MQ+AVP G+G+M AI+G +   +  ICA+A++  +   AN N  GQ+V++G   AV  A
Sbjct: 120 FMQDAVPVGVGAMAAILGAEAEQLAEICAEAAQGEVVSPANFNSPGQIVVAGHTAAVNRA 179

Query: 182 ADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSS 241
            +    KG ++A+ LPVSAPFH +LM   ++ +   L  V       P++ N  A P S 
Sbjct: 180 IEIAKAKGFRKAMLLPVSAPFHCALMQKAAERLAETLQPVQVNPLATPVVTNVEAKPNSD 239

Query: 242 IDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISK 301
              +  LLVEQV   V W + +Q     GV +  E+G GKVL GL KRI+K  ++ ++  
Sbjct: 240 PARVKPLLVEQVCAPVLWDQIVQQIIAAGVTNFVEIGPGKVLAGLVKRINKETASFNVQD 299

Query: 302 VEDIDLA 308
           V  +   
Sbjct: 300 VAGVKAL 306


>gi|148558951|ref|YP_001258475.1| malonyl CoA-acyl carrier protein transacylase [Brucella ovis ATCC
           25840]
 gi|161618428|ref|YP_001592315.1| malonyl CoA-acyl carrier protein transacylase [Brucella canis ATCC
           23365]
 gi|163842737|ref|YP_001627141.1| malonyl CoA-acyl carrier protein transacylase [Brucella suis ATCC
           23445]
 gi|225851993|ref|YP_002732226.1| malonyl CoA-acyl carrier protein transacylase [Brucella melitensis
           ATCC 23457]
 gi|254701260|ref|ZP_05163088.1| malonyl CoA-acyl carrier protein transacylase [Brucella suis bv. 5
           str. 513]
 gi|254707815|ref|ZP_05169643.1| malonyl CoA-acyl carrier protein transacylase [Brucella
           pinnipedialis M163/99/10]
 gi|254709603|ref|ZP_05171414.1| malonyl CoA-acyl carrier protein transacylase [Brucella
           pinnipedialis B2/94]
 gi|254712981|ref|ZP_05174792.1| malonyl CoA-acyl carrier protein transacylase [Brucella ceti
           M644/93/1]
 gi|254716665|ref|ZP_05178476.1| malonyl CoA-acyl carrier protein transacylase [Brucella ceti
           M13/05/1]
 gi|256031095|ref|ZP_05444709.1| malonyl CoA-acyl carrier protein transacylase [Brucella
           pinnipedialis M292/94/1]
 gi|256112980|ref|ZP_05453883.1| malonyl CoA-acyl carrier protein transacylase [Brucella melitensis
           bv. 3 str. Ether]
 gi|256159168|ref|ZP_05456981.1| malonyl CoA-acyl carrier protein transacylase [Brucella ceti
           M490/95/1]
 gi|256254498|ref|ZP_05460034.1| malonyl CoA-acyl carrier protein transacylase [Brucella ceti B1/94]
 gi|256264501|ref|ZP_05467033.1| acyl transferase domain-containing protein [Brucella melitensis bv.
           2 str. 63/9]
 gi|260566940|ref|ZP_05837410.1| acyl transferase domain-containing protein [Brucella suis bv. 4
           str. 40]
 gi|261218466|ref|ZP_05932747.1| malonyl CoA-acyl carrier protein transacylase [Brucella ceti
           M13/05/1]
 gi|261221673|ref|ZP_05935954.1| malonyl CoA-acyl carrier protein transacylase [Brucella ceti B1/94]
 gi|261315301|ref|ZP_05954498.1| malonyl CoA-acyl carrier protein transacylase [Brucella
           pinnipedialis M163/99/10]
 gi|261317131|ref|ZP_05956328.1| malonyl CoA-acyl carrier protein transacylase [Brucella
           pinnipedialis B2/94]
 gi|261320684|ref|ZP_05959881.1| malonyl CoA-acyl carrier protein transacylase [Brucella ceti
           M644/93/1]
 gi|261751799|ref|ZP_05995508.1| malonyl CoA-acyl carrier protein transacylase [Brucella suis bv. 5
           str. 513]
 gi|265988170|ref|ZP_06100727.1| malonyl CoA-acyl carrier protein transacylase [Brucella
           pinnipedialis M292/94/1]
 gi|265994416|ref|ZP_06106973.1| malonyl CoA-acyl carrier protein transacylase [Brucella melitensis
           bv. 3 str. Ether]
 gi|265997636|ref|ZP_06110193.1| malonyl CoA-acyl carrier protein transacylase [Brucella ceti
           M490/95/1]
 gi|306842258|ref|ZP_07474921.1| malonyl CoA-acyl carrier protein transacylase [Brucella sp. BO2]
 gi|148370208|gb|ABQ60187.1| malonyl CoA-acyl carrier protein transacylase [Brucella ovis ATCC
           25840]
 gi|161335239|gb|ABX61544.1| malonyl CoA-acyl carrier protein transacylase [Brucella canis ATCC
           23365]
 gi|163673460|gb|ABY37571.1| malonyl CoA-acyl carrier protein transacylase [Brucella suis ATCC
           23445]
 gi|225640358|gb|ACO00272.1| malonyl CoA-acyl carrier protein transacylase [Brucella melitensis
           ATCC 23457]
 gi|260156458|gb|EEW91538.1| acyl transferase domain-containing protein [Brucella suis bv. 4
           str. 40]
 gi|260920257|gb|EEX86910.1| malonyl CoA-acyl carrier protein transacylase [Brucella ceti B1/94]
 gi|260923555|gb|EEX90123.1| malonyl CoA-acyl carrier protein transacylase [Brucella ceti
           M13/05/1]
 gi|261293374|gb|EEX96870.1| malonyl CoA-acyl carrier protein transacylase [Brucella ceti
           M644/93/1]
 gi|261296354|gb|EEX99850.1| malonyl CoA-acyl carrier protein transacylase [Brucella
           pinnipedialis B2/94]
 gi|261304327|gb|EEY07824.1| malonyl CoA-acyl carrier protein transacylase [Brucella
           pinnipedialis M163/99/10]
 gi|261741552|gb|EEY29478.1| malonyl CoA-acyl carrier protein transacylase [Brucella suis bv. 5
           str. 513]
 gi|262552104|gb|EEZ08094.1| malonyl CoA-acyl carrier protein transacylase [Brucella ceti
           M490/95/1]
 gi|262765529|gb|EEZ11318.1| malonyl CoA-acyl carrier protein transacylase [Brucella melitensis
           bv. 3 str. Ether]
 gi|263094833|gb|EEZ18571.1| acyl transferase domain-containing protein [Brucella melitensis bv.
           2 str. 63/9]
 gi|264660367|gb|EEZ30628.1| malonyl CoA-acyl carrier protein transacylase [Brucella
           pinnipedialis M292/94/1]
 gi|306287638|gb|EFM59085.1| malonyl CoA-acyl carrier protein transacylase [Brucella sp. BO2]
          Length = 314

 Score =  191 bits (484), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 174/301 (57%), Positives = 222/301 (73%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M+   TFPGQGSQ +GMG+ L + F EAR VF+EVD  L + LS  M+ G ++ LT T N
Sbjct: 1   MAVAFTFPGQGSQAVGMGKALAEQFAEARAVFDEVDEALGEKLSATMFEGPEDVLTLTAN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
           AQPAL AVSMA  R+ME  G  +K  +SYVAGHSLGEY+ALCAA  FSL+DT RL+R RG
Sbjct: 61  AQPALMAVSMAVQRIMEARGFSLKDKVSYVAGHSLGEYSALCAAGTFSLADTARLLRIRG 120

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
            +MQ+AVP G G+M AIIGL+   V+++C +A   G  +IANDNGGGQ+VISG + AV+ 
Sbjct: 121 NAMQKAVPVGEGAMAAIIGLEHGDVEAVCMEAKASGPVQIANDNGGGQLVISGARAAVEL 180

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           AA     KGAKRA+ LPVSAPFHS+LM P +  M+  L +V K DPVVP++ N  A+PV+
Sbjct: 181 AAKLGSEKGAKRAIMLPVSAPFHSTLMAPAADAMREALAAVEKHDPVVPLIANVRAAPVT 240

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
             +EI+ LLVEQVTG+VRWRETI+WF+ +GV ++YEVG GKVLTGLA+RI K +S  ++ 
Sbjct: 241 DANEIAALLVEQVTGQVRWRETIEWFSANGVTTLYEVGCGKVLTGLARRISKDVSGAAVG 300

Query: 301 K 301
            
Sbjct: 301 S 301


>gi|225626964|ref|ZP_03785003.1| malonyl CoA-acyl carrier protein transacylase [Brucella ceti str.
           Cudo]
 gi|260168226|ref|ZP_05755037.1| malonyl CoA-acyl carrier protein transacylase [Brucella sp. F5/99]
 gi|261757688|ref|ZP_06001397.1| acyl transferase domain-containing protein [Brucella sp. F5/99]
 gi|225618621|gb|EEH15664.1| malonyl CoA-acyl carrier protein transacylase [Brucella ceti str.
           Cudo]
 gi|261737672|gb|EEY25668.1| acyl transferase domain-containing protein [Brucella sp. F5/99]
          Length = 314

 Score =  191 bits (484), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 174/301 (57%), Positives = 221/301 (73%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M+   TFPGQGSQ +GMG+ L + F EAR VF+EVD  L + LS  M+ G ++ LT T N
Sbjct: 1   MAVAFTFPGQGSQAVGMGKALAEQFAEARAVFDEVDEALGEKLSATMFEGPEDVLTLTAN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
           AQPAL AVSMA  R+ME  G  +K  +SYVAGHSLGEY+ALCAA  FSL+DT RL+R RG
Sbjct: 61  AQPALMAVSMAVQRIMEARGFSLKDKVSYVAGHSLGEYSALCAAGTFSLADTARLLRIRG 120

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
            +MQ AVP G G+M AIIGL+   V+++C +A   G  +IANDNGGGQ+VISG + AV+ 
Sbjct: 121 NAMQTAVPVGEGAMAAIIGLEHGDVEAVCMEAKASGPVQIANDNGGGQLVISGARAAVEL 180

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           AA     KGAKRA+ LPVSAPFHS+LM P +  M+  L +V K DPVVP++ N  A+PV+
Sbjct: 181 AAKLGSEKGAKRAIMLPVSAPFHSTLMAPAADAMREALAAVEKHDPVVPLIANVRAAPVT 240

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
             +EI+ LLVEQVTG+VRWRETI+WF+ +GV ++YEVG GKVLTGLA+RI K +S  ++ 
Sbjct: 241 DANEIAALLVEQVTGQVRWRETIEWFSANGVTTLYEVGCGKVLTGLARRISKDVSGAAVG 300

Query: 301 K 301
            
Sbjct: 301 S 301


>gi|254785808|ref|YP_003073237.1| malonyl CoA-acyl carrier protein transacylase [Teredinibacter
           turnerae T7901]
 gi|237685480|gb|ACR12744.1| malonyl CoA-acyl carrier protein transacylase [Teredinibacter
           turnerae T7901]
          Length = 323

 Score =  190 bits (483), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 120/317 (37%), Positives = 174/317 (54%), Gaps = 9/317 (2%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
                FPGQGSQ +GM  DL +S+   +  F +    L  +L  L+  G QEEL  T   
Sbjct: 5   KLAFVFPGQGSQKVGMLGDLAESYTVVKDTFAQASEALGYDLWKLVQEGPQEELNMTEVT 64

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPAL   S+A  RV ++ G         +AGHSLGE++AL  A     +D ++LVR RG+
Sbjct: 65  QPALLTASVATWRVWQEKGGA---KPEMMAGHSLGEWSALVCAGIVDFTDAVKLVRMRGQ 121

Query: 122 SMQEAVPPGLGSMVAIIGLDD------CVVDSICAQASRVGICEIANDNGGGQVVISGLQ 175
            MQEAVP G+G+M AIIGLDD      C        ++   I    N N  GQ+VI+G  
Sbjct: 122 FMQEAVPAGIGAMAAIIGLDDSLVEEACTAAMAAEASNAQDIVSPVNYNSPGQLVIAGHA 181

Query: 176 DAVKCAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFC 235
            AV+ A   C + GAKRA+ LPVSAPFH++LM P +  +   + S   + P +P++ N  
Sbjct: 182 AAVERAMALCKDAGAKRALLLPVSAPFHTALMKPAADRLAEHIQSTAFESPSIPVVHNVT 241

Query: 236 ASPVSSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLS 295
           A  ++  +EI  ++V Q+   VRW   +    + G+ +  E G GKVL+GL KRID++L+
Sbjct: 242 AQTLTDAEEIKAIMVAQIYSAVRWVACVNALTSAGIGTTVECGPGKVLSGLNKRIDRALN 301

Query: 296 AVSISKVEDIDLALRSI 312
            +S    + +   L ++
Sbjct: 302 TLSTDSEDALSATLLAL 318


>gi|256368910|ref|YP_003106416.1| acyl-carrier-protein S-malonyltransferase [Brucella microti CCM
           4915]
 gi|255999068|gb|ACU47467.1| acyl-carrier-protein S-malonyltransferase [Brucella microti CCM
           4915]
          Length = 314

 Score =  190 bits (483), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 174/301 (57%), Positives = 222/301 (73%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M+   TFPGQGSQ +GMG+ L + F EAR VF+EVD  L + LS  M+ G ++ LT T N
Sbjct: 1   MAVAFTFPGQGSQAVGMGKALAEQFAEARAVFDEVDEALGEKLSATMFEGPEDVLTLTAN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
           AQPAL AVSMA  R+ME  G  +K  +SYVAGHSLGEY+ALCAA  FSL+DT RL+R RG
Sbjct: 61  AQPALMAVSMAVQRIMEARGFSLKDKVSYVAGHSLGEYSALCAAGTFSLADTARLLRIRG 120

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
            +MQ+AVP G G+M AIIGL+   V+++C +A   G  +IANDNGGGQ+VISG + AV+ 
Sbjct: 121 NAMQKAVPVGEGAMAAIIGLEHGDVEAVCMEAKASGPVQIANDNGGGQLVISGARAAVEL 180

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           AA     KGAKRA+ LPVSAPFHS+LM P +  M+  L +V K DPVVP++ N  A+PV+
Sbjct: 181 AAKLGSEKGAKRAIMLPVSAPFHSTLMAPAADAMREALAAVEKHDPVVPLIANARAAPVT 240

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
             +EI+ LLVEQVTG+VRWRETI+WF+ +GV ++YEVG GKVLTGLA+RI K +S  ++ 
Sbjct: 241 DANEIAALLVEQVTGQVRWRETIEWFSANGVTTLYEVGCGKVLTGLARRISKDVSGAAVG 300

Query: 301 K 301
            
Sbjct: 301 S 301


>gi|197105020|ref|YP_002130397.1| malonyl CoA-acyl carrier protein transacylase [Phenylobacterium
           zucineum HLK1]
 gi|196478440|gb|ACG77968.1| malonyl CoA-acyl carrier protein transacylase [Phenylobacterium
           zucineum HLK1]
          Length = 314

 Score =  190 bits (483), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 145/314 (46%), Positives = 188/314 (59%), Gaps = 4/314 (1%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           MS    FPGQGSQ +GMG DL D+F  AR VF+EVD  L Q L  LM  G +++LT T N
Sbjct: 1   MSLAFIFPGQGSQAVGMGADLADAFGAAREVFQEVDEALGQKLFALMREGPEDQLTLTEN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
           AQPAL AVS+A +RV+E+         ++VAGHSLGEY+AL AA A SLSDT RL++ RG
Sbjct: 61  AQPALMAVSVAVMRVLEREFGVGVERAAFVAGHSLGEYSALAAAGAISLSDTARLLKLRG 120

Query: 121 KSMQEAVPPGL--GSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAV 178
           ++MQ AVP G    + +     D  + +      S  G+C +ANDN  G VVISG + AV
Sbjct: 121 QAMQRAVPVGQGAMASLIGPKTDLALAEEAAKAGSEAGVCVVANDNNQGNVVISGAKAAV 180

Query: 179 KCAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASP 238
             A +     GA+    L VSAPFH  LM P +  M   L + T   P  P++ N  A P
Sbjct: 181 DRAIEKAKELGARAI-PLNVSAPFHCPLMQPAADEMAQALTAATIVTPKAPVVANVTARP 239

Query: 239 VSSIDEISRLLVEQVTGRVRWRETIQWFANH-GVKSVYEVGSGKVLTGLAKRIDKSLSAV 297
            +  + I RLLVEQVTGRVRWRE++QW A   GV    E G+GKVL+G+ KRI     AV
Sbjct: 240 TNDPEAIRRLLVEQVTGRVRWRESVQWMAGEGGVTRFAEAGAGKVLSGMVKRIAPDAEAV 299

Query: 298 SISKVEDIDLALRS 311
            ++   D++   ++
Sbjct: 300 PLNAPADLEAFAKT 313


>gi|229086405|ref|ZP_04218581.1| Malonyl CoA-acyl carrier protein transacylase [Bacillus cereus
           Rock3-44]
 gi|228696921|gb|EEL49730.1| Malonyl CoA-acyl carrier protein transacylase [Bacillus cereus
           Rock3-44]
          Length = 316

 Score =  190 bits (483), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 121/314 (38%), Positives = 180/314 (57%), Gaps = 5/314 (1%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
                FPGQGSQ +GMGR L +++ E   VF++ D  L ++LS+L++ G QE+LT T NA
Sbjct: 3   KLAFLFPGQGSQAVGMGRQLAENYTEVASVFQKADEVLQESLSNLIFEGPQEKLTLTTNA 62

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPAL   S A +  +++  +       YVAGHSLGEY+AL AA A +  D +  VR RG+
Sbjct: 63  QPALLTTSFAILTALKEYDIT----PDYVAGHSLGEYSALVAAGALTFEDAVYAVRKRGE 118

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQASR-VGICEIANDNGGGQVVISGLQDAVKC 180
            M+EAVP G G+M AI+G D  ++  +  + +      ++AN N   Q+VISG +  V+ 
Sbjct: 119 YMEEAVPSGEGAMAAILGADPDILKQVTEEVTNEGYPVQVANMNSTKQIVISGTKQGVEL 178

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A+      GAKRA+ L VS PFHSSLM P ++  + +L  +  QD  +P++ N  A  ++
Sbjct: 179 ASQKAKENGAKRAIPLRVSGPFHSSLMKPAAEKFQGVLSEIAIQDAKIPVIANVTADCIT 238

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
              +I   L+EQ+   V W  +I+     GV +  E+G GKVL GL K I  S+   +I 
Sbjct: 239 RSTDIQEKLIEQLYSPVLWYPSIERMVEQGVDTFIEIGPGKVLAGLMKSIAPSVKVYAIY 298

Query: 301 KVEDIDLALRSIVG 314
             E +   + ++ G
Sbjct: 299 DEETLKDTISNLRG 312


>gi|157370147|ref|YP_001478136.1| malonyl CoA-acyl carrier protein transacylase [Serratia
           proteamaculans 568]
 gi|157321911|gb|ABV41008.1| malonyl CoA-acyl carrier protein transacylase [Serratia
           proteamaculans 568]
          Length = 309

 Score =  190 bits (483), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 128/312 (41%), Positives = 172/312 (55%), Gaps = 4/312 (1%)

Query: 1   MS-TVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATC 59
           M+     FPGQGSQ +GM  DL   +P     F E    L  +L  L+  G  EEL  T 
Sbjct: 1   MTQFAFVFPGQGSQTLGMLADLATQYPIVEATFSEASSVLGYDLWQLVQQGPAEELNKTW 60

Query: 60  NAQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRAR 119
             QPAL A S+A  RV ++ G       + +AGHSLGEY+AL  A        IRLV  R
Sbjct: 61  QTQPALLAASVAIFRVWQQQGGKA---PAIMAGHSLGEYSALVCAGVLDFQAAIRLVELR 117

Query: 120 GKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVK 179
           GK MQEAVP G G+M AIIGLD+  +   C ++++  +    N N  GQVVI+G ++AV+
Sbjct: 118 GKLMQEAVPEGTGAMSAIIGLDNAAIAKACEESAQGQVVSPVNFNSPGQVVIAGNKEAVE 177

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            A   C   GAKRA+ LPVS P H +LM P +  +   L  +T   P VP++ N   S  
Sbjct: 178 RAGAACKAAGAKRALPLPVSVPSHCALMKPAADKLAVALQEITFNAPQVPVVNNVDVSTE 237

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
           +  + I   LV Q+   VRW E++++ A  GV  + EVG GKVLTGL KRI  +L+A ++
Sbjct: 238 TDPEAIRSALVRQLYSPVRWTESVEFMAAQGVTLLLEVGPGKVLTGLTKRIVDTLTAAAV 297

Query: 300 SKVEDIDLALRS 311
           +    +  AL  
Sbjct: 298 NDAASLTAALEQ 309


>gi|304392017|ref|ZP_07373959.1| malonyl CoA-acyl carrier protein transacylase [Ahrensia sp. R2A130]
 gi|303296246|gb|EFL90604.1| malonyl CoA-acyl carrier protein transacylase [Ahrensia sp. R2A130]
          Length = 312

 Score =  190 bits (483), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 162/310 (52%), Positives = 215/310 (69%), Gaps = 2/310 (0%)

Query: 4   VLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQP 63
            LTFPGQGSQ +GMGR + D++PEA+ VF+EVD  L + LS ++++G  + LT T NAQP
Sbjct: 3   ALTFPGQGSQAVGMGRAIADAYPEAKAVFDEVDDALGEKLSAVIFDGPDDALTLTTNAQP 62

Query: 64  ALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSM 123
           AL AVS+A +R ME  G  V     YVAGHSLGEY+AL AA+A ++ DT RL+R RG++M
Sbjct: 63  ALMAVSLAVLRAMESEGFMVT-RADYVAGHSLGEYSALAAARAITIGDTARLLRIRGEAM 121

Query: 124 QEAVPPGLGSMVAIIGLD-DCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAA 182
           Q AVP G G+M AIIGL+ D V  +    +      +IANDNGGGQ+VISG   AV+ A 
Sbjct: 122 QAAVPVGKGAMAAIIGLEQDAVETACTNASQPDDEVQIANDNGGGQLVISGHAGAVERAM 181

Query: 183 DTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSI 242
           + C   GAKRA+ LPVSAPFHS+LM P +  MK  L +V  +  +VP++ N  A P+S  
Sbjct: 182 EACKEAGAKRALPLPVSAPFHSTLMAPAADRMKDALAAVDIKPTIVPLVCNVLADPISHP 241

Query: 243 DEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKV 302
           ++I + LVEQVTGRVRW E++++ A  GV  ++EVGSGKVLTGLA+RID++L   +I   
Sbjct: 242 EDIRKNLVEQVTGRVRWAESVEYMAEQGVNRIWEVGSGKVLTGLARRIDRTLEGTAIGAP 301

Query: 303 EDIDLALRSI 312
           +DI  AL  +
Sbjct: 302 DDISAALAQL 311


>gi|90413255|ref|ZP_01221250.1| acyl carrier protein S-malonyltransferase [Photobacterium profundum
           3TCK]
 gi|90325807|gb|EAS42265.1| acyl carrier protein S-malonyltransferase [Photobacterium profundum
           3TCK]
          Length = 307

 Score =  190 bits (483), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 122/307 (39%), Positives = 178/307 (57%), Gaps = 3/307 (0%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
              + FPGQGSQ +GM  +L + F   +  F E    L  +L  L+ NG  E+L  T   
Sbjct: 3   KFAIVFPGQGSQAVGMLAELAEKFDVVKYTFAEASEVLGYDLWALVQNGPAEDLNQTDRT 62

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPAL A S+A  RV ++ G       + +AGHSLGEY+AL  A      + I+LV  RG+
Sbjct: 63  QPALLAASVAIWRVWQEQG---GEQPAVLAGHSLGEYSALVCAGVIDFKEAIKLVELRGQ 119

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCA 181
            MQEAVP G+G+M AIIGLD+  +   C +A++  I    N N  GQVVI+G ++AV+ A
Sbjct: 120 LMQEAVPAGVGAMSAIIGLDNDSIAKACEEAAQDQIVSPVNFNSPGQVVIAGNKEAVERA 179

Query: 182 ADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSS 241
              C   GAKRA+ LPVS P H +LM P +  +   L+++    P +P++ N      S 
Sbjct: 180 NVLCKEAGAKRALPLPVSVPSHCALMKPAADKLAVALEAIEFNTPSIPVINNADVQTESD 239

Query: 242 IDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISK 301
              I   LV+Q+ G VRW E+++  AN G++ + E+G GKVLTGL KRI+++L++  ++ 
Sbjct: 240 PAAIKLALVKQLYGPVRWTESVERMANEGIEQLLEMGPGKVLTGLTKRINRALTSAVVND 299

Query: 302 VEDIDLA 308
              ++ A
Sbjct: 300 SASLEAA 306


>gi|229174518|ref|ZP_04302050.1| Malonyl CoA-acyl carrier protein transacylase [Bacillus cereus MM3]
 gi|228609078|gb|EEK66368.1| Malonyl CoA-acyl carrier protein transacylase [Bacillus cereus MM3]
          Length = 314

 Score =  190 bits (483), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 123/314 (39%), Positives = 181/314 (57%), Gaps = 5/314 (1%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
                FPGQGSQ +GMG+ L ++  E   VF + D  L  +LS++++ G QE+LT T NA
Sbjct: 3   KLAFLFPGQGSQAVGMGKQLAENNKEVANVFAKADEVLQDSLSEVIFEGPQEKLTLTTNA 62

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPAL   S A +  +++  +       +VAGHSLGEY+AL AA A +  D +  VR RG+
Sbjct: 63  QPALLTTSFAILTALKEYDIT----PDFVAGHSLGEYSALVAAGAITFEDAVYAVRKRGE 118

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQAS-RVGICEIANDNGGGQVVISGLQDAVKC 180
            M+EAVP G G+M AI+G D  ++  +  + +      +IAN N   Q+VISG +  V+ 
Sbjct: 119 YMEEAVPGGEGAMAAILGADPHMLKQVTEEVTSEGYAVQIANMNSTKQIVISGTKQGVEI 178

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A+      GAKRA+ L VS PFHSSLM P ++  + +L  +T QD  +P++ N  A  ++
Sbjct: 179 ASQRAKENGAKRAIPLKVSGPFHSSLMKPAAEKFQSVLKEITIQDTNIPVIANVTADVIT 238

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
           +   I   L+EQ+   V W  +I+   N GV +  E+G GKVL GL K ID S+ A +I 
Sbjct: 239 NGALIQEKLIEQLYSPVLWYPSIENMVNQGVDTFIEIGPGKVLAGLMKSIDSSVKAYAIY 298

Query: 301 KVEDIDLALRSIVG 314
             E +   + ++ G
Sbjct: 299 DEETLKDTISNLRG 312


>gi|332558112|ref|ZP_08412434.1| malonyl CoA-acyl carrier protein transacylase [Rhodobacter
           sphaeroides WS8N]
 gi|332275824|gb|EGJ21139.1| malonyl CoA-acyl carrier protein transacylase [Rhodobacter
           sphaeroides WS8N]
          Length = 310

 Score =  190 bits (483), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 157/310 (50%), Positives = 206/310 (66%), Gaps = 1/310 (0%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           MS    FPGQG+Q IGMGR L +++P AR VFEEVD  L + LS L+W+GS EELT T N
Sbjct: 1   MSRAFVFPGQGAQTIGMGRALAEAYPAARAVFEEVDEALGEKLSALIWDGSIEELTLTQN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
           AQPAL A SMA +  +E  GL +    S+VAGHSLGEY+ALCAAK+  LSDT RL+R RG
Sbjct: 61  AQPALMATSMAALAALEVEGLGI-ATASFVAGHSLGEYSALCAAKSLKLSDTARLLRIRG 119

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           ++MQEAVP G+G+M A++GLD      +  +A++  +C+ ANDN   QVV+SG + AV+ 
Sbjct: 120 QAMQEAVPVGVGAMAALLGLDYDTAVEVAHEAAQGEVCQAANDNDPAQVVVSGHKAAVER 179

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A +    +GAKRA+ LPVSAPFH +LM   + VM   L +V  + PV P++ N  A  VS
Sbjct: 180 AVEIAKGRGAKRAILLPVSAPFHCALMQHAASVMSEALAAVVIEAPVCPVVVNVRAEAVS 239

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
             D I  LLV QVTG VRWRE++ W  + GV   +E+G+GK L+G+ KRI K  +  +I 
Sbjct: 240 EPDRIRALLVAQVTGAVRWRESVMWMEDAGVDEFWEIGAGKALSGMIKRIAKGAATRAIG 299

Query: 301 KVEDIDLALR 310
             ED+  A  
Sbjct: 300 TPEDVAAAAT 309


>gi|306845086|ref|ZP_07477666.1| malonyl CoA-acyl carrier protein transacylase [Brucella sp. BO1]
 gi|306274501|gb|EFM56296.1| malonyl CoA-acyl carrier protein transacylase [Brucella sp. BO1]
          Length = 314

 Score =  190 bits (483), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 175/301 (58%), Positives = 222/301 (73%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M+   TFPGQGSQ +GMG+ L + F EAR VF+EVD  L + LS  M+ G ++ LT T N
Sbjct: 1   MAVAFTFPGQGSQAVGMGKALAEQFAEARAVFDEVDEALGEKLSATMFEGPEDVLTLTAN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
           AQPAL AVSMA  R+ME  G  +K  +SYVAGHSLGEY+ALCAA  FSL+DT RL+R RG
Sbjct: 61  AQPALMAVSMAVQRIMEARGFSLKDKVSYVAGHSLGEYSALCAAGTFSLADTARLLRIRG 120

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
            +MQ+AVP G G+M AIIGL+   V+++C +A   G  +IANDNGGGQ+VISG + AV+ 
Sbjct: 121 NAMQKAVPVGEGAMAAIIGLEHGDVEAVCMEAKASGPVQIANDNGGGQLVISGAKAAVEL 180

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           AA     KGAKRA+ LPVSAPFHS+LM P +  M+  L +V KQDPVVP++ N  A+PV+
Sbjct: 181 AAKLGSEKGAKRAIMLPVSAPFHSTLMAPAADAMREALAAVEKQDPVVPLIANVRAAPVT 240

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
              EI+ LLVEQVTG+VRWRETI+WF+ +GV ++YEVG GKVLTGLA+RI K +S  ++ 
Sbjct: 241 DASEIAALLVEQVTGQVRWRETIEWFSANGVTTLYEVGCGKVLTGLARRISKDVSGAAVG 300

Query: 301 K 301
            
Sbjct: 301 S 301


>gi|261346045|ref|ZP_05973689.1| malonyl CoA-acyl carrier protein transacylase [Providencia
           rustigianii DSM 4541]
 gi|282565932|gb|EFB71467.1| malonyl CoA-acyl carrier protein transacylase [Providencia
           rustigianii DSM 4541]
          Length = 310

 Score =  190 bits (483), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 126/313 (40%), Positives = 175/313 (55%), Gaps = 4/313 (1%)

Query: 1   MS-TVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATC 59
           M+   + FPGQGSQ +GM   L +        F E    L  +L  L+ NG +EEL  T 
Sbjct: 1   MTQFAMVFPGQGSQTLGMLAALAEQNQLIEQTFAEASDALGYDLWALVQNGPEEELNKTW 60

Query: 60  NAQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRAR 119
             QPAL A S+A  RV ++      +  + +AGHSLGEY+AL  A        I+LV  R
Sbjct: 61  QTQPALLAASVAIFRVWQEK---NGKMPAIMAGHSLGEYSALVCAGVIDFKQAIKLVELR 117

Query: 120 GKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVK 179
           GK MQEAVP G G+M AIIGLD+  ++  C +A++  +    N N  GQVVI+G + AV+
Sbjct: 118 GKLMQEAVPAGTGAMYAIIGLDNESIEKACQEAAQGQVVSPVNFNSPGQVVIAGEKAAVE 177

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            A   C   GAKRA+ L VS P H +LM P +  +   L+ +   +P  P++ N      
Sbjct: 178 RAGAACKEAGAKRALPLSVSVPSHCALMKPAADKLAEALEKIEFCEPAYPVINNVDVKIE 237

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
            S   I   LV Q+   VRW ET++  AN G++ + E+G GKVLTGL KRI  +L+AV++
Sbjct: 238 KSAQNIRDALVRQLYNPVRWTETVELMANQGIEQLVEMGPGKVLTGLTKRIVSNLTAVAV 297

Query: 300 SKVEDIDLALRSI 312
           +    +D AL +I
Sbjct: 298 NDPVSLDSALETI 310


>gi|332162107|ref|YP_004298684.1| malonyl CoA-acyl carrier protein transacylase [Yersinia
           enterocolitica subsp. palearctica 105.5R(r)]
 gi|318606156|emb|CBY27654.1| malonyl CoA-acyl carrier protein transacylase [Yersinia
           enterocolitica subsp. palearctica Y11]
 gi|325666337|gb|ADZ42981.1| malonyl CoA-acyl carrier protein transacylase [Yersinia
           enterocolitica subsp. palearctica 105.5R(r)]
 gi|330861069|emb|CBX71338.1| malonyl CoA-acyl carrier protein transacylase [Yersinia
           enterocolitica W22703]
          Length = 309

 Score =  190 bits (483), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 123/310 (39%), Positives = 170/310 (54%), Gaps = 3/310 (0%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
              + FPGQGSQ +GM  DL   FP     F E    L  +L  L+  G  EEL  T   
Sbjct: 3   KFAMVFPGQGSQSLGMLADLAAQFPIVEETFSEASSVLGYDLWQLVQQGPAEELNKTWQT 62

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPAL   S+A  RV +  G  +    + +AGHSLGEY+AL  A        +RLV  RGK
Sbjct: 63  QPALLTASVAIWRVWQHQGGKL---PTMMAGHSLGEYSALVCAGVLDFKQAVRLVELRGK 119

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCA 181
            MQEAVP G G+M AIIGLD+  +   C +++   +    N N  GQVVI+G ++AV+ A
Sbjct: 120 LMQEAVPEGTGAMYAIIGLDNESIAKACEESALGQVVSPVNFNSPGQVVIAGNKEAVERA 179

Query: 182 ADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSS 241
              C   GAKRA+ LPVS P H +LM P +  +   L+ +  Q P+ P++ N       S
Sbjct: 180 GAACKALGAKRALPLPVSVPSHCALMKPAADKLAVALEEIEFQAPLFPVVNNVDVKTEVS 239

Query: 242 IDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISK 301
            + I   LV Q+   VRW E++++ A  G++ + EVG GKVL GL KRI  +L+A +++ 
Sbjct: 240 PEAIRSALVRQLYNPVRWAESVEFMAAEGIELLLEVGPGKVLAGLTKRIVDTLAAAAVND 299

Query: 302 VEDIDLALRS 311
           V  +   L +
Sbjct: 300 VATLTSTLEN 309


>gi|73541951|ref|YP_296471.1| [Acyl-carrier-protein] S-malonyltransferase [Ralstonia eutropha
           JMP134]
 gi|72119364|gb|AAZ61627.1| [Acyl-carrier-protein] S-malonyltransferase [Ralstonia eutropha
           JMP134]
          Length = 309

 Score =  190 bits (483), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 126/313 (40%), Positives = 168/313 (53%), Gaps = 4/313 (1%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M     FPGQGSQ +GM     D+    R   EE    L Q++  L+  G  EEL  T N
Sbjct: 1   MKFAFVFPGQGSQSVGMLNAFADN-AVVRATLEEASTALGQDIGRLIAEGPAEELNLTTN 59

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
            QP +   ++A  R     G       + VAGHSLGEY+AL AA     ++ + LVR R 
Sbjct: 60  TQPVMLTAAVAVYRAWLDAGG---PAPAMVAGHSLGEYSALVAAGVIPFAEAVPLVRFRA 116

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           ++MQEAVP G G M AI+GL D  V + CA+AS  G+ E  N N   QVVI+G +  V+ 
Sbjct: 117 QAMQEAVPVGQGGMAAILGLSDDDVRAACAEASAAGVVEAVNFNAPSQVVIAGSKAGVEK 176

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A +    KGAKRA+ LPVSAPFHSSL+ P S  ++  +  +T   P +P++ N   + V+
Sbjct: 177 ACEVAKAKGAKRALPLPVSAPFHSSLLKPASDRLRERMAGLTFSAPTIPLVNNVDVAIVN 236

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
             + I   LV Q    VRW E +Q  A  GV  V E G GKVL G+ KRID SL+  ++ 
Sbjct: 237 DPEAIKDALVRQAAAPVRWVECVQKMAAEGVTHVIECGPGKVLAGMTKRIDGSLTGGAVF 296

Query: 301 KVEDIDLALRSIV 313
               +   L  + 
Sbjct: 297 DPASLQETLALLK 309


>gi|304404212|ref|ZP_07385874.1| malonyl CoA-acyl carrier protein transacylase [Paenibacillus
           curdlanolyticus YK9]
 gi|304347190|gb|EFM13022.1| malonyl CoA-acyl carrier protein transacylase [Paenibacillus
           curdlanolyticus YK9]
          Length = 311

 Score =  190 bits (483), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 127/310 (40%), Positives = 189/310 (60%), Gaps = 5/310 (1%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
            T   FPGQG+Q +GMG D + +F E+R +FE+ D  L  +LSD+++NG  + L  T N 
Sbjct: 3   KTAFVFPGQGAQAVGMGHDAFQTFEESRKIFEQADEALGFSLSDIIFNGPDDSLKQTANT 62

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPAL  VS+A +  ++  GL       YVAGHSLGEY+AL A+   S +D +R VR+RG+
Sbjct: 63  QPALLTVSVALLEALKDRGLT----PDYVAGHSLGEYSALVASGVLSFADAVRTVRSRGE 118

Query: 122 SMQEAVPPGLGSMVAIIGLD-DCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
            M++AVP G G+M A++G + + +     A  + VG  E+AN N  GQ+V+SG    V+ 
Sbjct: 119 FMEQAVPSGNGAMAAVLGAEREALAQLCKAVTAEVGAVELANVNCPGQIVVSGTAAGVQG 178

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
             +     GAKR + L VS PFHSSLM P ++ +  +L+ V+  D  +P++ N  A PVS
Sbjct: 179 VVERGKEAGAKRVIPLEVSGPFHSSLMKPAAERLAGVLEGVSFHDAAIPVIANVTAEPVS 238

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
           +   I  LLVEQV   V W +TI+   + GV +  E+GSG VL GL K++D+S++ + ++
Sbjct: 239 AASSIRELLVEQVYSPVLWEDTIRKLIDLGVTTFVEIGSGNVLAGLIKKVDRSVTIIPVN 298

Query: 301 KVEDIDLALR 310
            VE +   + 
Sbjct: 299 SVETLQAVVT 308


>gi|229134660|ref|ZP_04263469.1| Malonyl CoA-acyl carrier protein transacylase [Bacillus cereus
           BDRD-ST196]
 gi|228648706|gb|EEL04732.1| Malonyl CoA-acyl carrier protein transacylase [Bacillus cereus
           BDRD-ST196]
          Length = 314

 Score =  190 bits (483), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 123/314 (39%), Positives = 183/314 (58%), Gaps = 5/314 (1%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
                FPGQGSQ +GMGR L ++  E   VF + D  L+ +LS +++ G QE+LT T NA
Sbjct: 3   KIAFLFPGQGSQAVGMGRQLAENNKEVAKVFAKADEVLHDSLSAVIFEGPQEKLTLTTNA 62

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPAL   S A +  +++  +       +VAGHSLGEY+AL AA A +  D +  VR RG+
Sbjct: 63  QPALLTTSFAILTALKEYDIT----PDFVAGHSLGEYSALVAAGALTFEDAVYAVRKRGE 118

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQAS-RVGICEIANDNGGGQVVISGLQDAVKC 180
            M+EAVP G G+M AI+G D  ++  +  + +      +IAN N   Q+VISG +  V+ 
Sbjct: 119 YMEEAVPGGEGAMAAILGADPDMLKRVTEEVTSEGYAVQIANMNSTKQIVISGTKQGVEL 178

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A+      GAKRA+ L VS PFHSSLM P ++  + +L+ +T QD  +P++ N  A  ++
Sbjct: 179 ASQRAKENGAKRAIPLKVSGPFHSSLMKPAAEKFQSVLNEITIQDTNIPVIANVTADVIT 238

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
              +I   L+EQ+   V W  +I++  N GV +  E+G GKVL GL K ID S+ A ++ 
Sbjct: 239 RGTDIQAKLIEQLYSPVLWYPSIEYMVNQGVDTFIEIGPGKVLAGLMKSIDSSVKAYAVY 298

Query: 301 KVEDIDLALRSIVG 314
             E +   + ++ G
Sbjct: 299 DEETLKDTISNLRG 312


>gi|293402133|ref|ZP_06646272.1| malonyl CoA-acyl carrier protein transacylase [Erysipelotrichaceae
           bacterium 5_2_54FAA]
 gi|291304525|gb|EFE45775.1| malonyl CoA-acyl carrier protein transacylase [Erysipelotrichaceae
           bacterium 5_2_54FAA]
          Length = 308

 Score =  190 bits (482), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 111/316 (35%), Positives = 171/316 (54%), Gaps = 10/316 (3%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M T   F GQG+Q  GMG+DLYD++   R +F+    TL+ ++  L + G +E L  T  
Sbjct: 1   MKTAFLFSGQGAQHPGMGKDLYDNYAIVRAIFD--SSTLDFDVKQLCFEGPKETLDDTQY 58

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
           AQPA+   SMA   ++   G+    +    AG SLGEY+ALC A AFS+ D  ++V  RG
Sbjct: 59  AQPAIFLHSMACATLLRSFGV----EADVCAGLSLGEYSALCYANAFSIEDGTKIVAQRG 114

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           K M  A+P G+ SM AI+ L++  +   C +   +G+CEIAN N  GQ+VI+G + AV+ 
Sbjct: 115 KIMANALPSGISSMAAILMLEEAKILQACEEVKALGVCEIANYNCPGQIVITGHKAAVEA 174

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A+  CL  GA+R + L VS  FHSSL+   +K ++ +L     + P +P+  N    P  
Sbjct: 175 ASKRCLELGARRVIPLQVSGAFHSSLLLDAAKELRKILAQYNIKQPSIPVYHNISGKPEK 234

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDK--SLSAVS 298
           +       L +Q+   V + +TI+     GV +  EVG GK ++G  K+  K   +  + 
Sbjct: 235 TDLNTI--LSKQIAHSVYFTQTIEHMLEDGVDTFIEVGPGKAVSGFVKKCCKGHDVKILH 292

Query: 299 ISKVEDIDLALRSIVG 314
           +     +   L ++ G
Sbjct: 293 VEDEASLKECLNALKG 308


>gi|78189620|ref|YP_379958.1| malonyl CoA-acyl carrier protein transacylase [Chlorobium
           chlorochromatii CaD3]
 gi|78171819|gb|ABB28915.1| [Acyl-carrier-protein] S-malonyltransferase [Chlorobium
           chlorochromatii CaD3]
          Length = 303

 Score =  190 bits (482), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 129/309 (41%), Positives = 176/309 (56%), Gaps = 7/309 (2%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M     FPGQGSQ  GMGRDL++SFPEAR + E+ +  L  +++D+M+ GS+EEL  T  
Sbjct: 1   MK-AFVFPGQGSQYCGMGRDLFESFPEARALMEQANEILGYSITDIMFTGSEEELRQTKF 59

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
            QPA+   SM    ++  NG+         AGHSLGEY+ALC A A S  D +R+V  RG
Sbjct: 60  TQPAIFLHSMVLATLLGNNGVS------MCAGHSLGEYSALCFAGAMSFEDALRIVAKRG 113

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
             MQEA     G+M AIIG+ D  ++ + A+A   GI + AN N  GQ+VISG   AVK 
Sbjct: 114 NLMQEAGTQNPGTMAAIIGMADEALEGLLAEAQSDGIVQAANFNSPGQIVISGDVAAVKK 173

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A     +KGA+ A  L VS  FHS LM P  + +   L  V  ++  +P+  N  A  V+
Sbjct: 174 AVALAPSKGARMAKELVVSGAFHSPLMKPAEEELAAALAQVEIKEARIPVCMNAVAKAVT 233

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
           S  EI   LV Q+T  V W ++I+  A  GV +  EVG  KVL GL KRI K+++  ++ 
Sbjct: 234 SAAEIRCNLVLQLTSSVLWTQSIEAMAQAGVTTFVEVGPQKVLQGLIKRIVKNVTIQTVD 293

Query: 301 KVEDIDLAL 309
              ++   L
Sbjct: 294 TAAELQGML 302


>gi|229192021|ref|ZP_04318991.1| Malonyl CoA-acyl carrier protein transacylase [Bacillus cereus ATCC
           10876]
 gi|228591572|gb|EEK49421.1| Malonyl CoA-acyl carrier protein transacylase [Bacillus cereus ATCC
           10876]
          Length = 314

 Score =  190 bits (482), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 121/314 (38%), Positives = 181/314 (57%), Gaps = 5/314 (1%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
                FPGQGSQ +GMG+ L ++  E   VF + D  L  +LS++++ G QE+LT T NA
Sbjct: 3   KIAFLFPGQGSQAVGMGKQLAENNKEVAKVFVKADELLQDSLSEVIFEGPQEKLTLTTNA 62

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPAL   S A +  +++  +       +VAGHSLGEY+AL AA A +  D +  VR RG+
Sbjct: 63  QPALLTTSFAILTALKEYDIT----PDFVAGHSLGEYSALVAAGALTFEDAVYAVRKRGE 118

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQAS-RVGICEIANDNGGGQVVISGLQDAVKC 180
            M+EAVP G G+M AI+G D  ++  +  + +      +IAN N   Q+VISG +  V+ 
Sbjct: 119 YMEEAVPGGEGAMAAILGADPHMLKQVTEEVTSEGYAVQIANMNSTKQIVISGTKQGVEV 178

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A+      GAKRA+ L VS PFHSSLM P ++  + +L+ +T  D  +P++ N  A  ++
Sbjct: 179 ASQRAKENGAKRAIPLKVSGPFHSSLMKPAAEKFQSVLNEITIHDTNIPVIANVTAEVIT 238

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
              +I   L+EQ+   V W  +I++    GV +  E+G GKVL GL K ID S+ A +I 
Sbjct: 239 RGADIQEKLIEQLYSPVLWYPSIEYMVKQGVDTFIEIGPGKVLAGLMKSIDSSVKAYAIY 298

Query: 301 KVEDIDLALRSIVG 314
             E +   + ++ G
Sbjct: 299 DEETLKDTISNLRG 312


>gi|300023229|ref|YP_003755840.1| malonyl CoA-acyl carrier protein transacylase [Hyphomicrobium
           denitrificans ATCC 51888]
 gi|299525050|gb|ADJ23519.1| malonyl CoA-acyl carrier protein transacylase [Hyphomicrobium
           denitrificans ATCC 51888]
          Length = 315

 Score =  190 bits (482), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 151/301 (50%), Positives = 205/301 (68%), Gaps = 1/301 (0%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M+    FPGQGSQ +GMG+ L ++FP A+ VF+EVD  L Q LS ++W G +E LT T N
Sbjct: 1   MARAFVFPGQGSQDVGMGKALAEAFPSAKAVFDEVDDALGQKLSAIIWEGPKETLTLTEN 60

Query: 61  AQPALTAVSMAFIRVME-KNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRAR 119
           AQPAL AVSMA +RV+E + G  +   + +VAGHSLGEY+AL AA AFSL+D  RL++ R
Sbjct: 61  AQPALMAVSMAVMRVLEKEKGFSLADKVKFVAGHSLGEYSALAAAGAFSLADAARLLKLR 120

Query: 120 GKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVK 179
           G++MQ+AVP G+G+M A++G+     + + A+A++  +C++ANDN   Q+V+SG + A+ 
Sbjct: 121 GQAMQKAVPVGVGAMAALLGVGAEAAEKVAAEAAQGDVCQVANDNDPTQIVLSGHKTAID 180

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
             A+     G +RAV LPVSAPFH +LM P +  M   L +VT   PVVP++ N  A+P+
Sbjct: 181 RVAEIGKKYGVRRAVPLPVSAPFHCALMQPAADAMAEALATVTVNKPVVPVVANVLAAPI 240

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
           S  DEI + LVEQVTG VRWRE +   A  GV   YE+G+GKVL GL KR   S SAVS+
Sbjct: 241 SDPDEIRKRLVEQVTGTVRWRECVAAMAADGVTEFYEIGAGKVLAGLVKRTAASASAVSL 300

Query: 300 S 300
            
Sbjct: 301 G 301


>gi|182679256|ref|YP_001833402.1| malonyl CoA-acyl carrier protein transacylase [Beijerinckia indica
           subsp. indica ATCC 9039]
 gi|182635139|gb|ACB95913.1| malonyl CoA-acyl carrier protein transacylase [Beijerinckia indica
           subsp. indica ATCC 9039]
          Length = 324

 Score =  190 bits (482), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 159/316 (50%), Positives = 208/316 (65%), Gaps = 6/316 (1%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           MS    FPGQGSQ +GMG+ LY+SF  AR VF+EVD  L + LS L++ G + +LT T N
Sbjct: 5   MSKAFVFPGQGSQAVGMGKALYESFAPARAVFDEVDEALGERLSTLIFEGPEADLTLTAN 64

Query: 61  AQPALTAVSMAFIRVME-KNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRAR 119
           AQPAL AVS+A +RV+E +  L + RD +YVAGHSLGEY+AL AA + +L+ T RL+R R
Sbjct: 65  AQPALMAVSLAVVRVLEAEADLDLARDATYVAGHSLGEYSALAAAGSLTLATTARLLRQR 124

Query: 120 GKSMQEAVPPGLGSMVAIIGLDDCV----VDSICAQASRVGICEIANDNGGGQVVISGLQ 175
           G +MQ AVP G+G+M A++GLD            A+     +C IANDNGGGQVV SG +
Sbjct: 125 GAAMQSAVPVGVGAMAALLGLDYETGLAVTKQAEAETGENAVCAIANDNGGGQVVASGSK 184

Query: 176 DAVKCAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFC 235
            AV  A +    KGAKR++ LPVSAPFH  LM P + VM   L  V+ + P VP++ N  
Sbjct: 185 AAVMRAMEIAKEKGAKRSMLLPVSAPFHCPLMAPAAAVMAEALAEVSIRPPCVPLVANVI 244

Query: 236 ASPVSSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLS 295
           A+PV+  ++I  LLV QVTG VRWRE++ + A  GV    E GSGKVLTGL KRI     
Sbjct: 245 AAPVTDPEKIRSLLVSQVTGTVRWRESVAFMAAEGVDLFIECGSGKVLTGLLKRIAPQAR 304

Query: 296 AVSISKVEDIDLALRS 311
            ++I +  D++ ALR+
Sbjct: 305 GLTIGQPADLE-ALRA 319


>gi|295111287|emb|CBL28037.1| [Acyl-carrier-protein] S-malonyltransferase [Synergistetes
           bacterium SGP1]
          Length = 315

 Score =  190 bits (482), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 137/312 (43%), Positives = 195/312 (62%), Gaps = 1/312 (0%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M   L FPGQG+Q +GMG++LY +FP A+ VF+E D  L+ +L+ L++ G + ELT T N
Sbjct: 1   MKYALCFPGQGAQQVGMGQELYRAFPSAKAVFDEADDALSAHLTKLIFEGPEGELTLTAN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
           AQPA+  VS+A + V+EK  + V    +  AGHSLGEYTAL AA   S SD +RLV  RG
Sbjct: 61  AQPAIMTVSVAALSVLEKE-MGVALKPACGAGHSLGEYTALVAAGVLSFSDAVRLVNKRG 119

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           + MQEA P G+G+M AI+GL    V ++CA+A+  G C+ AN N  GQVVISG+++ V+ 
Sbjct: 120 RWMQEAAPEGVGAMAAILGLGSDEVKALCAEAAPGGECQAANFNSPGQVVISGVKEFVEK 179

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           AA     KGA++ V L VSAPFHS LM P ++ +K   +  +  +P  PI+ N  AS V 
Sbjct: 180 AAAAAKAKGARKTVMLNVSAPFHSRLMLPAAEKLKEEFERCSWAEPKWPIVANVSASAVV 239

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
           S +EI   L EQ    V W  ++ +  ++GV +  E+G G+VL GL KR  K L  ++  
Sbjct: 240 SAEEIRDALYEQTFSPVLWESSVLYMVDYGVDTFLELGPGEVLCGLIKRCRKGLKQMAAG 299

Query: 301 KVEDIDLALRSI 312
           + E ++    ++
Sbjct: 300 EPEALEAMATAL 311


>gi|324327749|gb|ADY23009.1| malonyl CoA-acyl carrier protein transacylase [Bacillus
           thuringiensis serovar finitimus YBT-020]
          Length = 314

 Score =  190 bits (482), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 122/314 (38%), Positives = 183/314 (58%), Gaps = 5/314 (1%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
                FPGQGSQ +GMG+ L ++  E   VF + D  L  +LS++++ G QE+LT T NA
Sbjct: 3   KLAFLFPGQGSQAVGMGKQLAENNKEVANVFAKADEVLQDSLSEVIFEGPQEKLTLTTNA 62

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPAL   S A +  +++  +       +VAGHSLGEY+AL AA A +  D +  VR RG+
Sbjct: 63  QPALLTTSFAILTALKEYDIT----PDFVAGHSLGEYSALVAAGALTFEDAVYAVRKRGE 118

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQAS-RVGICEIANDNGGGQVVISGLQDAVKC 180
            M+EAVP G G+M AI+G D  ++  +  + +      +IAN N   Q+VISG +  V+ 
Sbjct: 119 YMEEAVPGGEGAMAAILGADPHMLKQVTEEVTSEGYAVQIANMNSTKQIVISGTKQGVEI 178

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A+      GAKRA+ L VS PFHS+LM P ++  + +L+ +T QD  +P++ N  A  ++
Sbjct: 179 ASQRAKENGAKRAILLKVSGPFHSALMKPAAEKFQSVLNEITIQDTNIPVIANVTADVIT 238

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
           S   I   L+EQ+   V W  +I++  + GV +  E+G GKVL GL K ID S+ A +I 
Sbjct: 239 SGAHIQEKLIEQLYSPVLWYPSIEYMVSQGVDTFIEIGPGKVLAGLMKSIDSSVKAYAIY 298

Query: 301 KVEDIDLALRSIVG 314
             E +   + ++ G
Sbjct: 299 DEETLQDTISNLRG 312


>gi|123441940|ref|YP_001005923.1| malonyl CoA-acyl carrier protein transacylase [Yersinia
           enterocolitica subsp. enterocolitica 8081]
 gi|122088901|emb|CAL11708.1| malonyl CoA-acyl carrier protein transacylase [Yersinia
           enterocolitica subsp. enterocolitica 8081]
          Length = 309

 Score =  190 bits (482), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 124/310 (40%), Positives = 171/310 (55%), Gaps = 3/310 (0%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
              + FPGQG+Q +GM  DL   FP     F E    L  +L  L+  G  EEL  T   
Sbjct: 3   KFAMVFPGQGAQSLGMLADLAAQFPIVEETFSEASSVLGYDLWQLVQQGPAEELNKTWQT 62

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPAL   S+A  RV +  G  +    + +AGHSLGEY+AL  A        +RLV  RGK
Sbjct: 63  QPALLTASVAIWRVWQHQGGNL---PAMMAGHSLGEYSALVCAGVLDFKQAVRLVELRGK 119

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCA 181
            MQEAVP G G+M AIIGLD+  +   C +++   +    N N  GQVVI+G ++AV+ A
Sbjct: 120 LMQEAVPEGTGAMYAIIGLDNESIAKACEESALGQVVSPVNFNSPGQVVIAGNKEAVERA 179

Query: 182 ADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSS 241
              C   GAKRA+ LPVS P H +LM P +  +   L+ +  Q P+ P++ N       S
Sbjct: 180 GAACKALGAKRALPLPVSVPSHCALMKPAADKLAVALEEIEFQAPLFPVVNNVDVKTEVS 239

Query: 242 IDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISK 301
            + I   LV Q+   VRW E++++ A  G++ + EVG GKVLTGL KRI  +L+A  ++ 
Sbjct: 240 PEAIRSALVRQLYNPVRWTESVEFMAAEGIELLLEVGPGKVLTGLTKRIVDTLAAAPVND 299

Query: 302 VEDIDLALRS 311
           V  +  AL +
Sbjct: 300 VATLTSALEN 309


>gi|197119478|ref|YP_002139905.1| malonyl-CoA--acyl carrier protein transacylase [Geobacter
           bemidjiensis Bem]
 gi|197088838|gb|ACH40109.1| malonyl-CoA--acyl carrier protein transacylase [Geobacter
           bemidjiensis Bem]
          Length = 311

 Score =  190 bits (482), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 125/307 (40%), Positives = 180/307 (58%), Gaps = 3/307 (0%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
           S    FPGQGSQ  GMG++L ++F  AR+ FEE D  L  +LS L + G +++L  T N 
Sbjct: 3   SFAFIFPGQGSQHAGMGKELAENFKSARISFEEADDALGFSLSRLCFEGPEDDLKLTANT 62

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPA+ A S+A +RV+ +         S++AGHSLGEY+AL A+ A   +D +R VRARG 
Sbjct: 63  QPAILAASVAALRVLRE---ETPLTPSFLAGHSLGEYSALVASGALDFADALRTVRARGS 119

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCA 181
            MQ+AVP G+G+M AI+G +   +  ICA+A++  +   AN N  GQ+V++G   AV  A
Sbjct: 120 FMQDAVPVGVGAMAAILGAEAEQLAEICAEAAQGEVVSPANFNSPGQIVVAGHTAAVNRA 179

Query: 182 ADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSS 241
            +    KG ++A+ LPVSAPFH +LM   ++ +   L SV       P++ N  A P S 
Sbjct: 180 IEIAKAKGFRKAMLLPVSAPFHCALMQKAAERLAETLQSVQVNPLATPVVTNVEAKPNSD 239

Query: 242 IDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISK 301
              +  LLVEQV   V W + +Q     GV +  E+G GKVL GL KRI+K  ++ ++  
Sbjct: 240 PARVKPLLVEQVCAPVLWDQIVQQIVAAGVTNFVEIGPGKVLAGLVKRINKETASFNVQD 299

Query: 302 VEDIDLA 308
           V  +   
Sbjct: 300 VAGVKAL 306


>gi|301154891|emb|CBW14354.1| malonyl-CoA-[acyl-carrier-protein] transacylase [Haemophilus
           parainfluenzae T3T1]
          Length = 312

 Score =  190 bits (482), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 126/312 (40%), Positives = 177/312 (56%), Gaps = 3/312 (0%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
              + FPGQGSQ +GM  DL + +P     F++    L  +L +L+  G  EEL  T   
Sbjct: 3   KFAMVFPGQGSQAVGMLADLANEYPVVTETFKQASEALGYDLWNLVQQGPAEELNKTWQT 62

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPAL A S+A  RV ++     +   S +AGHSLGEY+AL  A      D I+LV  RGK
Sbjct: 63  QPALLAASVAIFRVWQE--KYPQLQPSVMAGHSLGEYSALVCAGVIDFKDAIKLVELRGK 120

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCA 181
            MQ+AVP G G+M AIIGLD+  + + C QA +  +    N N  GQVVI+G ++AV+ A
Sbjct: 121 LMQQAVPEGTGAMYAIIGLDNEAIINACKQAEQGEVVSAVNFNSPGQVVIAGAKEAVERA 180

Query: 182 ADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSS 241
           A  C   GAKRA+ L VS P H +LM P ++ +   L+ +T   P  P+L N      + 
Sbjct: 181 ATLCKEAGAKRALPLAVSVPSHCALMKPAAEQLAVTLEGITLNAPATPVLNNVDVKAETE 240

Query: 242 IDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISK 301
             EI   L+ Q+   VRW ET++  A  GV+ + E+G GKVL GL KRI   L A S++ 
Sbjct: 241 SAEIRTALIRQLYSPVRWTETVEKMAQDGVEVLVEIGPGKVLNGLTKRIVAELQATSVND 300

Query: 302 VEDIDLALRSIV 313
           V  ++ A+ +++
Sbjct: 301 VASLN-AVEALL 311


>gi|295689691|ref|YP_003593384.1| malonyl CoA-acyl carrier protein transacylase [Caulobacter segnis
           ATCC 21756]
 gi|295431594|gb|ADG10766.1| malonyl CoA-acyl carrier protein transacylase [Caulobacter segnis
           ATCC 21756]
          Length = 314

 Score =  190 bits (482), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 146/315 (46%), Positives = 185/315 (58%), Gaps = 4/315 (1%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           MS    FPGQGSQ +GMG DL ++F  AR VF+EVD  L Q L  LM  G + +LT T N
Sbjct: 1   MSIAFIFPGQGSQSVGMGVDLAEAFASAREVFQEVDDALGQKLFALMKEGPEGDLTLTEN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
           AQPAL AVS+A  R +EK         ++VAGHSLGEY+AL AA A SLSDT RL++ RG
Sbjct: 61  AQPALMAVSLAVTRTLEKEFGVGIDKAAFVAGHSLGEYSALAAAGAISLSDTARLLKLRG 120

Query: 121 KSMQEAVPPGL--GSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAV 178
           ++MQ AVP G    + +     D  + +      S VG+C +ANDN  G VVISG + AV
Sbjct: 121 QAMQRAVPVGEGAMASLIGPKTDLALAEEAAKAGSEVGVCVVANDNNNGNVVISGAKAAV 180

Query: 179 KCAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASP 238
             A +     GA+    L VSAPFH  LM P +  M   L   T   P  P++ N  A+P
Sbjct: 181 DKAIEKAKELGARAI-PLNVSAPFHCPLMQPAADEMAEALAKTTILAPRAPLVANVTAAP 239

Query: 239 VSSIDEISRLLVEQVTGRVRWRETIQWFANH-GVKSVYEVGSGKVLTGLAKRIDKSLSAV 297
           V   D I +LLVEQVTGRVRWRE++ W A   GV    E G+GKVL+G+AKRI     A 
Sbjct: 240 VHDPDVIRKLLVEQVTGRVRWRESMTWLATQGGVTRFAEAGAGKVLSGMAKRIAPDAEAT 299

Query: 298 SISKVEDIDLALRSI 312
            ++   D++    S+
Sbjct: 300 PLNTPADLEAFAASL 314


>gi|30263855|ref|NP_846232.1| acyl-carrier-protein S-malonyltransferase [Bacillus anthracis str.
           Ames]
 gi|47529281|ref|YP_020630.1| acyl-carrier-protein S-malonyltransferase [Bacillus anthracis str.
           'Ames Ancestor']
 gi|49186702|ref|YP_029954.1| acyl-carrier-protein S-malonyltransferase [Bacillus anthracis str.
           Sterne]
 gi|65321180|ref|ZP_00394139.1| COG0331: (acyl-carrier-protein) S-malonyltransferase [Bacillus
           anthracis str. A2012]
 gi|165873289|ref|ZP_02217897.1| malonyl CoA-acyl carrier protein transacylase [Bacillus anthracis
           str. A0488]
 gi|167642022|ref|ZP_02400253.1| malonyl CoA-acyl carrier protein transacylase [Bacillus anthracis
           str. A0193]
 gi|170709346|ref|ZP_02899761.1| malonyl CoA-acyl carrier protein transacylase [Bacillus anthracis
           str. A0389]
 gi|177655961|ref|ZP_02937113.1| malonyl CoA-acyl carrier protein transacylase [Bacillus anthracis
           str. A0174]
 gi|190566053|ref|ZP_03018972.1| malonyl CoA-acyl carrier protein transacylase [Bacillus anthracis
           Tsiankovskii-I]
 gi|227813240|ref|YP_002813249.1| malonyl CoA-acyl carrier protein transacylase [Bacillus anthracis
           str. CDC 684]
 gi|229601809|ref|YP_002868089.1| malonyl CoA-acyl carrier protein transacylase [Bacillus anthracis
           str. A0248]
 gi|254735890|ref|ZP_05193596.1| malonyl CoA-acyl carrier protein transacylase [Bacillus anthracis
           str. Western North America USA6153]
 gi|254751169|ref|ZP_05203208.1| malonyl CoA-acyl carrier protein transacylase [Bacillus anthracis
           str. Vollum]
 gi|254756717|ref|ZP_05208746.1| malonyl CoA-acyl carrier protein transacylase [Bacillus anthracis
           str. Australia 94]
 gi|30258499|gb|AAP27718.1| malonyl CoA-acyl carrier protein transacylase [Bacillus anthracis
           str. Ames]
 gi|47504429|gb|AAT33105.1| malonyl CoA-acyl carrier protein transacylase [Bacillus anthracis
           str. 'Ames Ancestor']
 gi|49180629|gb|AAT56005.1| malonyl CoA-acyl carrier protein transacylase [Bacillus anthracis
           str. Sterne]
 gi|164710974|gb|EDR16543.1| malonyl CoA-acyl carrier protein transacylase [Bacillus anthracis
           str. A0488]
 gi|167510021|gb|EDR85436.1| malonyl CoA-acyl carrier protein transacylase [Bacillus anthracis
           str. A0193]
 gi|170125741|gb|EDS94653.1| malonyl CoA-acyl carrier protein transacylase [Bacillus anthracis
           str. A0389]
 gi|172079905|gb|EDT65012.1| malonyl CoA-acyl carrier protein transacylase [Bacillus anthracis
           str. A0174]
 gi|190562972|gb|EDV16938.1| malonyl CoA-acyl carrier protein transacylase [Bacillus anthracis
           Tsiankovskii-I]
 gi|227007316|gb|ACP17059.1| malonyl CoA-acyl carrier protein transacylase [Bacillus anthracis
           str. CDC 684]
 gi|229266217|gb|ACQ47854.1| malonyl CoA-acyl carrier protein transacylase [Bacillus anthracis
           str. A0248]
          Length = 314

 Score =  190 bits (482), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 124/314 (39%), Positives = 184/314 (58%), Gaps = 5/314 (1%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
                FPGQGSQ +GMG+ L ++  E   VF + D  L  +LS++++ GSQE+LT T NA
Sbjct: 3   KLAFLFPGQGSQAVGMGKQLAENNKEVANVFAKADEVLQDSLSEVIFEGSQEKLTLTTNA 62

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPAL   S A +  +++  +       +VAGHSLGEY+AL AA A +  D +  VR RG+
Sbjct: 63  QPALLTTSFAILTALKEYDIT----PDFVAGHSLGEYSALVAAGALTFEDAVYAVRKRGE 118

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQAS-RVGICEIANDNGGGQVVISGLQDAVKC 180
            M+EAVP G G+M AI+G D  ++  +  + +      +IAN N   Q+VISG +  V+ 
Sbjct: 119 YMEEAVPGGEGAMAAILGADPHMLKRVTEEVTGEGYAVQIANMNSTKQIVISGTKQGVEI 178

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A+      GAKRA+ L VS PFHS+LM P ++  + +L+ +T QD  +P++ N  A  ++
Sbjct: 179 ASQRAKENGAKRAIPLKVSGPFHSALMKPAAEKFQSVLNEITIQDTNIPVIANVTADVIT 238

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
           S   I   L+EQ+   V W  +I++  N GV +  E+G GKVL GL K ID S+ A +I 
Sbjct: 239 SGAHIQEKLIEQLYSPVLWYPSIEYMVNQGVDTFIEIGPGKVLAGLMKSIDSSVKAYAIY 298

Query: 301 KVEDIDLALRSIVG 314
             E +   + ++ G
Sbjct: 299 DEETLKDTISNLRG 312


>gi|167646479|ref|YP_001684142.1| malonyl CoA-acyl carrier protein transacylase [Caulobacter sp. K31]
 gi|167348909|gb|ABZ71644.1| malonyl CoA-acyl carrier protein transacylase [Caulobacter sp. K31]
          Length = 314

 Score =  190 bits (482), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 147/315 (46%), Positives = 190/315 (60%), Gaps = 4/315 (1%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           MS    FPGQGSQ +GMG DL  +F  AR VF+EVD  L Q L  LM  G + +LT T N
Sbjct: 1   MSIAFIFPGQGSQTVGMGADLAQAFATAREVFQEVDDALGQKLFKLMVEGPEGDLTLTEN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
           AQPAL AVS+A  RV+E+         ++VAGHSLGEY+AL AA + +L+DT RL++ RG
Sbjct: 61  AQPALMAVSLAVSRVLEREFGVGIDRAAFVAGHSLGEYSALAAAGSITLADTARLLKLRG 120

Query: 121 KSMQEAVPPGL--GSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAV 178
           ++MQ AVP G    + +     D  + ++  A  S VG+C +ANDN  G VVISG + AV
Sbjct: 121 QAMQRAVPVGEGAMASLIGPKTDLALAEAAAAAGSEVGVCVVANDNNNGNVVISGTKAAV 180

Query: 179 KCAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASP 238
             A +     GA+    L VSAPFH  LM P +  M+  L   T   P  P++ N  ASP
Sbjct: 181 DKAIEKAKELGARAI-PLNVSAPFHCPLMRPAADEMEEALARTTIIAPRAPLVANVTASP 239

Query: 239 VSSIDEISRLLVEQVTGRVRWRETIQWFANH-GVKSVYEVGSGKVLTGLAKRIDKSLSAV 297
           V   D I RLLVEQVTGRVRWRE++ W A   GV    E G+GKVL+G+AKRI     AV
Sbjct: 240 VHEPDVIRRLLVEQVTGRVRWRESMTWLAGEGGVTRFAEAGAGKVLSGMAKRIAPDAEAV 299

Query: 298 SISKVEDIDLALRSI 312
            ++   D++   +S+
Sbjct: 300 PLNSPADLEAFAKSL 314


>gi|91977451|ref|YP_570110.1| malonyl CoA-acyl carrier protein transacylase [Rhodopseudomonas
           palustris BisB5]
 gi|91683907|gb|ABE40209.1| [Acyl-carrier-protein] S-malonyltransferase [Rhodopseudomonas
           palustris BisB5]
          Length = 317

 Score =  190 bits (482), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 153/307 (49%), Positives = 213/307 (69%), Gaps = 1/307 (0%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M+   TFPGQGSQ +GMG+ L D+FP A+ VF+EVD  L + L+ ++W G  E L  T N
Sbjct: 1   MTAAFTFPGQGSQAVGMGKALADAFPAAKAVFDEVDAALGEKLTAIIWEGPAETLQLTEN 60

Query: 61  AQPALTAVSMAFIRVMEKN-GLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRAR 119
           AQPAL AVS+A +RV+E   G+ + RD ++VAGHSLGEY+AL AA + +LSDT RL+R R
Sbjct: 61  AQPALMAVSLAALRVLESEAGVVIGRDAAFVAGHSLGEYSALAAAGSLTLSDTARLLRIR 120

Query: 120 GKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVK 179
           G++MQ+AVP G+G+M A++GLD     ++ ++A++  +C+ ANDNGGGQVV+SG ++AV+
Sbjct: 121 GRAMQKAVPVGVGAMAALLGLDYDAAVAVASEAAQGQVCQAANDNGGGQVVVSGHKEAVE 180

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            A +    KGAKRA+ LPVSAPFH +LM P ++ M   L  V  + P  P++ N  A+P+
Sbjct: 181 RAVEIAKAKGAKRAMLLPVSAPFHCALMQPAAEAMAEALAGVAIKAPAAPLVCNVLAAPI 240

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
           +  DEI   LVEQVTG VRWRE++ + A  GV   +E+G+GKVL+GL KRI      + +
Sbjct: 241 TDPDEIRSRLVEQVTGTVRWRESVAYMAGQGVTQFFEIGAGKVLSGLVKRIADGAVGMPV 300

Query: 300 SKVEDID 306
               DID
Sbjct: 301 GGPGDID 307


>gi|187924887|ref|YP_001896529.1| malonyl CoA-acyl carrier protein transacylase [Burkholderia
           phytofirmans PsJN]
 gi|187716081|gb|ACD17305.1| malonyl CoA-acyl carrier protein transacylase [Burkholderia
           phytofirmans PsJN]
          Length = 311

 Score =  190 bits (482), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 135/310 (43%), Positives = 174/310 (56%), Gaps = 4/310 (1%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M     FPGQGSQ +GM     D     R   +E    LNQ+L  L+  G  E+L  T N
Sbjct: 1   MKFAFVFPGQGSQSVGMLNAFAD-HAVVRETVQEASDALNQDLGKLIAEGPVEDLNLTTN 59

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
            QP +   + A  R   + G       + VAGHSLGEYTAL AA A +  D + LVR R 
Sbjct: 60  TQPVMLTAAYAMYRAWLQAGG---PKPAIVAGHSLGEYTALVAAGAIAFRDAVPLVRFRA 116

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           ++MQ AVP G G M AI+GLDD  V ++CA+AS  G+ E  N N   QVVI+G + AV+ 
Sbjct: 117 QAMQTAVPVGEGGMAAILGLDDDAVRAVCAEASVAGVVEAVNFNAPAQVVIAGNKAAVEK 176

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A +    KGAKRA+ LPVSAPFHSSL+ P S  ++  L SV  Q P +P++ N   + V+
Sbjct: 177 ACEVAKAKGAKRALPLPVSAPFHSSLLKPASDQLREYLASVEVQVPAIPVINNVDVAVVN 236

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
              +I   LV Q  G VRW E++Q  +  GV  V E G GKVL GL KRID +L   SI 
Sbjct: 237 EPVKIKDALVRQAAGAVRWVESVQAMSAQGVTHVIECGPGKVLAGLTKRIDGNLIGASIF 296

Query: 301 KVEDIDLALR 310
               ++  L+
Sbjct: 297 DPASLEETLK 306


>gi|47570286|ref|ZP_00240935.1| malonyl CoA-acyl carrier protein transacylase [Bacillus cereus
           G9241]
 gi|47553050|gb|EAL11452.1| malonyl CoA-acyl carrier protein transacylase [Bacillus cereus
           G9241]
          Length = 314

 Score =  190 bits (482), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 122/314 (38%), Positives = 182/314 (57%), Gaps = 5/314 (1%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
                FPGQGSQ +GMG+ L ++  E   VF + D  L  +LS++++ G QE+LT T NA
Sbjct: 3   KLAFLFPGQGSQAVGMGKQLAENNKEVANVFAKADEVLQDSLSEVIFEGPQEKLTLTTNA 62

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPAL   S A +  +++  +       +VAGHSLGEY+AL AA A +  D +  VR RG+
Sbjct: 63  QPALLTTSFAILTALKEYDIT----PDFVAGHSLGEYSALVAAGALTFEDAVYAVRKRGE 118

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQAS-RVGICEIANDNGGGQVVISGLQDAVKC 180
            M+ AVP G G+M AI+G D  ++  +  + +      +IAN N   Q+VISG +  V+ 
Sbjct: 119 YMEAAVPGGEGAMAAILGADPHMLKQVTEEVTSEGYAVQIANMNSTKQIVISGTKQGVEI 178

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A+      GAKRA+ L VS PFHS+LM P ++  + +L+ +T QD  +P++ N  A  ++
Sbjct: 179 ASQRAKENGAKRAIPLKVSGPFHSALMKPAAEKFQSVLNEITIQDTNIPVIANVTADVIT 238

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
           S   I + L+EQ+   V W  +I++  N GV +  E+G GKVL GL K ID S+ A +I 
Sbjct: 239 SGAHIQKKLIEQLYSPVLWYPSIEYMVNQGVDTFIEIGPGKVLAGLMKSIDSSVKAYAIY 298

Query: 301 KVEDIDLALRSIVG 314
             E +   +  + G
Sbjct: 299 DEETLKDTISDLRG 312


>gi|222097297|ref|YP_002531354.1| malonyl CoA-acyl carrier protein transacylase [Bacillus cereus Q1]
 gi|221241355|gb|ACM14065.1| malonyl CoA-acyl carrier protein transacylase [Bacillus cereus Q1]
          Length = 314

 Score =  190 bits (482), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 123/314 (39%), Positives = 184/314 (58%), Gaps = 5/314 (1%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
                FPGQGSQ +GMG+ L ++  E   VF + D  L  +LS++++ G QE+LT T NA
Sbjct: 3   KLAFLFPGQGSQAVGMGKQLAENNKEVANVFAKADEVLQDSLSEVIFEGPQEKLTLTTNA 62

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPAL   S A +  +++  +       +VAGHSLGEY+AL AA A +  D +  VR RG+
Sbjct: 63  QPALLTTSFAILTALKEYDIT----PDFVAGHSLGEYSALVAAGALTFEDAVYAVRKRGE 118

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQAS-RVGICEIANDNGGGQVVISGLQDAVKC 180
            M+EAVP G G+MVAI+G D  ++  +  + +      +IAN N   Q+VISG +  V+ 
Sbjct: 119 YMEEAVPGGEGAMVAILGADPHMLKQVTEEVTSEGYAVQIANMNSTKQIVISGTKQGVEI 178

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A+      GAKRA+ L VS PFHS+LM P ++  + +L+ +T QD  +P++ N  A  ++
Sbjct: 179 ASQRAKENGAKRAIPLKVSGPFHSALMKPAAEKFQSVLNEITIQDTNIPVIANVTADVIT 238

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
           S   I   L+EQ+   V W  +I++  + GV +  E+G GKVL GL K ID S+ A +I 
Sbjct: 239 SGAHIQEKLIEQLYSPVLWYPSIEYMVSQGVDTFIEIGPGKVLVGLMKSIDSSVKAYAIY 298

Query: 301 KVEDIDLALRSIVG 314
             E +   + ++ G
Sbjct: 299 DEETLQDTISNLRG 312


>gi|89068233|ref|ZP_01155643.1| acyl-carrier-protein S-malonyltransferase [Oceanicola granulosus
           HTCC2516]
 gi|89046150|gb|EAR52208.1| acyl-carrier-protein S-malonyltransferase [Oceanicola granulosus
           HTCC2516]
          Length = 312

 Score =  190 bits (482), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 162/311 (52%), Positives = 217/311 (69%), Gaps = 1/311 (0%)

Query: 4   VLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQP 63
              FPGQGSQVIGMGR+L +++PEAR VF+EVD  L Q+LS L W G   +LT T NAQP
Sbjct: 3   AFVFPGQGSQVIGMGRELAEAYPEARAVFDEVDAALGQDLSALTWEGDIADLTLTENAQP 62

Query: 64  ALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSM 123
           AL A SMA +  +   G+ V     YVAGHSLGEYTALCAA A SL+DT RL++ RG++M
Sbjct: 63  ALMATSMAAMAALASEGVTVSA-ADYVAGHSLGEYTALCAAGALSLADTARLLKVRGQAM 121

Query: 124 QEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAAD 183
           QEAVP G G+M A++GLD     ++  +A+   +C+ ANDN  GQVV+SG + AV+ A +
Sbjct: 122 QEAVPVGQGAMAALLGLDYETARAVAEEAAGDDVCQAANDNDPGQVVVSGHKAAVERAVE 181

Query: 184 TCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSID 243
               +GAKRAV LPVSAPFHSSLM P ++VM   LD VT + PVVP++ N  A PV++ D
Sbjct: 182 IAKGRGAKRAVILPVSAPFHSSLMAPAAEVMAGALDKVTFEAPVVPVVTNVSARPVTNPD 241

Query: 244 EISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVE 303
           E+   LVEQVTG VRWRE++ W A  GV  V+E+G+GK L+G+ +RID++++  +++   
Sbjct: 242 ELRAQLVEQVTGSVRWRESVAWMAGEGVGEVWEIGAGKALSGMIRRIDRAVATRTVATPH 301

Query: 304 DIDLALRSIVG 314
           ++  A  S+ G
Sbjct: 302 EVKDAAASLAG 312


>gi|168187326|ref|ZP_02621961.1| malonyl CoA-acyl carrier protein transacylase [Clostridium
           botulinum C str. Eklund]
 gi|169294789|gb|EDS76922.1| malonyl CoA-acyl carrier protein transacylase [Clostridium
           botulinum C str. Eklund]
          Length = 314

 Score =  190 bits (481), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 110/313 (35%), Positives = 179/313 (57%), Gaps = 4/313 (1%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
                F GQG+Q IGMG++LY++  E++ VF + D+ L  ++S+L ++G  +EL  T N 
Sbjct: 3   KIAFLFSGQGAQYIGMGKELYENIEESKEVFHKADNALGFSISELCFSGEAQELNKTENT 62

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPA+   S+A ++ +EK     +     VAG SLGEY+AL  +      D +R+V+ RGK
Sbjct: 63  QPAILTTSIAALKALEKY----EIKPDVVAGLSLGEYSALVCSGVLEFEDAVRVVKKRGK 118

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCA 181
            MQ+ VP G+G+M AIIGLD   +   C +A+  GI E+AN N   Q+VI+G   AV  A
Sbjct: 119 FMQQEVPFGVGTMAAIIGLDRENIKEACNRAASEGIVEVANYNCSSQIVIAGEIKAVDKA 178

Query: 182 ADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSS 241
            D     GAKRA+ L VSAPFHSS++    + +     ++  ++  +P++ N   + + S
Sbjct: 179 LDIAKELGAKRAIKLQVSAPFHSSMLKGAGEKLYNEFQNIELKEIKIPVMTNVTGTYIKS 238

Query: 242 IDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISK 301
           + +I  +L +QV   V W + I+     GV +  E+G GK L G  K+I++ +  +++  
Sbjct: 239 VSDIKGILKKQVMSSVLWEDIIKNMIEEGVDTFIEIGPGKALVGFVKKINRKVKVLNVED 298

Query: 302 VEDIDLALRSIVG 314
           ++ ++     + G
Sbjct: 299 LKSLEKTADELKG 311


>gi|331266966|ref|YP_004326596.1| (acyl-carrier-protein) S-malonyltransferase [Streptococcus oralis
           Uo5]
 gi|326683638|emb|CBZ01256.1| (acyl-carrier-protein) S-malonyltransferase [Streptococcus oralis
           Uo5]
          Length = 306

 Score =  190 bits (481), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 112/308 (36%), Positives = 161/308 (52%), Gaps = 6/308 (1%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
            T   F GQG+Q +GMGRDLYD +P  +   ++    L  +L DL+ +  + ++  T   
Sbjct: 3   KTAFLFAGQGAQYLGMGRDLYDRYPIVKETIDQASQVLGYDLRDLI-DKEEAKINQTRYT 61

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPA+ A S++  R++++ G         VAG SLGEY+AL A+ A    + + LV  RG 
Sbjct: 62  QPAILATSVSIYRLLKEKGY----QPDMVAGLSLGEYSALVASGALDFEEAVALVAKRGA 117

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCA 181
            M+EA P G G MVA++     V++  C  AS VGI   AN N   Q+VI G   AV  A
Sbjct: 118 YMEEAAPAGSGKMVAVLNTPVDVIEEACKTASEVGIVTPANYNTPSQIVIGGEVAAVDRA 177

Query: 182 ADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSS 241
            +     GAKR + L VS PFH++L+ P S+ +   L+ V+  D     L     + V  
Sbjct: 178 VELLQEAGAKRLIPLNVSGPFHTALLEPASQQLAGALEGVSFSD-FTCPLVGNTEAAVME 236

Query: 242 IDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISK 301
            D I  LL  QV   VR+ E+I    + GV    E+G GKVL+G  K+IDK+    ++  
Sbjct: 237 KDRIQELLTRQVKEPVRFYESIAVMQDAGVTHFIEIGPGKVLSGFVKKIDKTAQLANVED 296

Query: 302 VEDIDLAL 309
              +D  L
Sbjct: 297 QASLDALL 304


>gi|313886434|ref|ZP_07820153.1| [acyl-carrier-protein] S-malonyltransferase [Porphyromonas
           asaccharolytica PR426713P-I]
 gi|312924115|gb|EFR34905.1| [acyl-carrier-protein] S-malonyltransferase [Porphyromonas
           asaccharolytica PR426713P-I]
          Length = 296

 Score =  190 bits (481), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 107/302 (35%), Positives = 160/302 (52%), Gaps = 6/302 (1%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M     FPGQGSQ +GMG+++Y      R +F E D  L  +LS  M+ G++E+L  T  
Sbjct: 1   MKKAFVFPGQGSQFVGMGQEIYTKSEAVRKLFAEADEVLGFDLSKTMFEGTEEDLKQTKV 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
            QPA+   S+A    + +           VAGHSLGE++AL A++A   +D +RLV  R 
Sbjct: 61  TQPAVFLHSVAMTVALGEAFA-----PDMVAGHSLGEFSALVASRALPFADALRLVSERA 115

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
            +MQ A      +M AIIGL D  ++    +     +   AN N  GQVVISG  + +  
Sbjct: 116 LAMQAACEAHPSTMAAIIGLPDDKIE-EVCRGISGQVVVPANYNCSGQVVISGTMEGIAE 174

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A +     GAKRA+ L V   FHS LM P  + ++  +++ T   P+ PI  N  A P +
Sbjct: 175 ACEQLKAAGAKRALPLKVGGAFHSPLMQPAKERLQRAIEATTFATPICPIYQNVDARPHT 234

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
            ++EI   L+ Q+T  VRW ++++     G     E+G GKVL GL  RI + ++  S++
Sbjct: 235 DVEEIKANLIAQLTAPVRWTKSVEAMVADGATHFVELGPGKVLAGLIGRIARDVTCESLA 294

Query: 301 KV 302
            +
Sbjct: 295 TI 296


>gi|209695676|ref|YP_002263605.1| malonyl CoA-acyl carrier protein transacylase [Aliivibrio
           salmonicida LFI1238]
 gi|208009628|emb|CAQ79924.1| malonyl CoA-acyl carrier protein transacylase [Aliivibrio
           salmonicida LFI1238]
          Length = 307

 Score =  190 bits (481), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 131/309 (42%), Positives = 178/309 (57%), Gaps = 4/309 (1%)

Query: 1   MS-TVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATC 59
           MS   + FPGQGSQ +GM  +L +        F E    L  +L  L+ NG  E+L  T 
Sbjct: 1   MSNFAIVFPGQGSQAVGMLAELGEQHEVVTQTFAEASEALGYDLWSLVQNGPAEDLNQTF 60

Query: 60  NAQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRAR 119
             QPAL A S+A  RV ++ GL      S +AGHSLGEY+AL  A      + I+LV  R
Sbjct: 61  RTQPALLATSVALWRVWQEQGLA---QPSVLAGHSLGEYSALVCAGVIDFKEAIKLVELR 117

Query: 120 GKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVK 179
           G+ MQEAVP G+G+M AIIGLD+  +   C  A++  +    N N  GQVVI+G +DAV+
Sbjct: 118 GQLMQEAVPAGVGAMFAIIGLDNDSIAKACEDAAQDEVVSPVNFNSPGQVVIAGNKDAVE 177

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            A   C   GAKRA+ LPVS P H +LM P +  +   L+S+    PV+P++ N      
Sbjct: 178 RAGVLCKEAGAKRALPLPVSVPSHCALMKPAADKLAVALESIEFSTPVLPVINNVDVIAE 237

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
           +  ++I   LV Q+   VRW E ++  A  GV+ +YEVG GKVLTGL KRI KSLSA ++
Sbjct: 238 TDPEKIKDALVRQLYCPVRWTEVVEQMAEQGVEMLYEVGPGKVLTGLTKRIVKSLSAAAV 297

Query: 300 SKVEDIDLA 308
           +    ++ A
Sbjct: 298 NDAASLEAA 306


>gi|56697137|ref|YP_167500.1| acyl-carrier-protein S-malonyltransferase [Ruegeria pomeroyi DSS-3]
 gi|56678874|gb|AAV95540.1| malonyl CoA-acyl carrier protein transacylase [Ruegeria pomeroyi
           DSS-3]
          Length = 312

 Score =  190 bits (481), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 151/310 (48%), Positives = 208/310 (67%), Gaps = 1/310 (0%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M+T   FPGQG+Q IGMG+ L +++P A+ VF+EVD  L + LS L+W G  E LT T N
Sbjct: 1   MTTAFVFPGQGAQTIGMGKALAEAYPAAQAVFDEVDAALGEKLSALIWEGDIETLTLTQN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
           AQPAL A SMA +R +E  G+ +    ++VAGHSLGEY+AL AA A S+ DT RL+R RG
Sbjct: 61  AQPALMATSMAAMRALEAEGVAIT-QAAFVAGHSLGEYSALAAAGALSVGDTARLLRTRG 119

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           ++MQ AVP G G+M AI+GLD   V  + A+A++  +C+ ANDN   QVV+SG + AV+ 
Sbjct: 120 QAMQSAVPVGQGAMAAILGLDLAAVREVAAEAAQGEVCQAANDNDPTQVVVSGAKAAVER 179

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           AA+    KGAKRAV LPVSAPFH +LM P +  M   L +V  + P VP++ N  A  VS
Sbjct: 180 AAEIAKAKGAKRAVMLPVSAPFHCALMQPAADAMAEALAAVEIKAPAVPLVANVRAEAVS 239

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
             D I +LLVEQVTG VRWRE++++ A  GV  ++E+G+GK L+G+ ++I++ ++     
Sbjct: 240 DPDLIRQLLVEQVTGSVRWRESVEYMAAQGVTEIWEIGAGKALSGMVRKINREIACKPAG 299

Query: 301 KVEDIDLALR 310
             ED+   L 
Sbjct: 300 TPEDVQKILA 309


>gi|23501358|ref|NP_697485.1| acyl-carrier-protein S-malonyltransferase [Brucella suis 1330]
 gi|23347251|gb|AAN29400.1| malonyl CoA-acyl carrier protein transacylase [Brucella suis 1330]
          Length = 314

 Score =  190 bits (481), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 174/301 (57%), Positives = 222/301 (73%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M+   TFPGQGSQ +GMG+ L + F EAR VF+EVD  L + LS  M+ G ++ LT T N
Sbjct: 1   MAVAFTFPGQGSQAVGMGKALAEQFAEARAVFDEVDEALGEKLSATMFEGPEDVLTLTAN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
           AQPAL AVSMA  R+ME  G  +K  +SYVAGHSLGEY+ALCAA  FSL+DT RL+R RG
Sbjct: 61  AQPALMAVSMAVQRIMEARGFSLKDKVSYVAGHSLGEYSALCAAGTFSLADTARLLRIRG 120

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
            +MQ+AVP G G+M AIIGL+   V+++C +A   G  +IANDNGGGQ+VISG + AV+ 
Sbjct: 121 NAMQKAVPVGEGAMAAIIGLEHGDVEAVCMEAKASGPVQIANDNGGGQLVISGARAAVEL 180

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           AA     KGAKRA+ LPVSAPFHS+LM P +  M+  L +V K DPVVP++ N  A+PV+
Sbjct: 181 AAKLGSEKGAKRAIMLPVSAPFHSTLMAPAADAMREALAAVEKHDPVVPLIANVRAAPVT 240

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
             +EI+ LLVEQVTG+VRWRETI+WF+ +GV ++YEVG GKVLTGLA+RI K +S  ++ 
Sbjct: 241 DANEIAALLVEQVTGQVRWRETIEWFSANGVTTLYEVGCGKVLTGLARRISKDVSGATVG 300

Query: 301 K 301
            
Sbjct: 301 S 301


>gi|315612593|ref|ZP_07887506.1| malonyl-CoA-[acyl-carrier-protein] transacylase [Streptococcus
           sanguinis ATCC 49296]
 gi|315315574|gb|EFU63613.1| malonyl-CoA-[acyl-carrier-protein] transacylase [Streptococcus
           sanguinis ATCC 49296]
          Length = 306

 Score =  190 bits (481), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 114/308 (37%), Positives = 163/308 (52%), Gaps = 6/308 (1%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
            T   F GQG+Q +GMGRDLYD +P  +   ++    L  +L DL+ +  + +L  T   
Sbjct: 3   KTAFLFAGQGAQYLGMGRDLYDRYPIVKETIDQASQVLGYDLRDLI-DKEETKLNQTRYT 61

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPA+ A S+A  R++++ G         VAG SLGEY+AL A+ A    D + LV  RG 
Sbjct: 62  QPAILATSVAIYRLLKEKGY----QPDMVAGLSLGEYSALVASGALDFEDAVALVAKRGA 117

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCA 181
            M+EA P G G MVA++     V++  C  AS+VG+   AN N   Q+VI G   AV  A
Sbjct: 118 YMEEAAPAGSGKMVAVLNTPVEVIEEACETASKVGVVTPANYNTPSQIVIGGEVAAVDRA 177

Query: 182 ADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSS 241
            +     GAKR + L VS PFH++L+ P S+ +   L+ V+  D     L     + V  
Sbjct: 178 VELLQEAGAKRLIPLNVSGPFHTALLEPASQQLAEALEGVSFAD-FTCPLVGNTEAAVME 236

Query: 242 IDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISK 301
            D I  LL  QV   VR+ E+I    + GV +  E+G GKVL+G  K+IDK+    ++  
Sbjct: 237 KDRIQELLTRQVKEPVRFYESIAVMQDAGVTNFIEIGPGKVLSGFVKKIDKTAQLANVED 296

Query: 302 VEDIDLAL 309
              +D  L
Sbjct: 297 QASLDALL 304


>gi|118444515|ref|YP_877021.1| malonyl CoA-acyl carrier protein transacylase [Clostridium novyi
           NT]
 gi|118134971|gb|ABK62015.1| malonyl CoA-acyl carrier protein transacylase [Clostridium novyi
           NT]
          Length = 314

 Score =  190 bits (481), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 112/313 (35%), Positives = 179/313 (57%), Gaps = 4/313 (1%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
                F GQGSQ IGMG++LYD+F E+R VF + +  L  ++SDL + GS E+L  T N 
Sbjct: 3   KIAFLFSGQGSQYIGMGKELYDNFYESREVFNKANIALGFSISDLCFGGSLEDLNKTENT 62

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPA+   S+A ++ +EK+    +     VAG SLGEY+AL  +      D +R+V+ RGK
Sbjct: 63  QPAILTTSIATLKALEKH----EIKPDMVAGLSLGEYSALVCSGVLDFEDAVRVVKKRGK 118

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCA 181
            MQE VP G+G+M A+IGL    +   C +AS+ GI ++AN N   Q+VI+G   AV  A
Sbjct: 119 FMQEEVPFGVGTMAAVIGLAREKIKEACIRASKEGIVQVANYNCQSQIVIAGEIKAVDKA 178

Query: 182 ADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSS 241
            +     GAKR + L VSAPFH+S++    + +   L ++  ++  +P++ N   + ++ 
Sbjct: 179 LEIAKELGAKRVIKLKVSAPFHTSMLKGAGEKLYSELQNIELKEIKIPVMTNVTGTYIND 238

Query: 242 IDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISK 301
           + +I  +L EQV   V W + I+     GV +  E+G GK L G  K+I++ +  +++  
Sbjct: 239 VHDIKGILKEQVMSSVLWEDIIKNMIEEGVDTFIEIGPGKALCGFVKKINRKVKVLNVED 298

Query: 302 VEDIDLALRSIVG 314
           +  +   +  + G
Sbjct: 299 LNSLRKTVDELKG 311


>gi|113868530|ref|YP_727019.1| (Acyl-carrier-protein) S-malonyltransferase [Ralstonia eutropha
           H16]
 gi|113527306|emb|CAJ93651.1| (Acyl-carrier-protein) S-malonyltransferase [Ralstonia eutropha
           H16]
          Length = 309

 Score =  190 bits (481), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 129/313 (41%), Positives = 169/313 (53%), Gaps = 4/313 (1%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M     FPGQGSQ +GM     D+    R   EE    L Q+L  L+  G  EEL  T N
Sbjct: 1   MKFAFVFPGQGSQSVGMLNAFADN-AVVRATVEEASAALGQDLGRLIAEGPAEELNLTTN 59

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
            QP +   ++A  R     G       + VAGHSLGEY+AL AA     +D + LVR R 
Sbjct: 60  TQPVMLTAAVAVYRAWLDAGG---PAPALVAGHSLGEYSALVAAGVIPFADAVPLVRFRA 116

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           ++MQEAVP G G+M AI+GL D  V + CA+AS  G+ E  N N   QVVI+G + AV+ 
Sbjct: 117 QAMQEAVPVGEGAMAAILGLSDDDVRAACAEASAAGVVEAVNFNAPSQVVIAGHKAAVEK 176

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A +    KGAKRA+ LPVSAPFHSSL+ P S  ++  +  +    P +P++ N   + V+
Sbjct: 177 ACEIAKGKGAKRALPLPVSAPFHSSLLKPASDRLRERMAGLAFSAPSIPLVNNVDVAIVN 236

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
             D I   LV Q    VRW E +Q  A  GV  V E G GKVL G+ KRID +L+  +I 
Sbjct: 237 DPDAIKDALVRQAAAPVRWVECVQKMAAEGVTHVIECGPGKVLAGMTKRIDGNLTGGAIF 296

Query: 301 KVEDIDLALRSIV 313
               +   L  + 
Sbjct: 297 DPASLQDTLALLK 309


>gi|78222810|ref|YP_384557.1| [Acyl-carrier-protein] S-malonyltransferase [Geobacter
           metallireducens GS-15]
 gi|78194065|gb|ABB31832.1| [Acyl-carrier-protein] S-malonyltransferase [Geobacter
           metallireducens GS-15]
          Length = 308

 Score =  190 bits (481), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 129/304 (42%), Positives = 178/304 (58%), Gaps = 3/304 (0%)

Query: 4   VLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQP 63
              FPGQGSQ  GMG+DL D+F  AR  FEE D  L  NLS L ++G +++L  T N QP
Sbjct: 5   AFIFPGQGSQYPGMGKDLADNFALARKTFEEADDALGDNLSRLCFDGPEDQLKLTANTQP 64

Query: 64  ALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSM 123
           ++  VS+A +RV+++          Y AGHSLGEY+AL AA     +D +R VRARG  M
Sbjct: 65  SILTVSVAALRVLQE---ETGLSAQYFAGHSLGEYSALVAAGVIQFADAVRTVRARGTFM 121

Query: 124 QEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAAD 183
           QEAVP G+G+M A++ ++  V+ +ICA+A++      AN N  GQ+VI+G   AV  A +
Sbjct: 122 QEAVPVGVGAMAAMLSIEPDVLAAICAEAAQGEEVSPANFNSPGQIVIAGHTGAVNRAIE 181

Query: 184 TCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSID 243
               KG ++A+ LPVSAPFHSSLM P  + +  +L  +T      P++ N  A P     
Sbjct: 182 IAKAKGFRKAMLLPVSAPFHSSLMVPAGERLAGVLAPITVGAFSAPVVTNVEAKPNDDKA 241

Query: 244 EISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVE 303
            +  LLV QV+  V W  +++     GV    EVG GKVL+GL KRIDK +S  ++    
Sbjct: 242 RVKELLVRQVSAPVLWDASVREMVALGVTEFVEVGPGKVLSGLVKRIDKGVSTKNVEDAA 301

Query: 304 DIDL 307
            I  
Sbjct: 302 GIKA 305


>gi|187928011|ref|YP_001898498.1| cyclic nucleotide-binding protein [Ralstonia pickettii 12J]
 gi|187724901|gb|ACD26066.1| cyclic nucleotide-binding protein [Ralstonia pickettii 12J]
          Length = 309

 Score =  190 bits (481), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 132/313 (42%), Positives = 169/313 (53%), Gaps = 4/313 (1%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M+    FPGQGSQ +GM     D  P       E    L Q++  L+  G  EEL  T N
Sbjct: 1   MTFAFVFPGQGSQSVGMLNAFAD-HPAVAATLVEASDALGQDIGKLIAEGPAEELNLTTN 59

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
            QP +   ++A  R  +  G       + VAGHSLGEY+AL AA A +  D + LVR R 
Sbjct: 60  TQPVMLTAAVAVYRAWQAAGG---PTPTVVAGHSLGEYSALVAAGAIAFQDAVPLVRFRA 116

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           K+MQEAVP G G M AI+GL D  V + CA+AS  G+ E  N N   QVVI+G + AV+ 
Sbjct: 117 KAMQEAVPVGEGGMAAILGLSDDDVRAACAEASVAGVVEAVNFNAPAQVVIAGAKAAVEK 176

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A +    KGAKRA+ LPVSAPFHSSL+ P S  ++  L +V    PV+P++ N   + VS
Sbjct: 177 ACEIAKAKGAKRALPLPVSAPFHSSLLKPASDRLREYLANVAVTTPVIPVINNVDVAVVS 236

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
               I   LV Q    VRW ETIQ     G+  V E G GKVL GL KRID  +   +I 
Sbjct: 237 DPAAIKDALVRQAASPVRWVETIQKMKGDGITRVVECGPGKVLAGLVKRIDGEIVGDAIF 296

Query: 301 KVEDIDLALRSIV 313
               ++  L  + 
Sbjct: 297 DPASLEAVLGQLK 309


>gi|310641505|ref|YP_003946263.1| malonyl CoA-acyl carrier protein transacylase (fabd) [Paenibacillus
           polymyxa SC2]
 gi|309246455|gb|ADO56022.1| Malonyl CoA-acyl carrier protein transacylase (FabD) [Paenibacillus
           polymyxa SC2]
          Length = 313

 Score =  190 bits (481), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 120/312 (38%), Positives = 174/312 (55%), Gaps = 5/312 (1%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
            T   FPGQGSQ +GM +D Y++ P A  VF + D  L   LS L++ G    L  T N 
Sbjct: 3   KTAFIFPGQGSQAVGMAKDAYEAVPAATEVFRKADERLGFALSTLIFEGPDTALKQTSNT 62

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPAL   S+A     ++ G+       YVAGHSLGEY+AL A+   +  D +  VRARG+
Sbjct: 63  QPALLTASIALYEAFKEKGI----RPDYVAGHSLGEYSALVASGVLTFEDAVETVRARGQ 118

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQASR-VGICEIANDNGGGQVVISGLQDAVKC 180
            M++A+P G G M A++G D   + ++C   +    + E+AN N  GQ+V+SG +  V  
Sbjct: 119 FMEQAIPDGQGGMAAVLGADREALAALCRDITESGQLVELANINCPGQIVVSGTKAGVAA 178

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
            A+     G KRA+ L VS PFHSSLM   +  +   L++V   +  +P++ N  A PV 
Sbjct: 179 VAERVKEAGGKRAITLEVSGPFHSSLMKEAADKLSGKLETVKFAEAQIPVVTNVTAKPVR 238

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
              EI +LLVEQV   V W +++ W    GV +  E G G VLTGL K+IDK++   ++S
Sbjct: 239 EGSEIRQLLVEQVYSPVLWEDSVAWLLEQGVDTFVEFGPGSVLTGLVKKIDKTVKLYNMS 298

Query: 301 KVEDIDLALRSI 312
            +E     + ++
Sbjct: 299 SLESFASIIEAL 310


>gi|37526724|ref|NP_930068.1| acyl carrier protein S-malonyltransferase [Photorhabdus luminescens
           subsp. laumondii TTO1]
 gi|36786156|emb|CAE15208.1| malonyl CoA-acyl carrier protein transacylase (MCT) [Photorhabdus
           luminescens subsp. laumondii TTO1]
          Length = 310

 Score =  190 bits (481), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 129/312 (41%), Positives = 173/312 (55%), Gaps = 4/312 (1%)

Query: 1   MS-TVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATC 59
           MS   + FPGQGSQ +GM  DL  +FP     F E    L  +L  L+  G +EEL  T 
Sbjct: 1   MSEFAMVFPGQGSQDLGMLADLATAFPVVEQTFAEASDVLGYDLWALVQQGPEEELNKTW 60

Query: 60  NAQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRAR 119
             QPAL A S+A  RV ++ G       S +AGHSLGEY+AL  A        IRLV  R
Sbjct: 61  QTQPALLAASVAIWRVWQEKGGKA---PSLMAGHSLGEYSALVCAGVIDFKQAIRLVELR 117

Query: 120 GKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVK 179
           GK MQEAVP G G+M  IIGLD+  +D  C + ++  I    N N  GQVVI+G ++AV+
Sbjct: 118 GKLMQEAVPEGTGAMYVIIGLDNESIDRACKEVAQGQIVSPVNFNSPGQVVIAGEKEAVE 177

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            A D C   GAKRA+ L VS P H +LM P +  +  +L+ +    P  P++ N      
Sbjct: 178 RAGDACKAAGAKRALPLAVSVPSHCALMKPAADKLAVVLEGIEFGYPQFPVVNNVDVKIE 237

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
            S + I   LV Q+   VRW ET+++    GV  + E+G G+VLTGL KRI  +LSA ++
Sbjct: 238 QSAEAIRHALVRQLYNPVRWTETVEFITEQGVGQLLEIGPGRVLTGLTKRIVNTLSAAAV 297

Query: 300 SKVEDIDLALRS 311
           +    +  AL +
Sbjct: 298 NDTASLITALEN 309


>gi|307706069|ref|ZP_07642888.1| malonyl CoA-acyl carrier protein transacylase [Streptococcus mitis
           SK321]
 gi|307618469|gb|EFN97617.1| malonyl CoA-acyl carrier protein transacylase [Streptococcus mitis
           SK321]
          Length = 307

 Score =  189 bits (480), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 109/310 (35%), Positives = 165/310 (53%), Gaps = 6/310 (1%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
            T   F GQG+Q +GMGRDLYD +P  +   ++    L  +L  L+ +  + +L  T   
Sbjct: 3   KTAFLFAGQGAQYLGMGRDLYDQYPIVKETIDQASQVLGYDLRHLI-DTEEAKLNQTRYT 61

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPA+ A S+A  R++++ G         VAG SLGEY+AL A+ A    + + LV  RG 
Sbjct: 62  QPAILATSVAIYRLLQEKGY----QPDMVAGLSLGEYSALVASGALDFGEAVALVAKRGA 117

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCA 181
            M+EA P G G MVA++     V++ +C +AS +G+   AN N   Q+VI G   AV  A
Sbjct: 118 YMEEAAPAGSGKMVAVLNTPVEVIEQVCRKASELGVVTPANYNTPAQIVIGGEVVAVDRA 177

Query: 182 ADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSS 241
            +     GAKR + L VS PFH++L+ P S+ +   L  V+  D     L     + V  
Sbjct: 178 VELLQEAGAKRLIPLKVSGPFHTALLEPASQKLAETLAQVSFSD-FTCPLVGNTEAAVMQ 236

Query: 242 IDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISK 301
            ++I++LL  QV   VR+ E+I      GV +  E+G GKVL+G  K+IDK+    ++  
Sbjct: 237 KEDIAQLLTRQVKEPVRFYESIAVMQEAGVTNFIEIGPGKVLSGFVKKIDKTAKLANVED 296

Query: 302 VEDIDLALRS 311
              ++  L +
Sbjct: 297 QASLETLLEN 306


>gi|229061455|ref|ZP_04198800.1| Malonyl CoA-acyl carrier protein transacylase [Bacillus cereus
           AH603]
 gi|228717878|gb|EEL69526.1| Malonyl CoA-acyl carrier protein transacylase [Bacillus cereus
           AH603]
          Length = 314

 Score =  189 bits (480), Expect = 4e-46,   Method: Composition-based stats.
 Identities = 123/314 (39%), Positives = 183/314 (58%), Gaps = 5/314 (1%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
                FPGQGSQ +GMGR L  +  E   VF + D  L+ +LS++++ G QE+LT T NA
Sbjct: 3   KIAFLFPGQGSQAVGMGRQLAGNNKEVAKVFAKADEVLHDSLSEVIFEGPQEKLTLTTNA 62

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPAL   S A +  +++  +       +VAGHSLGEY+AL AA A +  D +  VR RG+
Sbjct: 63  QPALLTTSFAILTALKEYDIT----PDFVAGHSLGEYSALVAAGALTFEDAVYAVRKRGE 118

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQAS-RVGICEIANDNGGGQVVISGLQDAVKC 180
            M+EAVP G G+M AI+G D  ++  +  + +      +IAN N   Q+VISG +  V+ 
Sbjct: 119 YMEEAVPGGEGAMAAILGADPDMLKRVTEEVTSEGYAVQIANMNSTKQIVISGTKQGVEL 178

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A+      GAKRA+ L VS PFHSSLM P ++  + +L+ +T QD  +P++ N  A  ++
Sbjct: 179 ASQRAKENGAKRAIPLKVSGPFHSSLMKPAAEKFQSVLNEITIQDTNIPVIANVTADVIT 238

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
              +I   L+EQ+   V W  +I++  N GV +  E+G GKVL GL K ID S+ A ++ 
Sbjct: 239 RGTDIQAKLIEQLYSPVLWYPSIEYMVNQGVDTFIEIGPGKVLAGLMKSIDSSVKAYAVY 298

Query: 301 KVEDIDLALRSIVG 314
             E +   + ++ G
Sbjct: 299 DEETLKDTISNLRG 312


>gi|90423801|ref|YP_532171.1| malonyl CoA-acyl carrier protein transacylase [Rhodopseudomonas
           palustris BisB18]
 gi|90105815|gb|ABD87852.1| [Acyl-carrier-protein] S-malonyltransferase [Rhodopseudomonas
           palustris BisB18]
          Length = 319

 Score =  189 bits (480), Expect = 4e-46,   Method: Composition-based stats.
 Identities = 157/314 (50%), Positives = 218/314 (69%), Gaps = 1/314 (0%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M+   TFPGQGSQ +GMG+ L ++FP AR VF+EVD  L + L+  +W+G  E L  T N
Sbjct: 1   MTAAFTFPGQGSQAVGMGKALAEAFPAARAVFDEVDSALGEKLTATIWDGPAETLQLTEN 60

Query: 61  AQPALTAVSMAFIRVME-KNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRAR 119
           AQPAL AVS+A +RV+E + G  V R  ++VAGHSLGEY+AL AA + ++SDT RL+R R
Sbjct: 61  AQPALMAVSLATLRVLETEAGFSVARHAAFVAGHSLGEYSALAAAGSLTISDTARLLRTR 120

Query: 120 GKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVK 179
           G +MQ+AVP G+G+M A++GLD     ++  +A++  +C+ ANDNGGGQVV+SG + AV+
Sbjct: 121 GLAMQKAVPVGVGAMAALLGLDFDTAVAVAQEAAQGEVCQAANDNGGGQVVVSGAKAAVE 180

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            A +    KGAKRA+ LPVSAPFH +LM P ++ M   L  VT   P  P++ N  ASPV
Sbjct: 181 RALEIAKAKGAKRALLLPVSAPFHCTLMQPAAEAMAQALADVTILPPAAPLVANVLASPV 240

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
           ++ DEI RLLVEQVTG VRWRE++ + A+ GV   +E+G+GKVL+GL KRI      +++
Sbjct: 241 TAPDEIRRLLVEQVTGTVRWRESVAFMASQGVTHFFEIGAGKVLSGLVKRIADGAVGIAV 300

Query: 300 SKVEDIDLALRSIV 313
               DI+ A +++ 
Sbjct: 301 GGPNDIEPAKQALA 314


>gi|77864470|gb|ABB05103.1| LipPks2 [Streptomyces aureofaciens]
          Length = 3582

 Score =  189 bits (480), Expect = 4e-46,   Method: Composition-based stats.
 Identities = 90/316 (28%), Positives = 144/316 (45%), Gaps = 14/316 (4%)

Query: 3    TVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNL----SDLMWNGSQEELTAT 58
            T   F GQG+Q +GMGR+LYD+FP  R   +EV   L+  L     ++MW+   E L+ T
Sbjct: 2319 TAFLFTGQGAQRVGMGRELYDTFPAFRKALDEVCAVLDPLLPRPSREVMWDEDPEALSRT 2378

Query: 59   CNAQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRA 118
               QP L A+ +A  R++E  G+        VAGHS+GE  A       SL+D   LV A
Sbjct: 2379 EFTQPTLFAIEVALFRLLESWGI----HPDAVAGHSIGEIAAAHVTGVLSLADACVLVAA 2434

Query: 119  RGKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAV 178
            RG+     +   L     +I +     + +       G  +IA  N    VV+SG +  V
Sbjct: 2435 RGR-----LMQALPHDGVMIAVQATEDEVLPLLEKVTGQADIAAVNAPEAVVVSGAETEV 2489

Query: 179  KCAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASP 238
            +  A T   +  +R   L VS  FHS LM P+ K  + +++ ++ + P +P +     + 
Sbjct: 2490 EHVAATLGAQ-GRRVKRLTVSHAFHSPLMDPILKDFQTVVEGLSFRQPSLPFVSTVTGTV 2548

Query: 239  VSSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVS 298
              +        V  V   VR+ + ++     GV+   E+G   +LTGL ++   + +   
Sbjct: 2549 AGAEITEPAYWVRHVRQTVRFADGLRALHELGVRKFIEIGPDAILTGLVEQTLDTQAVPV 2608

Query: 299  ISKVEDIDLALRSIVG 314
            + +  D   A     G
Sbjct: 2609 LRRDRDEVRAAVEAAG 2624



 Score =  158 bits (400), Expect = 7e-37,   Method: Composition-based stats.
 Identities = 63/320 (19%), Positives = 109/320 (34%), Gaps = 18/320 (5%)

Query: 4   VLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTL----NQNLSDLMWNGSQEELTATC 59
           V  FPGQGSQ  GM  +L DS P      +     L    + NL +++ +  +E      
Sbjct: 574 VFVFPGQGSQWAGMAVELLDSSPVFADSMQACSEALNEFVDWNLLEVLRSDDEELSNRVD 633

Query: 60  NAQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRAR 119
             QP L AV ++   + +  G+      + V GHS GE  A   A A SL D  R+V  R
Sbjct: 634 VVQPVLWAVMVSLAALWQACGV----RPAAVVGHSQGEIAAAVVAGALSLRDGARVVALR 689

Query: 120 GKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVK 179
              +   +          +  D         +            +      +  L + V 
Sbjct: 690 SAVIARLLAGKGAMASVALASDTVRERLTPWEGRLSLAAVNGPSSSVVCGHLDALDEFVS 749

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
                       R   + V    HS  +    + ++ +L  V+     VP       + +
Sbjct: 750 AL-----EHDGVRVRRIAVDYASHSVFVEQAEEELRNVLTEVSPLPGEVPFYSTVTGAVL 804

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRID-----KSL 294
            +    +      +   VR+ ET++     G  +  EV +  VLT   +        +  
Sbjct: 805 DTTTLDAGYWYRNLRQTVRFEETVRELTRRGHDAFIEVSAHPVLTVGIQDTLEATGTRHA 864

Query: 295 SAVSISKVEDIDLALRSIVG 314
              ++ + E     L + +G
Sbjct: 865 VCGTLRRGEGGAQRLLTSLG 884


>gi|62289442|ref|YP_221235.1| acyl-carrier-protein S-malonyltransferase [Brucella abortus bv. 1
           str. 9-941]
 gi|82699368|ref|YP_413942.1| malonyl CoA-acyl carrier protein transacylase [Brucella melitensis
           biovar Abortus 2308]
 gi|189023691|ref|YP_001934459.1| acyl transferase [Brucella abortus S19]
 gi|237814929|ref|ZP_04593927.1| malonyl CoA-acyl carrier protein transacylase [Brucella abortus
           str. 2308 A]
 gi|254688753|ref|ZP_05152007.1| malonyl CoA-acyl carrier protein transacylase [Brucella abortus bv.
           6 str. 870]
 gi|254693236|ref|ZP_05155064.1| malonyl CoA-acyl carrier protein transacylase [Brucella abortus bv.
           3 str. Tulya]
 gi|254696882|ref|ZP_05158710.1| malonyl CoA-acyl carrier protein transacylase [Brucella abortus bv.
           2 str. 86/8/59]
 gi|254729786|ref|ZP_05188364.1| malonyl CoA-acyl carrier protein transacylase [Brucella abortus bv.
           4 str. 292]
 gi|256257000|ref|ZP_05462536.1| malonyl CoA-acyl carrier protein transacylase [Brucella abortus bv.
           9 str. C68]
 gi|260545808|ref|ZP_05821549.1| acyl transferase domain-containing protein [Brucella abortus NCTC
           8038]
 gi|260754233|ref|ZP_05866581.1| malonyl CoA-acyl carrier protein transacylase [Brucella abortus bv.
           6 str. 870]
 gi|260757453|ref|ZP_05869801.1| malonyl CoA-acyl carrier protein transacylase [Brucella abortus bv.
           4 str. 292]
 gi|260761278|ref|ZP_05873621.1| malonyl CoA-acyl carrier protein transacylase [Brucella abortus bv.
           2 str. 86/8/59]
 gi|260883259|ref|ZP_05894873.1| malonyl CoA-acyl carrier protein transacylase [Brucella abortus bv.
           9 str. C68]
 gi|261213480|ref|ZP_05927761.1| malonyl CoA-acyl carrier protein transacylase [Brucella abortus bv.
           3 str. Tulya]
 gi|297247854|ref|ZP_06931572.1| malonyl CoA-acyl carrier protein transacylase [Brucella abortus bv.
           5 str. B3196]
 gi|62195574|gb|AAX73874.1| FabD, malonyl CoA-acyl carrier protein transacylase [Brucella
           abortus bv. 1 str. 9-941]
 gi|82615469|emb|CAJ10438.1| Acyl transferase domain:Malonyl CoA-acyl carrier protein
           transacylase [Brucella melitensis biovar Abortus 2308]
 gi|189019263|gb|ACD71985.1| Acyl transferase domain protein [Brucella abortus S19]
 gi|237789766|gb|EEP63976.1| malonyl CoA-acyl carrier protein transacylase [Brucella abortus
           str. 2308 A]
 gi|260097215|gb|EEW81090.1| acyl transferase domain-containing protein [Brucella abortus NCTC
           8038]
 gi|260667771|gb|EEX54711.1| malonyl CoA-acyl carrier protein transacylase [Brucella abortus bv.
           4 str. 292]
 gi|260671710|gb|EEX58531.1| malonyl CoA-acyl carrier protein transacylase [Brucella abortus bv.
           2 str. 86/8/59]
 gi|260674341|gb|EEX61162.1| malonyl CoA-acyl carrier protein transacylase [Brucella abortus bv.
           6 str. 870]
 gi|260872787|gb|EEX79856.1| malonyl CoA-acyl carrier protein transacylase [Brucella abortus bv.
           9 str. C68]
 gi|260915087|gb|EEX81948.1| malonyl CoA-acyl carrier protein transacylase [Brucella abortus bv.
           3 str. Tulya]
 gi|297175023|gb|EFH34370.1| malonyl CoA-acyl carrier protein transacylase [Brucella abortus bv.
           5 str. B3196]
          Length = 314

 Score =  189 bits (480), Expect = 4e-46,   Method: Composition-based stats.
 Identities = 174/301 (57%), Positives = 221/301 (73%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M+   TFPGQGSQ +GMG+ L + F EAR VF+EVD  L + LS  M+ G ++ LT T N
Sbjct: 1   MAVAFTFPGQGSQAVGMGKALAEQFAEARAVFDEVDEALGEKLSATMFEGPEDVLTLTAN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
           AQPAL AVSMA  R+ME  G  +K  +SYVAGHSLGEY+ALCAA  FSL+DT RL+R RG
Sbjct: 61  AQPALMAVSMAVQRIMEARGFSLKDKVSYVAGHSLGEYSALCAAGTFSLADTARLLRIRG 120

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
            +MQ+AVP G G+M AIIGL+   V+++C +A   G  +IANDNGGGQ+VISG + AV+ 
Sbjct: 121 NAMQKAVPVGEGAMAAIIGLEHGDVEAVCMEAKASGPVQIANDNGGGQLVISGARAAVEL 180

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           AA     KGAKRA+ LPVSAPFHS+LM P +  M   L +V K DPVVP++ N  A+PV+
Sbjct: 181 AAKLGSEKGAKRAIMLPVSAPFHSTLMAPAADAMLEALAAVEKHDPVVPLIANVRAAPVT 240

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
             +EI+ LLVEQVTG+VRWRETI+WF+ +GV ++YEVG GKVLTGLA+RI K +S  ++ 
Sbjct: 241 DANEIAALLVEQVTGQVRWRETIEWFSANGVTTLYEVGCGKVLTGLARRISKDVSGAAVG 300

Query: 301 K 301
            
Sbjct: 301 S 301


>gi|213019596|ref|ZP_03335402.1| malonyl CoA-acyl carrier protein transacylase [Wolbachia
           endosymbiont of Culex quinquefasciatus JHB]
 gi|212995018|gb|EEB55660.1| malonyl CoA-acyl carrier protein transacylase [Wolbachia
           endosymbiont of Culex quinquefasciatus JHB]
          Length = 328

 Score =  189 bits (480), Expect = 4e-46,   Method: Composition-based stats.
 Identities = 136/305 (44%), Positives = 182/305 (59%), Gaps = 2/305 (0%)

Query: 4   VLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQP 63
           +  FPGQGSQ +GMG+ LYD F  AR VF+EVD  L + LS L++NG  E+LT T NAQP
Sbjct: 9   IFAFPGQGSQFVGMGKSLYDEFSVARNVFDEVDDILGRKLSHLIFNGPIEKLTITENAQP 68

Query: 64  ALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSM 123
           A+ AVS+A +RVM+         + YV GHS+GEYTALCAA A +L   ++L++ R ++M
Sbjct: 69  AIMAVSIATLRVMKHVFGESLYSVQYVCGHSVGEYTALCAAGALTLESAVKLLKVRSEAM 128

Query: 124 QEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAAD 183
            EA     G M A++G +   V+ I   A     CEIANDNGGGQVV+SG  +A++   D
Sbjct: 129 HEASLKCKGGMFALLGAEISEVEGILKSAQID--CEIANDNGGGQVVVSGTAEALEVLPD 186

Query: 184 TCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSID 243
              N   K+ + L VS PFHSS M P  + +   L S+    P +P + N  A   S  +
Sbjct: 187 LFKNSSVKKMIKLQVSGPFHSSFMKPADEKLLEFLKSINITRPSIPFVSNVTAKEESDPE 246

Query: 244 EISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVE 303
            I  LL +QV  RVRWRE + +  +HG     EVG  KVL+ L KRID+S++  SI  + 
Sbjct: 247 IIRALLAKQVVSRVRWREMVLYMTSHGTNKFVEVGPNKVLSNLVKRIDQSINTKSIGSIS 306

Query: 304 DIDLA 308
           D D  
Sbjct: 307 DADNF 311


>gi|190571076|ref|YP_001975434.1| malonyl CoA-acyl carrier protein transacylase [Wolbachia
           endosymbiont of Culex quinquefasciatus Pel]
 gi|190357348|emb|CAQ54779.1| malonyl CoA-acyl carrier protein transacylase [Wolbachia
           endosymbiont of Culex quinquefasciatus Pel]
          Length = 321

 Score =  189 bits (480), Expect = 4e-46,   Method: Composition-based stats.
 Identities = 136/305 (44%), Positives = 182/305 (59%), Gaps = 2/305 (0%)

Query: 4   VLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQP 63
           +  FPGQGSQ +GMG+ LYD F  AR VF+EVD  L + LS L++NG  E+LT T NAQP
Sbjct: 2   IFAFPGQGSQFVGMGKSLYDEFSVARNVFDEVDDILGRKLSHLIFNGPIEKLTITENAQP 61

Query: 64  ALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSM 123
           A+ AVS+A +RVM+         + YV GHS+GEYTALCAA A +L   ++L++ R ++M
Sbjct: 62  AIMAVSIATLRVMKHVFGESLYSVQYVCGHSVGEYTALCAAGALTLESAVKLLKVRSEAM 121

Query: 124 QEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAAD 183
            EA     G M A++G +   V+ I   A     CEIANDNGGGQVV+SG  +A++   D
Sbjct: 122 HEASLKCKGGMFALLGAEISEVEGILKSAQID--CEIANDNGGGQVVVSGTAEALEVLPD 179

Query: 184 TCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSID 243
              N   K+ + L VS PFHSS M P  + +   L S+    P +P + N  A   S  +
Sbjct: 180 LFKNSSVKKMIKLQVSGPFHSSFMKPADEKLLEFLKSINITRPSIPFVSNVTAKEESDPE 239

Query: 244 EISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVE 303
            I  LL +QV  RVRWRE + +  +HG     EVG  KVL+ L KRID+S++  SI  + 
Sbjct: 240 IIRALLAKQVVSRVRWREMVLYMTSHGTNKFVEVGPNKVLSNLVKRIDQSINTKSIGSIS 299

Query: 304 DIDLA 308
           D D  
Sbjct: 300 DADNF 304


>gi|294677212|ref|YP_003577827.1| [acyl-carrier-protein] S-malonyltransferase [Rhodobacter capsulatus
           SB 1003]
 gi|294476032|gb|ADE85420.1| [acyl-carrier-protein] S-malonyltransferase [Rhodobacter capsulatus
           SB 1003]
          Length = 309

 Score =  189 bits (480), Expect = 4e-46,   Method: Composition-based stats.
 Identities = 151/308 (49%), Positives = 201/308 (65%), Gaps = 1/308 (0%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           MS    FPGQG+Q IGMG+ L +++P A+ VF+EVD  L + LS L+W G  E LT T N
Sbjct: 1   MSVAWVFPGQGAQTIGMGKALAEAYPAAKAVFDEVDAALGEKLSALIWEGEIERLTLTAN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
           AQPAL A S+A +  ++  G+ V    ++VAGHSLGEY+ALCAA A SL+DT RL+R RG
Sbjct: 61  AQPALMATSLAAVAALKAEGIEVG-QAAFVAGHSLGEYSALCAAGALSLADTARLLRIRG 119

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           ++MQ AVP G+G+M A++GLD      + A+A++  +C+ ANDN   QVV+SG + AV+ 
Sbjct: 120 EAMQSAVPVGVGAMAALLGLDFATAAEVAAEAAQGEVCQAANDNDPAQVVVSGHKAAVER 179

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A +    KGAKRAV LPVSAPFH +LM P +  M   L +VT   PVVP++ N  A  V 
Sbjct: 180 AVEIAKGKGAKRAVMLPVSAPFHCALMQPAADRMAEALAAVTVSAPVVPVVANVRAEAVC 239

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
               I +LLVEQVTG VRWRE++ W    GV    EVG+GK L+G+ KRI K  +  ++ 
Sbjct: 240 DPATIRQLLVEQVTGSVRWRESVLWMVGQGVTDFCEVGAGKALSGMIKRIAKDTTQKAVG 299

Query: 301 KVEDIDLA 308
             ED+   
Sbjct: 300 TPEDVAAL 307


>gi|187735997|ref|YP_001878109.1| malonyl CoA-acyl carrier protein transacylase [Akkermansia
           muciniphila ATCC BAA-835]
 gi|187426049|gb|ACD05328.1| malonyl CoA-acyl carrier protein transacylase [Akkermansia
           muciniphila ATCC BAA-835]
          Length = 308

 Score =  189 bits (480), Expect = 4e-46,   Method: Composition-based stats.
 Identities = 113/312 (36%), Positives = 168/312 (53%), Gaps = 6/312 (1%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M  VL F GQG+Q +GMG+DLYD +P A+ + E+ D  L ++LS +M+ G  EELT TCN
Sbjct: 1   MDAVLLFSGQGAQKVGMGKDLYDQYPVAKALIEQADKALGESLSAVMFEGPGEELTRTCN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
            QPAL    +A + V+++  L    +    AG SLGE+TA  AA  +S  + +RLV+ RG
Sbjct: 61  CQPALYVHGLACLAVLKE--LVPSLNPVAAAGLSLGEFTAHAAAGTYSFEEGLRLVQKRG 118

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
             M+EA     G+M A+IG  D  V  +  +       ++AN N  GQ V+SG ++ V  
Sbjct: 119 AFMEEACNATKGTMAAMIGGTDENVIKLAQE----CDVDVANFNCPGQTVVSGTEEGVAK 174

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A       G K A  L V+  +HS LM      +   L +++   P +P+  N+ A  V 
Sbjct: 175 AVAGAKAAGCKIAKKLNVAGAYHSRLMYSAMVKLAEELKNISFGTPSMPVYCNYEARVVE 234

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
             D+I  +L  QV G VRW  ++Q   + G +   E+G GK L G+  RI K  + +SI 
Sbjct: 235 GPDDIRSMLEHQVCGSVRWTASMQKLVDQGHRLFIELGPGKTLAGMMARICKEATVISIE 294

Query: 301 KVEDIDLALRSI 312
            V  ++ A+  +
Sbjct: 295 DVPSLEAAVAEL 306


>gi|189463630|ref|ZP_03012415.1| hypothetical protein BACCOP_04354 [Bacteroides coprocola DSM 17136]
 gi|189429733|gb|EDU98717.1| hypothetical protein BACCOP_04354 [Bacteroides coprocola DSM 17136]
          Length = 295

 Score =  189 bits (480), Expect = 4e-46,   Method: Composition-based stats.
 Identities = 101/300 (33%), Positives = 146/300 (48%), Gaps = 7/300 (2%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M     FPGQG+Q +GMG+DLY++   A+ +FE+ +  L   ++D+M+NG+ E+L  T  
Sbjct: 1   MK-AFVFPGQGAQFVGMGKDLYENSALAKELFEKANDILGYRITDIMFNGTDEDLRQTKV 59

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVR-AR 119
            QP     ++    V+    +         AGHSLGE++AL AA A S  D ++LV    
Sbjct: 60  TQP-----AVFLHSVISALCMGDDFKPEMTAGHSLGEFSALVAAGALSFEDGLKLVYARA 114

Query: 120 GKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVK 179
               +            I   D+ V +     ++   +C  AN N  GQ+VISG  + + 
Sbjct: 115 MAMQKACEMQPSTMAAIIALPDEKVEEICAQVSAEGEVCVAANFNCPGQIVISGSIEGIN 174

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            A +     GAKRA+ L V   FHS LM P    ++  +++     P  PI  N  A P 
Sbjct: 175 KACELMKAAGAKRALPLKVGGAFHSPLMDPAKVELEAAINATEFHTPKCPIYQNVDAKPH 234

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
           +   EI   LV Q+T  VRW +T+Q     G     E G G VL GL K+IDK  +A  I
Sbjct: 235 TDPAEIKTNLVAQLTASVRWTQTVQNMIADGATDFTECGPGAVLQGLIKKIDKEANAHGI 294


>gi|218709017|ref|YP_002416638.1| malonyl CoA-acyl carrier protein transacylase [Vibrio splendidus
           LGP32]
 gi|218322036|emb|CAV18076.1| Malonyl CoA-acyl carrier protein transacylase [Vibrio splendidus
           LGP32]
          Length = 307

 Score =  189 bits (480), Expect = 4e-46,   Method: Composition-based stats.
 Identities = 121/307 (39%), Positives = 172/307 (56%), Gaps = 3/307 (0%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
              + FPGQGSQ IGM  DL + +   +  F E    L  +L  L+ +G  E L  T   
Sbjct: 3   KFAIVFPGQGSQAIGMLADLGEQYDVVKKTFAEASEALGYDLWALVQDGPVENLNETFRT 62

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPAL   S+A  RV ++ GL      + +AGHSLGEY+AL  A      + I+LV  RG+
Sbjct: 63  QPALLTASVAIWRVWQELGL---EQPANLAGHSLGEYSALVCAGVIDFKEAIKLVELRGQ 119

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCA 181
            MQEAVP G+G+M AIIGLDD  +   C +A++  +    N N  GQVVI+G + AV+ A
Sbjct: 120 LMQEAVPAGVGAMYAIIGLDDEAIAKACEEAAQDEVVSPVNFNSPGQVVIAGNKAAVERA 179

Query: 182 ADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSS 241
              C   GAKRA+ LPVS P H +LM P +  +   L+++    P +P++ N      + 
Sbjct: 180 GALCKEAGAKRALPLPVSVPSHCALMKPAADKLAVALEALEFNTPALPVINNVDVIAETD 239

Query: 242 IDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISK 301
             +I   LV Q+   VRW E +Q     GV+ + E+G GKVLTGL KRI K+++A +++ 
Sbjct: 240 PAKIKSALVRQLYSPVRWTEGVQAMNEQGVEKLLELGPGKVLTGLTKRIVKTMTAAAVND 299

Query: 302 VEDIDLA 308
              ++ A
Sbjct: 300 TASLEAA 306


>gi|306825801|ref|ZP_07459140.1| malonyl-CoA-[acyl-carrier-protein] transacylase [Streptococcus sp.
           oral taxon 071 str. 73H25AP]
 gi|304432162|gb|EFM35139.1| malonyl-CoA-[acyl-carrier-protein] transacylase [Streptococcus sp.
           oral taxon 071 str. 73H25AP]
          Length = 306

 Score =  189 bits (480), Expect = 4e-46,   Method: Composition-based stats.
 Identities = 116/308 (37%), Positives = 163/308 (52%), Gaps = 6/308 (1%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
            T   F GQG+Q IGMGRDLYD +P  +   ++    L  +L DL+ +  + +L  T   
Sbjct: 3   KTAFLFAGQGAQYIGMGRDLYDHYPIVKETIDQASQVLGYDLRDLI-DNDEAKLNQTRYT 61

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPA+ A S+A  R++++ G         VAG SLGEY+AL A+ A    D + LV  RG 
Sbjct: 62  QPAILATSVAIYRLLKEKGY----QPDMVAGLSLGEYSALVASGALDFEDAVALVAKRGA 117

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCA 181
            M+EA P G G MVA++     V++  C  AS+VG+   AN N   QVVI G   AV  A
Sbjct: 118 YMEEAAPAGSGKMVAVLNTPVEVIEEACETASKVGVVTPANYNTPSQVVIGGEVAAVDRA 177

Query: 182 ADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSS 241
            +     GAKR + L VS PFH++L+ P S+ +   L+ V+  D     L     + V  
Sbjct: 178 VELLQEAGAKRLIPLNVSGPFHTALLEPASQQLAGALEEVSFSD-FTCPLVGNTEATVME 236

Query: 242 IDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISK 301
            D I  LL  QV   VR+ E+I    + GV +  E+G GKVL+G  K+IDK+    ++  
Sbjct: 237 KDRIQELLTRQVKEPVRFYESIAVMQDAGVTNFIEIGPGKVLSGFVKKIDKTAQLANVED 296

Query: 302 VEDIDLAL 309
              +D  L
Sbjct: 297 QTSLDALL 304


>gi|299821770|ref|ZP_07053658.1| malonyl-CoA-[acyl-carrier-protein] transacylase [Listeria grayi DSM
           20601]
 gi|299817435|gb|EFI84671.1| malonyl-CoA-[acyl-carrier-protein] transacylase [Listeria grayi DSM
           20601]
          Length = 313

 Score =  189 bits (480), Expect = 4e-46,   Method: Composition-based stats.
 Identities = 130/314 (41%), Positives = 187/314 (59%), Gaps = 5/314 (1%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
                FPGQGSQ IGMG D+ + +PEA  +FE  D  L  +LS+L+  G  E+LT + NA
Sbjct: 3   KIAFVFPGQGSQKIGMGLDVAEKYPEAAAIFEAADKRLGFSLSELIQEGPIEKLTKSENA 62

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPAL   S A +RV+E +         YVAGHSLGEY+AL A       D I LV  RG+
Sbjct: 63  QPALVTNSTAILRVLEAH----AIKADYVAGHSLGEYSALVAGGYLKAEDAIYLVNKRGQ 118

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQAS-RVGICEIANDNGGGQVVISGLQDAVKC 180
            M+ AVP G G+M AI+GLD   + S+  + +      ++AN N  GQ+VISG    V+ 
Sbjct: 119 LMEAAVPNGQGAMAAILGLDRETLTSVTEEVTAGGDDVQLANLNCPGQIVISGSVAGVEK 178

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A++    KGAKRA+ L VS PFHS+LM P S+    +L  VT QD  +P++ N  A   +
Sbjct: 179 ASELAKEKGAKRAMPLAVSGPFHSTLMKPASEAFVPVLQEVTIQDGAIPVVANSNAEATT 238

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
           S D +++ L+EQ+   V W +T+++  + GV +  E+G+GKVL GL K+ID+ ++ +S  
Sbjct: 239 SSDTVAKNLIEQIYSPVLWEDTVRYLIDQGVDTFVEIGAGKVLAGLIKKIDRGVTVLSAG 298

Query: 301 KVEDIDLALRSIVG 314
            V  +D  + ++ G
Sbjct: 299 DVASVDTVIETLKG 312


>gi|322387206|ref|ZP_08060816.1| exopolyphosphatase [Streptococcus infantis ATCC 700779]
 gi|321141735|gb|EFX37230.1| exopolyphosphatase [Streptococcus infantis ATCC 700779]
          Length = 306

 Score =  189 bits (480), Expect = 4e-46,   Method: Composition-based stats.
 Identities = 110/310 (35%), Positives = 164/310 (52%), Gaps = 6/310 (1%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
            T   F GQG+Q +GMGR+LYD +   +   ++    L  +L DL+ +  + +L  T   
Sbjct: 3   KTAFLFAGQGAQYLGMGRELYDQYAIVKETIDQASQVLGYDLRDLI-DNDETKLNQTRYT 61

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPA+ A S+A  R++++ G         VAG SLGEY+AL A+ A    D + LV  RG 
Sbjct: 62  QPAILATSVAIYRLLKEKGY----QPDIVAGLSLGEYSALVASGALDFEDAVALVAKRGA 117

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCA 181
            M+EA P G G MVA++     V++  C +AS++G+   AN N   Q+VI G   AV  A
Sbjct: 118 YMEEAAPAGSGKMVAVLNTPVEVIEQACQEASQLGVVTPANYNTPSQIVIGGEVVAVDRA 177

Query: 182 ADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSS 241
            +     GAKR + L VS PFH++L+ P S+ +  +L+ V   D   P++ N  A     
Sbjct: 178 VELLQEAGAKRLIPLNVSGPFHTALLEPASQKLAQVLEDVEFNDFACPLVGNTEAKV-ME 236

Query: 242 IDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISK 301
            + I+ LL  QV   VR+ E+I      GV    E+G GKVL+G  K+IDK+    ++  
Sbjct: 237 KERIAELLTRQVKEPVRFYESIAVMQEAGVTRFIEIGPGKVLSGFVKKIDKTAQLANVED 296

Query: 302 VEDIDLALRS 311
              +   L +
Sbjct: 297 QASLQALLEN 306


>gi|116621716|ref|YP_823872.1| [Acyl-carrier-protein] S-malonyltransferase [Candidatus Solibacter
           usitatus Ellin6076]
 gi|116224878|gb|ABJ83587.1| [Acyl-carrier-protein] S-malonyltransferase [Candidatus Solibacter
           usitatus Ellin6076]
          Length = 310

 Score =  189 bits (480), Expect = 4e-46,   Method: Composition-based stats.
 Identities = 134/307 (43%), Positives = 178/307 (57%), Gaps = 4/307 (1%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
            T   FPGQGSQ  GMG+ L D+   AR VFEE D  L   LS L + G +++L  T N 
Sbjct: 4   KTAFLFPGQGSQAPGMGKALADTHAAARRVFEEADDALGFPLSRLCFEGPEDQLKLTENT 63

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPAL  VS+A   V+ + G        YVAGHSLGEY+AL AA +   +D +RLVR RG+
Sbjct: 64  QPALLTVSIAAFEVLRETGRV----PDYVAGHSLGEYSALVAAGSLRFADAVRLVRKRGQ 119

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCA 181
            MQEAVP G+G+M AI+ L +  +DSI A+A++  +   AN N   QVVI+G   AV  A
Sbjct: 120 YMQEAVPQGIGAMAAILKLPEGKLDSIIAEAAQGEVLSAANLNSPDQVVIAGHTGAVNRA 179

Query: 182 ADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSS 241
            +     GAKRA+ LPVSAPFH +LM P  + ++  LD+    D   P++ N+ A  + +
Sbjct: 180 CELAKAAGAKRAILLPVSAPFHCALMRPAQERLRADLDAAEFHDLTCPLVNNWQAREIRA 239

Query: 242 IDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISK 301
             E    L +QV   VRW ETI++ A  G     EVG+G VLTGL + ID  L  V   +
Sbjct: 240 AAEAREGLYQQVPNPVRWVETIRYLAGQGTAGFVEVGAGSVLTGLLRAIDPKLQGVKFGE 299

Query: 302 VEDIDLA 308
             D++  
Sbjct: 300 PADLEKL 306


>gi|78065706|ref|YP_368475.1| [Acyl-carrier-protein] S-malonyltransferase [Burkholderia sp. 383]
 gi|77966451|gb|ABB07831.1| [Acyl-carrier-protein] S-malonyltransferase [Burkholderia sp. 383]
          Length = 310

 Score =  189 bits (479), Expect = 5e-46,   Method: Composition-based stats.
 Identities = 135/310 (43%), Positives = 174/310 (56%), Gaps = 4/310 (1%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M     FPGQGSQ +GM     D     R   +E    LNQ+L  L+  G  E+L  T N
Sbjct: 1   MKFAFVFPGQGSQAVGMLNAFAD-LAIVRETVQEASDALNQDLGKLIAEGPVEDLNLTTN 59

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
            QP +   + A  R  ++ G       S VAGHSLGEYTAL AA A +  D + LVR R 
Sbjct: 60  TQPVMLTAAYACYRAWQQAGG---PAPSIVAGHSLGEYTALVAAGALAFKDAVPLVRFRA 116

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           ++MQ AVP G G M AI+GLDD  V ++CA+A+  G+ E  N N   QVVI+G + AV+ 
Sbjct: 117 QAMQTAVPVGQGGMAAILGLDDDTVRAVCAEAAEAGVVEAVNFNAPAQVVIAGNKAAVEK 176

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A +    KGAKRA+ LPVSAPFHSSL+ P S  ++  L +V  + P +P++ N   + V 
Sbjct: 177 ACEIAKAKGAKRALPLPVSAPFHSSLLKPASDQLRDYLANVDVKAPQIPVVNNIDVAVVG 236

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
               I   LV Q  G VRW E +Q  A  GV  V E G GKVL GL KRID +L+  S+ 
Sbjct: 237 DPAAIKDALVRQAAGPVRWVECVQHIAGTGVTHVIECGPGKVLAGLTKRIDSNLTGASVF 296

Query: 301 KVEDIDLALR 310
               +D AL+
Sbjct: 297 DPASLDEALK 306


>gi|115351052|ref|YP_772891.1| malonyl CoA-acyl carrier protein transacylase [Burkholderia
           ambifaria AMMD]
 gi|115281040|gb|ABI86557.1| [Acyl-carrier-protein] S-malonyltransferase [Burkholderia ambifaria
           AMMD]
          Length = 310

 Score =  189 bits (479), Expect = 5e-46,   Method: Composition-based stats.
 Identities = 137/310 (44%), Positives = 174/310 (56%), Gaps = 4/310 (1%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M     FPGQGSQ +GM     D     R   +E    LNQ++  L+  G  EEL  T N
Sbjct: 1   MKFAFVFPGQGSQSVGMLNAFAD-LAVVRETLQEASDALNQDIGKLIAEGPAEELNLTTN 59

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
            QP +   + A  R  ++ G       S VAGHSLGEYTAL AA A +  D + LVR R 
Sbjct: 60  TQPVMLTAAYACYRAWQQAGG---PAPSIVAGHSLGEYTALVAAGAIAFKDAVPLVRFRA 116

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           ++MQ AVP G G M AI+GLDD  V ++CA+A+  G+ E  N N   QVVI+G + AV+ 
Sbjct: 117 QAMQTAVPVGQGGMAAILGLDDDTVRAVCAEAAAAGVVEAVNFNAPAQVVIAGAKAAVEK 176

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A +    KGAKRA+ LPVSAPFHSSL+ P S  ++  L SV  + P +P++ N   + VS
Sbjct: 177 ACEIAKAKGAKRALPLPVSAPFHSSLLKPASDQLRDYLASVDVKAPQIPVVNNIDVAVVS 236

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
               I   LV Q  G VRW E +Q  A  GV  V E G GKVL GL KRID +L   S+ 
Sbjct: 237 DPAAIKDALVRQAAGPVRWVECVQHIAGTGVTHVIECGPGKVLAGLTKRIDGNLVGASVF 296

Query: 301 KVEDIDLALR 310
               +D AL+
Sbjct: 297 DPASLDEALK 306


>gi|322807924|emb|CBZ05499.1| malonyl CoA-acyl carrier protein transacylase [Clostridium
           botulinum H04402 065]
          Length = 314

 Score =  189 bits (479), Expect = 5e-46,   Method: Composition-based stats.
 Identities = 111/312 (35%), Positives = 172/312 (55%), Gaps = 4/312 (1%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
                F GQG+Q + MG+DLY++ PE R +F   +  L   L+ + + G ++E+  T N 
Sbjct: 3   KIAFIFSGQGAQYVSMGKDLYENIPECREIFNIAEEELQIPLTKICFQGPKDEIDKTENT 62

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPA+  +S+A ++ +EK G+         AG SLGEY+AL  +K     + + LVR RG+
Sbjct: 63  QPAILTLSIAAMKALEKYGI----KPDVTAGLSLGEYSALVCSKVIDFKEAVSLVRKRGQ 118

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCA 181
            M+ AVP G+G+M AIIGL    V  IC    +VGI EIAN N  GQ+VISG  +AV+ A
Sbjct: 119 YMEHAVPNGVGTMAAIIGLKKEKVKEICDGLKKVGIVEIANINCPGQIVISGEINAVEKA 178

Query: 182 ADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSS 241
            +    K A + V L VS PFHSS++    + +   L  +      VP + N     V +
Sbjct: 179 CEMAKEKRALKCVNLSVSGPFHSSMLKEAGENLYEELQKIRFNSIEVPFITNVTGDFVIN 238

Query: 242 IDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISK 301
             EI  LL +QV   V W  +I+   + GV +  E+G  KVL+G  K+ID+ ++ +++  
Sbjct: 239 TSEIKDLLKKQVMSTVLWEGSIKTMIDFGVDTFIEIGPSKVLSGFVKKIDRKVNILNVED 298

Query: 302 VEDIDLALRSIV 313
           ++ ++  +  + 
Sbjct: 299 IDSLNKTIEKLK 310


>gi|206971148|ref|ZP_03232099.1| malonyl CoA-acyl carrier protein transacylase [Bacillus cereus
           AH1134]
 gi|206733920|gb|EDZ51091.1| malonyl CoA-acyl carrier protein transacylase [Bacillus cereus
           AH1134]
          Length = 314

 Score =  189 bits (479), Expect = 5e-46,   Method: Composition-based stats.
 Identities = 122/314 (38%), Positives = 179/314 (57%), Gaps = 5/314 (1%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
                FPGQGSQ +GMG+ L ++  E   VF + D  L  +LS++++ G QE+LT T NA
Sbjct: 3   KIAFLFPGQGSQAVGMGKQLAENNKEVAKVFAKADEVLQDSLSEVIFEGPQEKLTLTTNA 62

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPAL   S A +  +++  +       +VAGHSLGEY+AL AA A +  D I  VR RG+
Sbjct: 63  QPALLTTSFAILTALKQYDIT----PDFVAGHSLGEYSALVAAGALTFEDAIYAVRKRGE 118

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQAS-RVGICEIANDNGGGQVVISGLQDAVKC 180
            M+EAVP G G+M AI+G D  ++  +  + +      +IAN N   Q+VISG +  V+ 
Sbjct: 119 YMEEAVPGGEGAMAAILGADPHMLKQVTEEVTSEGYAVQIANMNSTKQIVISGTKQGVEV 178

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A+      GAKRA+ L VS PFHSSLM P ++  + +L+ +T  D  +P++ N  A  ++
Sbjct: 179 ASQRAKENGAKRAIPLKVSGPFHSSLMKPAAEKFQSVLNEITIHDTNIPVIANVTADVIT 238

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
              +I   L+EQ+   V W  +I+     GV +  E+G GKVL GL K ID S+ A  I 
Sbjct: 239 RGADIQEKLIEQLYSPVLWYPSIECMVKQGVDTFIEIGPGKVLAGLMKSIDSSVKAYVIY 298

Query: 301 KVEDIDLALRSIVG 314
             E +   + ++ G
Sbjct: 299 DEETLKDTISNLRG 312


>gi|239831326|ref|ZP_04679655.1| malonyl CoA-acyl carrier protein transacylase [Ochrobactrum
           intermedium LMG 3301]
 gi|239823593|gb|EEQ95161.1| malonyl CoA-acyl carrier protein transacylase [Ochrobactrum
           intermedium LMG 3301]
          Length = 325

 Score =  189 bits (479), Expect = 5e-46,   Method: Composition-based stats.
 Identities = 176/301 (58%), Positives = 225/301 (74%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M+   TFPGQGSQ +GMG+ L + F EAR VFEEVD  L + LS  M+ G ++ LT T N
Sbjct: 12  MAVAFTFPGQGSQAVGMGKALAEQFAEARAVFEEVDAALGEKLSATMFEGPEDVLTLTAN 71

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
           AQPAL AVSMA +RVME  G  +K  +SYVAGHSLGEY+ALCAA  FSL+DT RL+R RG
Sbjct: 72  AQPALMAVSMAVLRVMEARGFSLKDKVSYVAGHSLGEYSALCAAGTFSLADTARLLRIRG 131

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
            +MQ+AVP G G+M AIIGL+   V+++CA+A   G  +IANDNGGGQ+VISG + AV+ 
Sbjct: 132 NAMQKAVPVGEGAMAAIIGLEHGDVEAVCAEAKSSGSVQIANDNGGGQLVISGSKAAVEL 191

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           AA     KGAKRA+ LPVSAPFHS+LM P +  M+  L SV K +P+VP++ N  A+P +
Sbjct: 192 AAGLASEKGAKRAIMLPVSAPFHSTLMGPAADAMREALASVEKHNPIVPLIANVRAAPAT 251

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
             +EI+ LLVEQVTG+VRWRET++WFA +GV ++YEVGSGKVLTGLA+RI K ++ V++ 
Sbjct: 252 DANEIADLLVEQVTGQVRWRETVEWFATNGVTTLYEVGSGKVLTGLARRISKDVAGVAVG 311

Query: 301 K 301
            
Sbjct: 312 S 312


>gi|269928566|ref|YP_003320887.1| malonyl CoA-acyl carrier protein transacylase [Sphaerobacter
           thermophilus DSM 20745]
 gi|269787923|gb|ACZ40065.1| malonyl CoA-acyl carrier protein transacylase [Sphaerobacter
           thermophilus DSM 20745]
          Length = 314

 Score =  189 bits (479), Expect = 5e-46,   Method: Composition-based stats.
 Identities = 112/301 (37%), Positives = 174/301 (57%), Gaps = 2/301 (0%)

Query: 3   TVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQ 62
               FPGQGSQ +GMG+ LY+    AR VF++ D  L   LS L ++G  EEL  T NAQ
Sbjct: 11  IAFVFPGQGSQYVGMGKALYEKSAAARKVFQQADEILGFPLSTLCFHGPTEELGDTINAQ 70

Query: 63  PALTAVSMAFIRVMEKNGLCVKRD--ISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
           PA+  VS+A++  + +    +  +   S+VAGHSLGE+TAL AA     +D + LVR RG
Sbjct: 71  PAILTVSLAYLEALRERWRSLNVNIVPSFVAGHSLGEFTALVAAGVLDFADALYLVRERG 130

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           + M+E      G M A++GLD   +++IC +AS VG   +ANDN  GQ VISG   A++ 
Sbjct: 131 RLMKECGDLQPGGMAAVLGLDRETLEAICEEASEVGTVVLANDNCPGQSVISGENAALER 190

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A +    +GA++ V L +S   HS LM   ++ +  +++ +  ++P VP++ N     ++
Sbjct: 191 AMELARQRGARKVVRLDISIASHSPLMERAAQQLAELVNKIPLREPQVPVVANISGRFMT 250

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
           ++DEI + +   V   V+W  +++  AN G  +  E+G G+VL GL +RI   +  +S  
Sbjct: 251 TVDEIRKEIAAHVVRPVQWTHSVREMANDGTAAFLEIGPGQVLGGLIRRIRSDVEVMSAK 310

Query: 301 K 301
            
Sbjct: 311 D 311


>gi|269959146|ref|YP_003328935.1| malonyl CoA-acyl carrier protein transacylase [Anaplasma centrale
           str. Israel]
 gi|269848977|gb|ACZ49621.1| malonyl CoA-acyl carrier protein transacylase [Anaplasma centrale
           str. Israel]
          Length = 325

 Score =  189 bits (479), Expect = 5e-46,   Method: Composition-based stats.
 Identities = 138/314 (43%), Positives = 187/314 (59%), Gaps = 1/314 (0%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           MS V  FPGQGSQ +GMGR++YDS P AR VF EVD TL + LS +++ G +E LT+TCN
Sbjct: 1   MSVVFMFPGQGSQFVGMGREVYDSSPAARRVFHEVDETLGRYLSRIIFQGPEEALTSTCN 60

Query: 61  AQPALTAVSMAFIRVMEKN-GLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRAR 119
           AQ AL  VS+A +R +E+N G  +   + YV GHS+GEYTAL  +K   L    RL+  R
Sbjct: 61  AQLALMTVSVALVRALEENLGGPITDAVKYVLGHSVGEYTALHVSKVIGLPGIARLLDVR 120

Query: 120 GKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVK 179
           GK+M  A     G M A+IG     V+++ A+AS  GICE+ANDN  GQVV+SG ++A++
Sbjct: 121 GKAMHRASALCCGGMAALIGGSLSEVEAVAARASEYGICEVANDNCTGQVVVSGTENALQ 180

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
                    G K+ + L VS PFHSSLM      +   +D +    P V ++ N  AS  
Sbjct: 181 QLPKLIEGTGIKKVIKLRVSGPFHSSLMRLACNEIGDFVDQLEMNPPEVEMVFNVSASTH 240

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
           S  + I  L+V QV  RVRWRE+I++    G     EVG G+VL GL KRID S+    +
Sbjct: 241 SDCNAIRDLMVRQVVSRVRWRESIEYLVRCGCSEFVEVGPGQVLVGLLKRIDNSVRGFGV 300

Query: 300 SKVEDIDLALRSIV 313
             +E +  +   I+
Sbjct: 301 DSMESVRASCSGIL 314


>gi|153939442|ref|YP_001392956.1| malonyl CoA-acyl carrier protein transacylase [Clostridium
           botulinum F str. Langeland]
 gi|152935338|gb|ABS40836.1| malonyl CoA-acyl carrier protein transacylase [Clostridium
           botulinum F str. Langeland]
 gi|295320933|gb|ADG01311.1| malonyl CoA-acyl carrier protein transacylase [Clostridium
           botulinum F str. 230613]
          Length = 314

 Score =  189 bits (479), Expect = 5e-46,   Method: Composition-based stats.
 Identities = 113/312 (36%), Positives = 172/312 (55%), Gaps = 4/312 (1%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
                F GQG+Q + MG+DLY++ PE R +F   D  L   L+ + + G + E+  T N 
Sbjct: 3   KIAFIFSGQGAQYVSMGKDLYENIPECREIFNIADEELQIPLTKICFQGPKYEIDKTENT 62

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPA+  +S+A ++ +EK G+         AG SLGEY+AL  +K     + + LVR RG+
Sbjct: 63  QPAILTLSIAAMKALEKYGI----KPDVTAGLSLGEYSALVCSKVIDFKEAVSLVRKRGQ 118

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCA 181
            M+ AVP G+G+MVAIIGL    V  IC    +VGI EIAN N  GQ+VISG  +AV+ A
Sbjct: 119 YMEHAVPNGVGTMVAIIGLKKEKVKEICDGLKKVGIVEIANINCPGQIVISGEINAVEKA 178

Query: 182 ADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSS 241
            +    K A + V L VS PFHSS++    + +   L  +      VP + N     V +
Sbjct: 179 CEMAKEKRALKCVNLSVSGPFHSSMLKEAGENLYEELQKIQFNSIEVPFITNVTGDFVIN 238

Query: 242 IDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISK 301
             EI  LL +QV   V W  +I+   + GV +  E+G  KVL+G  K+ID+ ++ +++  
Sbjct: 239 TSEIKDLLKKQVMSTVLWEGSIKTMIDFGVDTFIEIGPSKVLSGFVKKIDRKVNILNVED 298

Query: 302 VEDIDLALRSIV 313
           ++ ++  +  + 
Sbjct: 299 IDSLNKTIEKLK 310


>gi|306828949|ref|ZP_07462141.1| malonyl-CoA-[acyl-carrier-protein] transacylase [Streptococcus
           mitis ATCC 6249]
 gi|304429127|gb|EFM32215.1| malonyl-CoA-[acyl-carrier-protein] transacylase [Streptococcus
           mitis ATCC 6249]
          Length = 306

 Score =  189 bits (479), Expect = 5e-46,   Method: Composition-based stats.
 Identities = 112/308 (36%), Positives = 162/308 (52%), Gaps = 6/308 (1%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
            T   F GQG+Q +GMGRDLYD +P  +   ++    L  +L DL+ +  + +L  T   
Sbjct: 3   KTAFLFAGQGAQYLGMGRDLYDRYPIVKETIDQASQVLGYDLRDLI-DKEETKLNQTRYT 61

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPA+ A S+A  R++++ G         VAG SLGEY+AL A+ A    + + LV  RG 
Sbjct: 62  QPAILATSVAIYRLLKEKGYL----PDMVAGLSLGEYSALVASGALDFEEAVALVAKRGA 117

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCA 181
            M+EA P G G MVA++     V++  C  AS VGI   AN N   Q+VI G   AV  A
Sbjct: 118 YMEEAAPAGSGKMVAVLNTPVDVIEEACKTASEVGIVTPANYNTPSQIVIGGEVAAVDRA 177

Query: 182 ADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSS 241
                  GAKR + L VS PFH++L+ P S+ +   L+ ++  D     L     + +  
Sbjct: 178 VQLLQEAGAKRLIPLNVSGPFHTALLEPASQQLAGALEGISFSD-FNCPLVGNTEAAIME 236

Query: 242 IDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISK 301
            D I  LL  QV   VR+ E+I    + GV +  E+G GKVL+G  K+IDK+    ++  
Sbjct: 237 KDRIQELLTRQVKEPVRFYESIAVMQDAGVTNFIEIGPGKVLSGFVKKIDKTAQLANVED 296

Query: 302 VEDIDLAL 309
           +  +D  L
Sbjct: 297 LASLDALL 304


>gi|228909677|ref|ZP_04073500.1| Malonyl CoA-acyl carrier protein transacylase [Bacillus
           thuringiensis IBL 200]
 gi|228849966|gb|EEM94797.1| Malonyl CoA-acyl carrier protein transacylase [Bacillus
           thuringiensis IBL 200]
          Length = 314

 Score =  189 bits (479), Expect = 5e-46,   Method: Composition-based stats.
 Identities = 121/314 (38%), Positives = 181/314 (57%), Gaps = 5/314 (1%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
                FPGQGSQ +GMG+ L ++  E   VF + D  L  +LS++++ G QE+LT T NA
Sbjct: 3   KIAFLFPGQGSQAVGMGKKLAENNKEVAKVFAKADEVLQDSLSEVIFEGPQEKLTLTTNA 62

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPAL   S A +  +++  +      ++VAGHSLGEY+AL AA A +  D +  VR RG+
Sbjct: 63  QPALLTTSFAILTALKEYDIT----PNFVAGHSLGEYSALVAAGALTFEDAVYAVRKRGE 118

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQAS-RVGICEIANDNGGGQVVISGLQDAVKC 180
            M+EAVP G G+M AI+G D  ++  +  + +      +IAN N   Q+VISG +  V+ 
Sbjct: 119 YMEEAVPDGEGAMAAILGADLDMLKQVTEEVTSEGYAVQIANMNSTKQIVISGTKQGVEV 178

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A+      GAKRA+ L VS PFHSSLM P ++  + +L+ +T  D  +P++ N  A  ++
Sbjct: 179 ASQRAKENGAKRAIPLKVSGPFHSSLMKPAAEKFQSVLNEITIHDTNIPVIANVTADVIT 238

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
              +I   L+EQ+   V W  +I+     GV +  E+G GKVL GL K ID S+ A +I 
Sbjct: 239 RGADIQEKLIEQLYSPVLWYPSIECMVKQGVDTFIEIGPGKVLAGLMKSIDSSVKAYAIY 298

Query: 301 KVEDIDLALRSIVG 314
             E +   + ++ G
Sbjct: 299 DEETLKDTISNLRG 312


>gi|84517313|ref|ZP_01004667.1| acyl-carrier-protein S-malonyltransferase [Loktanella vestfoldensis
           SKA53]
 gi|84508793|gb|EAQ05256.1| acyl-carrier-protein S-malonyltransferase [Loktanella vestfoldensis
           SKA53]
          Length = 312

 Score =  189 bits (479), Expect = 5e-46,   Method: Composition-based stats.
 Identities = 153/309 (49%), Positives = 208/309 (67%), Gaps = 1/309 (0%)

Query: 4   VLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQP 63
              FPGQG+Q IGMGR L  ++P A+ VF+EVD  L +NLS L+W G  + LT T NAQP
Sbjct: 3   AFVFPGQGAQTIGMGRALAMAYPAAKAVFDEVDDALGENLSALIWEGDIDTLTLTQNAQP 62

Query: 64  ALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSM 123
           AL A S+A IR +E  G+ V     +VAGHSLGEY AL AA+A +++DT RL+R RG++M
Sbjct: 63  ALMATSLATIRALEAEGVDVTA-ARFVAGHSLGEYAALAAARALTIADTARLLRVRGRAM 121

Query: 124 QEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAAD 183
           Q+AVP G+G+M  ++GLD     ++  +A++  +CE ANDN  GQVV+SG + AV+ A +
Sbjct: 122 QDAVPVGVGAMAVLLGLDFDQARAVAEEAAQGEVCEAANDNDPGQVVVSGHKAAVERALE 181

Query: 184 TCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSID 243
               KGAKRA+ LPVSAPFH SLM P + VM   LD V+   PVV ++ N  A  VS   
Sbjct: 182 IAKLKGAKRAMLLPVSAPFHCSLMAPAADVMAQALDGVSITPPVVGLVANVLADVVSDPA 241

Query: 244 EISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVE 303
           +I +LLV QVTG VRWRE++ + A  GV  VYE+G+GK L+G+ KRI++ L+A +I   E
Sbjct: 242 QIRKLLVAQVTGSVRWRESVAFMAAQGVTHVYEIGAGKALSGMVKRINRDLAATAIGTPE 301

Query: 304 DIDLALRSI 312
           D+     ++
Sbjct: 302 DVVAMAAAL 310


>gi|312882460|ref|ZP_07742201.1| malonyl CoA-acyl carrier protein transacylase [Vibrio
           caribbenthicus ATCC BAA-2122]
 gi|309369860|gb|EFP97371.1| malonyl CoA-acyl carrier protein transacylase [Vibrio
           caribbenthicus ATCC BAA-2122]
          Length = 308

 Score =  189 bits (479), Expect = 6e-46,   Method: Composition-based stats.
 Identities = 120/307 (39%), Positives = 178/307 (57%), Gaps = 3/307 (0%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
              + FPGQGSQ +GM  +L + +   +  F+E    L  +L  L+ NG  E+L  T   
Sbjct: 3   KFAIVFPGQGSQSVGMLAELGEQYNVVKQTFDEASDVLGYDLWALVQNGPVEDLNQTFRT 62

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPAL   S+A  RV ++ G       + +AGHSLGEY+AL  A      + ++LV  RG+
Sbjct: 63  QPALLTASVAIWRVWQELGF---EQPANLAGHSLGEYSALVCAGVVDFREAVKLVELRGR 119

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCA 181
            MQEAVP G G+M AIIGL D ++   C++A++  +    N N  GQVVI+G +DAV+ A
Sbjct: 120 LMQEAVPSGTGAMYAIIGLSDDLIAKACSEAAQDDVVSPVNYNSPGQVVIAGSKDAVERA 179

Query: 182 ADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSS 241
           A  C   GAKRA+ LPVS P H +LM P +  +   L+++  + P +P++ N      + 
Sbjct: 180 AILCKEAGAKRALPLPVSVPSHCALMKPAADKLAMALETIEFKLPNLPVINNVDVIAETD 239

Query: 242 IDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISK 301
            ++I   LV Q+   VRW E+++  A   V+ + E+G GKVLTGL KRI K+LS  +++ 
Sbjct: 240 PEKIKDALVRQLYSPVRWTESVELMAQQDVEKLLELGPGKVLTGLTKRIVKTLSGAAVND 299

Query: 302 VEDIDLA 308
           V  ++ A
Sbjct: 300 VTSLEAA 306


>gi|289168514|ref|YP_003446783.1| predicted FabD (acyl-carrier-protein) S-malonyltransferase
           [Streptococcus mitis B6]
 gi|288908081|emb|CBJ22921.1| predicted FabD (acyl-carrier-protein) S-malonyltransferase
           [Streptococcus mitis B6]
          Length = 307

 Score =  189 bits (479), Expect = 6e-46,   Method: Composition-based stats.
 Identities = 111/310 (35%), Positives = 165/310 (53%), Gaps = 6/310 (1%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
            T   F GQG+Q +GMGRDLYD +P  +   ++    L  +L  L+ +  + +L  T   
Sbjct: 3   KTAFLFAGQGAQYLGMGRDLYDHYPIVKETIDQASQVLGYDLRHLI-DREEAKLNQTRYT 61

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPA+ A S+A  R++++ G         VAG SLGEY+AL A+ A    D + LV  RG 
Sbjct: 62  QPAILATSVAIYRLLQEKGY----QPDMVAGLSLGEYSALVASGALDFEDAVALVAKRGA 117

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCA 181
            M+EA P G G MVA++     V++ +C +AS +G+   AN N   Q+VI G   AV  A
Sbjct: 118 YMEEAAPAGSGKMVAVLNTPVEVIEEVCRKASELGVVTPANYNTPAQIVIGGEVVAVDRA 177

Query: 182 ADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSS 241
            +     GAKR + L VS PFH++L+ P S+ +   L  V+  D     L     + V  
Sbjct: 178 VELLQEAGAKRLIPLKVSGPFHTALLEPASQKLAETLAQVSFSD-FTCPLVGNTEATVMK 236

Query: 242 IDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISK 301
            ++I+RLL  QV   VR+ E+I      GV +  E+G GKVL+G  K+IDK+    ++  
Sbjct: 237 KEDIARLLTRQVKEPVRFYESIAVMQEAGVTNFIEIGPGKVLSGFVKKIDKTAKLANVED 296

Query: 302 VEDIDLALRS 311
              ++  L +
Sbjct: 297 QASLETLLEN 306


>gi|293374590|ref|ZP_06620907.1| [acyl-carrier-protein] S-malonyltransferase [Turicibacter sanguinis
           PC909]
 gi|292646792|gb|EFF64785.1| [acyl-carrier-protein] S-malonyltransferase [Turicibacter sanguinis
           PC909]
          Length = 309

 Score =  189 bits (479), Expect = 6e-46,   Method: Composition-based stats.
 Identities = 100/311 (32%), Positives = 169/311 (54%), Gaps = 6/311 (1%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
                F GQG+Q +GMG+ LY+  P AR +F + +  L+ +L +L +  SQ  +  T   
Sbjct: 3   KVAFLFSGQGAQYVGMGKSLYEQNPTARQLFNQANDLLSFDLKELCFEDSQNLINQTAYT 62

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPA+  +S   +  +++ G+        VAG SLGEY+ALCAA  FS ++ + LV  RG+
Sbjct: 63  QPAIFTISQMALATLKEAGI----KPDVVAGFSLGEYSALCAADVFSFTEGVELVAKRGE 118

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCA 181
            M  A   G  + +  + ++     ++C++AS  G+ E+AN N  GQ+VI G  +AV  A
Sbjct: 119 LMGVASGDGKMAALLGLDVE--KATALCSEASSKGVVELANLNCPGQIVIGGEAEAVNYA 176

Query: 182 ADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSS 241
            +     GAKRA+ LPVS PFH+SL+   ++    +L       P +PI+ N        
Sbjct: 177 CELAKGYGAKRALILPVSGPFHTSLLKETAQNFGQLLKMKNLNQPKLPIILNVLGDFYHH 236

Query: 242 IDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISK 301
              +  L+++Q+   V+W  +I+     GV +  E+G GK L+G  K+ID+S+  +++  
Sbjct: 237 DLSLIDLMIKQMATSVKWEASIKKMIEDGVDTFIEIGPGKTLSGFVKKIDRSVKILNVED 296

Query: 302 VEDIDLALRSI 312
           V  ++  ++++
Sbjct: 297 VASLEATIKAL 307


>gi|126728805|ref|ZP_01744620.1| acyl-carrier-protein S-malonyltransferase [Sagittula stellata E-37]
 gi|126710735|gb|EBA09786.1| acyl-carrier-protein S-malonyltransferase [Sagittula stellata E-37]
          Length = 313

 Score =  188 bits (478), Expect = 6e-46,   Method: Composition-based stats.
 Identities = 158/314 (50%), Positives = 209/314 (66%), Gaps = 1/314 (0%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M+    FPGQG+Q IGMGRDL +++P AR VF+EVD  LN+ LS L+W G Q+ LT T N
Sbjct: 1   MTRAFIFPGQGAQTIGMGRDLAEAYPAARAVFDEVDAALNEKLSALIWEGDQDTLTLTEN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
           AQPAL A S+A +R +E  G+ ++   SYVAGHSLGEYTAL AA A ++SD  RL+RARG
Sbjct: 61  AQPALMATSIAALRALEAEGVSIEA-ASYVAGHSLGEYTALTAAGALTVSDAARLLRARG 119

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           K+MQ AVP G G+M AI+GLD   V  + A+A+   +   ANDN   QVVISG + AV+ 
Sbjct: 120 KAMQAAVPVGKGAMAAILGLDLAAVRGVVAEAAEGEVLAAANDNDPSQVVISGAKAAVER 179

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A +    KGAKRAV LPVSAPFH  LM P + +M   LD V   +P VP++ N  AS V+
Sbjct: 180 AVEIAKTKGAKRAVLLPVSAPFHCDLMGPAADIMAEALDDVNIDEPKVPLVANVRASAVT 239

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
            +  I  LLVEQV G VRWRE++++    GV   +E+G+GK L+G+ +RID+S +  +I 
Sbjct: 240 DVTLIRNLLVEQVCGAVRWRESVEYMVGKGVTEFWEIGAGKALSGMVRRIDRSAAVRNIG 299

Query: 301 KVEDIDLALRSIVG 314
              ++  A  S+ G
Sbjct: 300 TAAEVAAAAASVKG 313


>gi|229019048|ref|ZP_04175888.1| Malonyl CoA-acyl carrier protein transacylase [Bacillus cereus
           AH1273]
 gi|229025294|ref|ZP_04181713.1| Malonyl CoA-acyl carrier protein transacylase [Bacillus cereus
           AH1272]
 gi|228735985|gb|EEL86561.1| Malonyl CoA-acyl carrier protein transacylase [Bacillus cereus
           AH1272]
 gi|228742250|gb|EEL92410.1| Malonyl CoA-acyl carrier protein transacylase [Bacillus cereus
           AH1273]
          Length = 314

 Score =  188 bits (478), Expect = 6e-46,   Method: Composition-based stats.
 Identities = 124/314 (39%), Positives = 181/314 (57%), Gaps = 5/314 (1%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
                FPGQGSQ +GMGR L ++  E   VF + D  L  +LS++++ G QE+LT T NA
Sbjct: 3   KLAFLFPGQGSQAVGMGRQLAENNNEVAKVFAKADEVLQDSLSEVIFEGPQEKLTLTTNA 62

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPAL   S A +  + +  +       +VAGHSLGEY+AL AA A +  D +  VR RG+
Sbjct: 63  QPALLTTSFAILTALNEYDIT----PDFVAGHSLGEYSALVAAGALTFEDAVYAVRKRGE 118

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQAS-RVGICEIANDNGGGQVVISGLQDAVKC 180
            M+EAVP G G+M AI+G D  ++  +  + +      +IAN N   Q+VISG    V+ 
Sbjct: 119 YMEEAVPGGEGAMAAILGADPEMLKQVTEEVTSEGYAVQIANMNSTKQIVISGTNQGVEL 178

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A+      GAKRA+ L VS PFHSSLM P ++  + +L+ +T QD  +P++ N  A  ++
Sbjct: 179 ASQRAKENGAKRAIPLKVSGPFHSSLMKPAAERFQSVLNEITIQDTNIPVIANVTADVIT 238

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
              +I   L+EQ+   V W  +I++  N GV +  E+G GKVL GL K ID S+ A +I 
Sbjct: 239 RGTDIKEKLIEQLYSPVLWYPSIEYMVNQGVDTFIEIGPGKVLAGLMKSIDSSVKAYAIY 298

Query: 301 KVEDIDLALRSIVG 314
             E +   + ++ G
Sbjct: 299 DEETLKDTISNLRG 312


>gi|90021275|ref|YP_527102.1| [Acyl-carrier-protein] S-malonyltransferase [Saccharophagus
           degradans 2-40]
 gi|89950875|gb|ABD80890.1| [Acyl-carrier-protein] S-malonyltransferase [Saccharophagus
           degradans 2-40]
          Length = 314

 Score =  188 bits (478), Expect = 6e-46,   Method: Composition-based stats.
 Identities = 126/317 (39%), Positives = 182/317 (57%), Gaps = 8/317 (2%)

Query: 1   MST----VLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELT 56
           MST       FPGQGSQ +GM  D Y      +  F+E    L  +L  L+ +G+Q+EL 
Sbjct: 1   MSTTANLAFVFPGQGSQKVGMLADFYQEGSVFKQTFDEAQAALGYDLWALIQSGTQDELN 60

Query: 57  ATCNAQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLV 116
            T   QPAL A S+A  R  +  G       +Y++GHSLGE++AL  A   +  D +RLV
Sbjct: 61  MTEVTQPALLACSVALWRKWQAEGGA---QPAYMSGHSLGEWSALVCAGVVAFEDALRLV 117

Query: 117 RARGKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASR-VGICEIANDNGGGQVVISGLQ 175
           R+RGK MQEAVP G+G+M AIIGLDD  V++ CA A+    I    N N  GQ+VI+G++
Sbjct: 118 RSRGKYMQEAVPAGVGAMAAIIGLDDAAVEAACATAAEGGDIVSPVNYNSPGQLVIAGMK 177

Query: 176 DAVKCAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFC 235
             V+ A + C   GAKRA+ LPVSAPFH++LM P +  +   +++V    P++P++ N  
Sbjct: 178 AGVEKAMELCKEAGAKRALPLPVSAPFHTALMKPAADKLAAEVEAVEFNAPLIPVVHNVT 237

Query: 236 ASPVSSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLS 295
           A   +  + I  L+++Q++  V W + +      GV+   E G GKVL+GL KRI KSL+
Sbjct: 238 AKTEADANTIKALMIQQISAPVLWVDCVNELVALGVEKTVECGPGKVLSGLNKRIQKSLA 297

Query: 296 AVSISKVEDIDLALRSI 312
             +    +    AL + 
Sbjct: 298 VSATETTDLFAEALANA 314


>gi|307708246|ref|ZP_07644713.1| malonyl CoA-acyl carrier protein transacylase [Streptococcus mitis
           NCTC 12261]
 gi|307615692|gb|EFN94898.1| malonyl CoA-acyl carrier protein transacylase [Streptococcus mitis
           NCTC 12261]
          Length = 306

 Score =  188 bits (478), Expect = 6e-46,   Method: Composition-based stats.
 Identities = 110/308 (35%), Positives = 163/308 (52%), Gaps = 6/308 (1%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
            T   F GQG+Q +GMGRDLYD +P  +   ++    L  +L  L+ +  +E+L  T   
Sbjct: 3   KTAFLFAGQGAQYLGMGRDLYDHYPIVKETIDQASQVLGYDLRHLI-DREEEKLNQTRYT 61

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPA+ A S+A  R++++ G         VAG SLGEY+AL A+ A    D + LV  RG 
Sbjct: 62  QPAILATSVAIYRLLQEKGY----QPDMVAGLSLGEYSALVASGALDFEDAVALVAKRGA 117

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCA 181
            M+EA P G G MVA++     V++  C +AS +G+   AN N   Q+VI G   AV  A
Sbjct: 118 YMEEAAPAGSGKMVAVLNTPVEVIEEACQKASELGVVTPANYNTPAQIVIGGEVVAVDRA 177

Query: 182 ADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSS 241
            +     GAKR + L VS PFH++L+   S+ +   L  V+  D     L     + V  
Sbjct: 178 VELLQEAGAKRLIPLKVSGPFHTALLESASQKLAETLAQVSFSD-FTCPLVGNTEAAVMQ 236

Query: 242 IDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISK 301
            ++I++LL  QV   VR+ E+I      GV +  E+G GKVL+G  K+IDK+    ++  
Sbjct: 237 KEDIAQLLTRQVKEPVRFYESIAVMQEAGVTNFIEIGPGKVLSGFVKKIDKTAKLANVED 296

Query: 302 VEDIDLAL 309
              ++  L
Sbjct: 297 QASLEALL 304


>gi|156934422|ref|YP_001438338.1| hypothetical protein ESA_02253 [Cronobacter sakazakii ATCC BAA-894]
 gi|156532676|gb|ABU77502.1| hypothetical protein ESA_02253 [Cronobacter sakazakii ATCC BAA-894]
          Length = 309

 Score =  188 bits (478), Expect = 6e-46,   Method: Composition-based stats.
 Identities = 128/312 (41%), Positives = 177/312 (56%), Gaps = 4/312 (1%)

Query: 1   MS-TVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATC 59
           M+     FPGQGSQ +GM  D+  +FP     F E    L  +L  L+  G  EEL  T 
Sbjct: 1   MTQFAFVFPGQGSQAVGMLSDMAANFPVIEATFREASAALGYDLWALVQQGPAEELNKTW 60

Query: 60  NAQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRAR 119
             QPAL   S+A  RV ++ G       + +AGHSLGEY+AL  A     +D +RLV  R
Sbjct: 61  QTQPALLTASVALWRVWQEQGGKA---PALMAGHSLGEYSALVCAGVIGFADAVRLVELR 117

Query: 120 GKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVK 179
           GK MQEAVP G G+M AIIGLDD  +   C +A+   +    N N  GQVVI+G ++AV+
Sbjct: 118 GKFMQEAVPEGTGAMAAIIGLDDDAIAKACEEAAEGQVVSPVNFNSPGQVVIAGHKEAVE 177

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            A   C   GAKRA+ LPVS P H +LM P ++ +   L+ +T   P +P++ N      
Sbjct: 178 RAGAACKAAGAKRALPLPVSVPSHCALMKPAAEKLAAELEKITFNAPQIPVVNNVDVKCE 237

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
           +S + I   LV Q+   V+W +++++ A  GV  +YEVG GKVLTGL KRI  +L+A +I
Sbjct: 238 TSPEAIRDALVRQLYSPVQWTKSVEFIAAQGVTQLYEVGPGKVLTGLTKRIVDTLTAAAI 297

Query: 300 SKVEDIDLALRS 311
           ++   +  AL  
Sbjct: 298 NEPASLSAALAQ 309


>gi|83591755|ref|YP_425507.1| [Acyl-carrier-protein] S-malonyltransferase [Rhodospirillum rubrum
           ATCC 11170]
 gi|83574669|gb|ABC21220.1| [Acyl-carrier-protein] S-malonyltransferase [Rhodospirillum rubrum
           ATCC 11170]
          Length = 312

 Score =  188 bits (478), Expect = 6e-46,   Method: Composition-based stats.
 Identities = 168/312 (53%), Positives = 211/312 (67%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M+    FPGQGSQ +GMG++L D+FP AR VF+EVD  L+Q L  LM  G  +ELT T N
Sbjct: 1   MTRAFVFPGQGSQAVGMGKELADAFPAARDVFQEVDDALSQKLFALMVEGPADELTLTQN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
           AQPAL AVSMA +RV+E  G+ +      VAGHSLGEY+AL AA A  L+DT RL+R RG
Sbjct: 61  AQPALMAVSMAVVRVLETGGVRLAAHADLVAGHSLGEYSALAAAGALGLADTARLLRIRG 120

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           ++MQ+AVP GLG+M A+IGL      S+ A+A+   ICE ANDN  GQVVISG + A++ 
Sbjct: 121 EAMQKAVPVGLGAMAALIGLSLEDARSVAAEAAEGEICEAANDNAPGQVVISGHRTAIER 180

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A      KG KRA+ LPVSAPFH +LM P ++VM   L+ VT + P VP++ N  AS VS
Sbjct: 181 AIVLAKAKGCKRALPLPVSAPFHCALMAPAAEVMAEALERVTFKAPAVPLVANVTASAVS 240

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
              EI RLLVEQVTG VRWRE++ +  + GV  + E+G+GKVL GLAKRI   L A SI 
Sbjct: 241 DPLEIRRLLVEQVTGAVRWRESVLYMVDAGVSELVELGAGKVLGGLAKRIHGDLGARSIQ 300

Query: 301 KVEDIDLALRSI 312
              DID  ++ I
Sbjct: 301 GPADIDAFIKGI 312


>gi|325845207|ref|ZP_08168514.1| [acyl-carrier-protein] S-malonyltransferase [Turicibacter sp. HGF1]
 gi|325488751|gb|EGC91153.1| [acyl-carrier-protein] S-malonyltransferase [Turicibacter sp. HGF1]
          Length = 309

 Score =  188 bits (478), Expect = 6e-46,   Method: Composition-based stats.
 Identities = 100/311 (32%), Positives = 169/311 (54%), Gaps = 6/311 (1%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
                F GQG+Q +GMG+ LY+  P AR +F + +  L+ +L +L +  SQ  +  T   
Sbjct: 3   KVAFLFSGQGAQYVGMGKSLYEQNPTARQLFNQANDLLSFDLKELCFEDSQNLINQTAYT 62

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPA+  +S   +  +++ G+        VAG SLGEY+ALCAA  FS ++ + LV  RG+
Sbjct: 63  QPAIFTISQMALATLKEAGI----KPDVVAGFSLGEYSALCAADVFSFTEGVELVAKRGE 118

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCA 181
            M  A   G  + +  + ++     ++C++AS  G+ E+AN N  GQ+VI G  +AV  A
Sbjct: 119 LMGVASGDGKMAALLGLDVE--KATALCSEASSKGVVELANLNCPGQIVIGGEAEAVNYA 176

Query: 182 ADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSS 241
            +     GAKRA+ LPVS PFH+SL+   ++    +L       P +PI+ N        
Sbjct: 177 CELAKGYGAKRALILPVSGPFHTSLLKETAQNFGQLLKMKNLNQPKLPIVLNVLGDFYHH 236

Query: 242 IDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISK 301
              +  L+++Q+   V+W  +I+     GV +  E+G GK L+G  K+ID+S+  +++  
Sbjct: 237 DLSLIDLMIKQMATSVKWEASIKKMIEDGVDTFIEIGPGKTLSGFVKKIDRSVKILNVED 296

Query: 302 VEDIDLALRSI 312
           V  ++  ++++
Sbjct: 297 VASLEATIKAL 307


>gi|326403717|ref|YP_004283799.1| malonyl CoA-acyl carrier protein transacylase [Acidiphilium
           multivorum AIU301]
 gi|325050579|dbj|BAJ80917.1| malonyl CoA-acyl carrier protein transacylase [Acidiphilium
           multivorum AIU301]
          Length = 319

 Score =  188 bits (478), Expect = 6e-46,   Method: Composition-based stats.
 Identities = 153/318 (48%), Positives = 204/318 (64%), Gaps = 6/318 (1%)

Query: 1   MST-VLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATC 59
           M+     FPGQGSQV+GMGRDL  +F  AR VFEEVD  L Q LS LM+ G  EELT T 
Sbjct: 1   MAVNAFIFPGQGSQVVGMGRDLAAAFAPAREVFEEVDEVLKQKLSRLMFEGPAEELTLTE 60

Query: 60  NAQPALTAVSMAFIRVME-KNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRA 118
           NAQPAL A+S+A +R +E + G+ +    + VAGHSLGEY+AL AA  F+L+D  RL+R 
Sbjct: 61  NAQPALMAMSIAVLRCLEKEAGIRIADRAAVVAGHSLGEYSALAAAGTFALADAARLLRI 120

Query: 119 RGKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICE----IANDNGGGQVVISGL 174
           RG +MQ+AVPPGLG+M A++G++    +SIC +A+          +ANDNGGGQVVISG 
Sbjct: 121 RGNAMQKAVPPGLGAMAALLGVELDAAESICTEAAEGPDGHEVVSVANDNGGGQVVISGT 180

Query: 175 QDAVKCAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNF 234
             AV  A +    +G KRA+ LPVSAPFH +LM P ++ M+  L  V    PVVP++ N 
Sbjct: 181 ATAVDRAIEIARGRGVKRALKLPVSAPFHCALMAPAAEAMREALAGVAVNAPVVPLIANV 240

Query: 235 CASPVSSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSL 294
            A+ V+   +I   LVEQVT  VRWRE++      GV    E+G+GKVL+GLA+RI    
Sbjct: 241 TAAKVTDPADIVAKLVEQVTAPVRWRESVATMTALGVTRFIELGAGKVLSGLARRIAPDA 300

Query: 295 SAVSISKVEDIDLALRSI 312
            A+S     +++   + +
Sbjct: 301 EALSCGTPAELEELAKHV 318


>gi|312897524|ref|ZP_07756944.1| malonyl CoA-acyl carrier protein transacylase [Megasphaera
           micronuciformis F0359]
 gi|310621376|gb|EFQ04916.1| malonyl CoA-acyl carrier protein transacylase [Megasphaera
           micronuciformis F0359]
          Length = 313

 Score =  188 bits (478), Expect = 6e-46,   Method: Composition-based stats.
 Identities = 126/315 (40%), Positives = 181/315 (57%), Gaps = 5/315 (1%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M     FPGQG+Q +GM +DLYDS+   R +FEE D  L  +L+ L + G  EEL  T N
Sbjct: 1   MKKAFVFPGQGAQKVGMVKDLYDSYASVRQLFEESDDALGFSLTKLCFEGPDEELMLTYN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
            QPA+   S A   V+++ G         VAGHSLGEY+AL AA +   +D +R VR RG
Sbjct: 61  TQPAILTASTACNLVLKEEGF----QPDIVAGHSLGEYSALVAAGSLDFTDAVRTVRLRG 116

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQA-SRVGICEIANDNGGGQVVISGLQDAVK 179
           + MQEAVP G G+M AI+GLD+  + SIC Q  ++    E  N N  GQ+VI+G   AV+
Sbjct: 117 QFMQEAVPLGEGAMAAILGLDEEKIKSICTQISTQGSTVEAVNFNCPGQIVIAGATKAVE 176

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            A ++    GAKRAV L VSAPFHS+LM P ++ +  +LD++T +D V+P++ N      
Sbjct: 177 QAVESMKEAGAKRAVMLNVSAPFHSTLMQPAAERLAEVLDTITIRDAVIPVVANVNGEIE 236

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
            +  +I   LV+Q    V W + +Q     G  +  EVG GK L G  ++IDK++ + + 
Sbjct: 237 RTAADIKASLVKQAASPVLWVKCVQTMQTFGADTFVEVGPGKTLCGFNRKIDKTIHSENT 296

Query: 300 SKVEDIDLALRSIVG 314
             +  +   +  + G
Sbjct: 297 EDIPSLKKTVDFLAG 311


>gi|322374863|ref|ZP_08049377.1| malonyl CoA-acyl carrier protein transacylase [Streptococcus sp.
           C300]
 gi|321280363|gb|EFX57402.1| malonyl CoA-acyl carrier protein transacylase [Streptococcus sp.
           C300]
          Length = 306

 Score =  188 bits (478), Expect = 7e-46,   Method: Composition-based stats.
 Identities = 114/308 (37%), Positives = 163/308 (52%), Gaps = 6/308 (1%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
            T   F GQG+Q +GMGRDLYD +P  +   ++    L  +L DL+ +  + +L  T   
Sbjct: 3   KTAFLFAGQGAQYLGMGRDLYDRYPIVKETIDQASQVLGYDLRDLI-DKEETKLNQTRYT 61

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPA+ A S+A  R++++ G         VAG SLGEY+AL A+ A    D + LV  RG 
Sbjct: 62  QPAILATSVAIYRLLKEKGY----QPDMVAGLSLGEYSALVASGALDFEDAVALVAKRGA 117

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCA 181
            M+EA P G G MVA++     V++  C  AS+VG+   AN N   Q+VI G   AV  A
Sbjct: 118 YMEEAAPAGSGKMVAVLNTPVEVIEEACETASKVGVVTPANYNTPSQIVIGGEVVAVDRA 177

Query: 182 ADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSS 241
            +     GAKR + L VS PFH++L+ P S+ +   L+ V+  D     L     + V  
Sbjct: 178 VELLQEAGAKRLIPLNVSGPFHTALLEPASQQLAGALEGVSFSD-FTCPLVGNTEAAVME 236

Query: 242 IDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISK 301
            D I  LL  QV   VR+ E+I    + GV +  E+G GKVL+G  K+IDK+    ++  
Sbjct: 237 KDRIQELLTRQVKEPVRFYESIAVMQDAGVTNFIEIGPGKVLSGFVKKIDKTAQLANVED 296

Query: 302 VEDIDLAL 309
              +D  L
Sbjct: 297 QASLDALL 304


>gi|198276731|ref|ZP_03209262.1| hypothetical protein BACPLE_02930 [Bacteroides plebeius DSM 17135]
 gi|198270256|gb|EDY94526.1| hypothetical protein BACPLE_02930 [Bacteroides plebeius DSM 17135]
          Length = 295

 Score =  188 bits (478), Expect = 7e-46,   Method: Composition-based stats.
 Identities = 101/300 (33%), Positives = 148/300 (49%), Gaps = 7/300 (2%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M     FPGQG+Q +GMG+DLY++ P A+ +FE+ +  L   ++D+M+ G+ E+L  T  
Sbjct: 1   MK-AFVFPGQGAQFVGMGKDLYENSPLAKELFEKANDILGYRITDIMFEGTDEDLRQTKV 59

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVR-AR 119
            QP     ++    V+    +         AGHSLGE++AL AA A S  D ++LV    
Sbjct: 60  TQP-----AVFLHSVISALCMGDAFQPEMTAGHSLGEFSALVAAGALSFEDGLKLVYARA 114

Query: 120 GKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVK 179
               +            I   D+ V +   + A+   +C  AN N  GQ+VISG  + + 
Sbjct: 115 MAMQKACEAQPSTMAAIIALPDEKVEEICASVAAEGEVCVAANYNCPGQIVISGSIEGIN 174

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            A +     GAKRA+ L V   FHS LM P    ++  +++     P  PI  N  A P 
Sbjct: 175 KACELMKAAGAKRALPLKVGGAFHSPLMDPAKVELEAAINATEFHTPKCPIYQNVDALPH 234

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
           +   EI + LV Q+T  VRW +T+Q     G     E G G VL GL K+I+K  +A  I
Sbjct: 235 TDPAEIKKNLVAQLTASVRWTQTVQQMIADGADDFTECGPGAVLQGLIKKINKDANAHGI 294


>gi|322377055|ref|ZP_08051547.1| malonyl CoA-acyl carrier protein transacylase [Streptococcus sp.
           M334]
 gi|321281768|gb|EFX58776.1| malonyl CoA-acyl carrier protein transacylase [Streptococcus sp.
           M334]
          Length = 307

 Score =  188 bits (478), Expect = 7e-46,   Method: Composition-based stats.
 Identities = 107/310 (34%), Positives = 162/310 (52%), Gaps = 6/310 (1%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
            T   F GQG+Q +GMGRDLYD +P  +   ++    L  +L  L+ +  +E+L  T   
Sbjct: 3   KTAFLFAGQGAQYLGMGRDLYDHYPIVKETIDQASQVLGYDLRHLI-DTEEEKLNQTRYT 61

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPA+ A S+A  R++++ G         VAG SLGEY+AL A+      D + LV  RG 
Sbjct: 62  QPAILATSVAIYRLLQEKGY----QPDMVAGLSLGEYSALVASGTLDFEDAVALVAKRGA 117

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCA 181
            M+EA P G G MVA +     V++ +C +AS +G+   AN N   Q+VI G   AV  A
Sbjct: 118 YMEEAAPAGSGKMVAALNTPVEVIEEVCRKASELGVVTPANYNTPAQIVIGGEVVAVDRA 177

Query: 182 ADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSS 241
            +     G+KR + L VS PFH++L+   S+ +   L  V+  D     L     + V  
Sbjct: 178 VELLQEAGSKRLIPLKVSGPFHTALLESASQKLAETLAQVSFSD-FTCPLVGNTEAAVMQ 236

Query: 242 IDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISK 301
            ++I++LL  QV   VR+ E+I      GV +  E+G GKVL+   K+IDK+    ++  
Sbjct: 237 KEDIAQLLTRQVKEPVRFYESIAVMQEAGVTNFIEIGPGKVLSSFVKKIDKTAKLANVED 296

Query: 302 VEDIDLALRS 311
              ++  L +
Sbjct: 297 QASLEALLEN 306


>gi|148260525|ref|YP_001234652.1| malonyl CoA-acyl carrier protein transacylase [Acidiphilium cryptum
           JF-5]
 gi|146402206|gb|ABQ30733.1| malonyl CoA-acyl carrier protein transacylase [Acidiphilium cryptum
           JF-5]
          Length = 319

 Score =  188 bits (478), Expect = 7e-46,   Method: Composition-based stats.
 Identities = 152/318 (47%), Positives = 203/318 (63%), Gaps = 6/318 (1%)

Query: 1   MST-VLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATC 59
           M+     FPGQGSQV+GMGRDL  +F  AR VFEEVD  L Q LS LM+ G  EELT T 
Sbjct: 1   MAVNAFIFPGQGSQVVGMGRDLAAAFAPAREVFEEVDEVLKQKLSRLMFEGPAEELTLTE 60

Query: 60  NAQPALTAVSMAFIRVME-KNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRA 118
           NAQPAL A+S+A +R +E + G+ +    + VAGHSLGEY+AL AA  F+L+D  RL+R 
Sbjct: 61  NAQPALMAMSIAVLRCLEKEAGIRIADRAAVVAGHSLGEYSALAAAGTFALADAARLLRI 120

Query: 119 RGKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICE----IANDNGGGQVVISGL 174
           RG +MQ+AVPPGLG+M A++G++    +SIC +A+          +ANDNGGGQVVISG 
Sbjct: 121 RGNAMQKAVPPGLGAMAALLGVELDAAESICTEAAEGPDGHEVVSVANDNGGGQVVISGT 180

Query: 175 QDAVKCAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNF 234
             AV  A +    +G KRA+ LPVSAPFH +LM P ++ M+  L  V    PVVP++ N 
Sbjct: 181 ATAVDRAIEIARGRGVKRALKLPVSAPFHCALMAPAAEAMREALAGVAVNAPVVPLIANV 240

Query: 235 CASPVSSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSL 294
            A+  +   +I   LVEQVT  VRWRE++      GV    E+G+GKVL+GLA+RI    
Sbjct: 241 TAAKATDPADIVAKLVEQVTAPVRWRESVATMTALGVTRFIELGAGKVLSGLARRIAPDA 300

Query: 295 SAVSISKVEDIDLALRSI 312
            A+S     +++   + +
Sbjct: 301 EALSCGTPAELEELAKHV 318


>gi|253688881|ref|YP_003018071.1| malonyl CoA-acyl carrier protein transacylase [Pectobacterium
           carotovorum subsp. carotovorum PC1]
 gi|251755459|gb|ACT13535.1| malonyl CoA-acyl carrier protein transacylase [Pectobacterium
           carotovorum subsp. carotovorum PC1]
          Length = 309

 Score =  188 bits (478), Expect = 7e-46,   Method: Composition-based stats.
 Identities = 127/311 (40%), Positives = 180/311 (57%), Gaps = 4/311 (1%)

Query: 1   MS-TVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATC 59
           M+   + FPGQGSQ +GM  +L   +P     F +    L  +L  L   G  EEL  T 
Sbjct: 1   MTQFAMVFPGQGSQTVGMLAELAAEYPIVTETFAQASEALGYDLWQLTQQGPAEELNKTW 60

Query: 60  NAQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRAR 119
             QPAL   S+A  RV ++ G    +  + ++GHSLGEY+AL  A        +RLV  R
Sbjct: 61  QTQPALLTASVAIWRVWQQQGG---KTPALMSGHSLGEYSALVCAGVLDFQQAVRLVELR 117

Query: 120 GKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVK 179
           GK MQEAVP G G+M AIIGLD+  +   C ++++  +    N N  GQVVI+G +DAV+
Sbjct: 118 GKLMQEAVPEGTGAMSAIIGLDNDAIAKACEESAQGQVVSPVNFNSPGQVVIAGNKDAVE 177

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            A   C   GAKRA+ LPVS P H +LM P +K +   L+SVT   PV+P++ N  AS  
Sbjct: 178 RAGAACKAAGAKRALPLPVSVPSHCALMEPAAKKLAVALESVTFNSPVIPVVNNVDASIE 237

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
           ++ + I   LV Q+   VRW + +++ A+ GV+S+ EVG GKVLTGL KRI  +L+A ++
Sbjct: 238 TTPEAIRDALVRQLYRPVRWTDCVEFMASQGVESLLEVGPGKVLTGLTKRIVDTLTAAAV 297

Query: 300 SKVEDIDLALR 310
           +    +  A+ 
Sbjct: 298 NDPASLSAAIE 308


>gi|332300869|ref|YP_004442790.1| malonyl CoA-acyl carrier protein transacylase [Porphyromonas
           asaccharolytica DSM 20707]
 gi|332177932|gb|AEE13622.1| malonyl CoA-acyl carrier protein transacylase [Porphyromonas
           asaccharolytica DSM 20707]
          Length = 296

 Score =  188 bits (478), Expect = 7e-46,   Method: Composition-based stats.
 Identities = 106/302 (35%), Positives = 159/302 (52%), Gaps = 6/302 (1%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M     FPGQGSQ +GMG+++Y      R +F E D  L  +LS  M+ G++E+L  T  
Sbjct: 1   MKKAFVFPGQGSQFVGMGQEIYTKSEAVRKLFAEADKVLGFDLSKTMFEGTEEDLKQTKV 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
            QPA+   S+A    + +           VAGHSLGE++AL A++A   +D +RLV  R 
Sbjct: 61  TQPAVFLHSVAMTVALGEAFA-----PDMVAGHSLGEFSALVASRALPFADALRLVSERA 115

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
            +MQ A      +M AIIGL D  ++    +     +   AN N  GQVVISG  + +  
Sbjct: 116 LAMQAACEAHPSTMAAIIGLPDDKIE-EVCRGISGQVVVPANYNCSGQVVISGTMEGIAE 174

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A +     GAKRA+ L V   FHS LM P  + ++  +++     P+ PI  N  A P +
Sbjct: 175 ACEQLKAAGAKRALPLKVGGAFHSPLMQPAKERLQRAIEATIFATPICPIYQNVDARPHT 234

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
            ++EI   L+ Q+T  VRW ++++     G     E+G GKVL GL  RI + ++  S++
Sbjct: 235 DVEEIKANLIAQLTAPVRWTKSVEAMVADGATHFVELGPGKVLAGLIGRIARDVTCESLA 294

Query: 301 KV 302
            +
Sbjct: 295 TI 296


>gi|270293318|ref|ZP_06199527.1| malonyl CoA-acyl carrier protein transacylase [Streptococcus sp.
           M143]
 gi|270278167|gb|EFA24015.1| malonyl CoA-acyl carrier protein transacylase [Streptococcus sp.
           M143]
          Length = 306

 Score =  188 bits (478), Expect = 7e-46,   Method: Composition-based stats.
 Identities = 114/308 (37%), Positives = 163/308 (52%), Gaps = 6/308 (1%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
            T   F GQG+Q +GMGRDLYD +P  +   ++    L  +L DL+ +  + +L  T   
Sbjct: 3   KTAFLFAGQGAQYLGMGRDLYDHYPIVKETIDQASQVLGYDLRDLI-DKEETKLNQTRYT 61

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPA+ A S+A  R++++ G         VAG SLGEY+AL A+ A    + + LV  RG 
Sbjct: 62  QPAILATSVAIYRLLKEKGY----QPDMVAGLSLGEYSALVASGALDFKEAVALVAKRGA 117

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCA 181
            M+EA P G G MVA++     V++  C  AS+VG+   AN N   Q+VI G   AV  A
Sbjct: 118 YMEEAAPAGSGKMVAVLNTPVEVIEEACETASKVGVVTPANYNTPSQIVIGGEVAAVDRA 177

Query: 182 ADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSS 241
            +     GAKR + L VS PFH++L+ P S+ +   L+ V+  D     L     + V  
Sbjct: 178 VELLQEAGAKRLIPLNVSGPFHTALLEPASQQLAGALEGVSFSD-FTCPLVGNTEATVME 236

Query: 242 IDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISK 301
            D I  LL  QV   VR+ E+I    N GV +  E+G GKVL+G  K+IDK+    ++  
Sbjct: 237 KDRIQELLTRQVKEPVRFYESIAVMQNAGVTNFIEIGPGKVLSGFVKKIDKTAKLANVED 296

Query: 302 VEDIDLAL 309
              +D  L
Sbjct: 297 QASLDALL 304


>gi|304409818|ref|ZP_07391438.1| malonyl CoA-acyl carrier protein transacylase [Shewanella baltica
           OS183]
 gi|307304174|ref|ZP_07583927.1| malonyl CoA-acyl carrier protein transacylase [Shewanella baltica
           BA175]
 gi|304352336|gb|EFM16734.1| malonyl CoA-acyl carrier protein transacylase [Shewanella baltica
           OS183]
 gi|306913072|gb|EFN43495.1| malonyl CoA-acyl carrier protein transacylase [Shewanella baltica
           BA175]
          Length = 308

 Score =  188 bits (478), Expect = 7e-46,   Method: Composition-based stats.
 Identities = 126/307 (41%), Positives = 170/307 (55%), Gaps = 3/307 (0%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
           +    FPGQGSQ +GM  +L +S       F E    L  +L  L+  G  E L  T   
Sbjct: 3   NVAFVFPGQGSQALGMLAELAESHAVVGQTFAEASDVLGYDLWALVQQGPVESLNETDKT 62

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPAL A S+A            K   + +AGHSLGEY+AL  A      D I+LV  RG+
Sbjct: 63  QPALLAASVAI---WRAYMASGKPMPAMLAGHSLGEYSALVCAGVMDFKDAIKLVELRGQ 119

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCA 181
            MQ+AVP G G+M AIIGLD+  + + CA+A++  +    N N  GQVVI+G +DAV+ A
Sbjct: 120 LMQQAVPAGTGAMYAIIGLDNEGIANACAEAAQGDVVSPVNFNSPGQVVIAGQKDAVERA 179

Query: 182 ADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSS 241
           A  C   GAK AV LPVS P H +LM P +  +   L+ V    P + ++ N   +  +S
Sbjct: 180 AAACKAAGAKMAVALPVSVPSHCALMKPAADKLAVALNDVQFNPPAITVINNVDVASPTS 239

Query: 242 IDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISK 301
            D+I   LV Q+   VRW ET++  A  G+  + E G GKVLTGLAKRI+KSLSA +++ 
Sbjct: 240 ADDIKDALVRQLYCPVRWSETVELMAQKGITQLVECGPGKVLTGLAKRINKSLSAQAVND 299

Query: 302 VEDIDLA 308
           V  +   
Sbjct: 300 VASLAAL 306


>gi|331005259|ref|ZP_08328651.1| Malonyl CoA-acyl carrier protein transacylase [gamma
           proteobacterium IMCC1989]
 gi|330420936|gb|EGG95210.1| Malonyl CoA-acyl carrier protein transacylase [gamma
           proteobacterium IMCC1989]
          Length = 309

 Score =  188 bits (478), Expect = 7e-46,   Method: Composition-based stats.
 Identities = 126/312 (40%), Positives = 171/312 (54%), Gaps = 7/312 (2%)

Query: 1   MST----VLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELT 56
           M+T       FPGQGSQ +GM  +L + +   +  F E    L  +L  L   G QE L 
Sbjct: 1   MTTVSTLAFIFPGQGSQKLGMLAELAEKYSIVQETFAEASTVLGYDLWQLSQQGPQEALN 60

Query: 57  ATCNAQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLV 116
            T   QP L A S+A  RV ++    +    + +AGHSLGE++AL  A   S +D IRLV
Sbjct: 61  MTERTQPLLLAASVAIWRVWQQEKTEL---PAVMAGHSLGEWSALVCAGVVSFTDAIRLV 117

Query: 117 RARGKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQD 176
           + RGK MQEAVP G+GSM AIIGLDD  + S C  A+   I    N N  GQVVI+G   
Sbjct: 118 QLRGKYMQEAVPSGVGSMAAIIGLDDESIVSACQTAAETEIVSAVNFNSPGQVVIAGHVG 177

Query: 177 AVKCAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCA 236
           AV  A   C  KGAK+A+ L VSAPFHS+L+ P +  +   + +V  Q P +P++ N  A
Sbjct: 178 AVDRAIAICKEKGAKKAMPLAVSAPFHSALLKPAADRLADEIANVEFQPPTIPVVHNVNA 237

Query: 237 SPVSSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSA 296
              +    I + ++EQ+   V W + +      GV    E G GKVL+GL KRID+S+ +
Sbjct: 238 QIEADPAMIKQRMIEQIYHPVLWVDCVNALLAQGVTKAVECGPGKVLSGLVKRIDRSIVS 297

Query: 297 VSISKVEDIDLA 308
           ++    E I  A
Sbjct: 298 IATDSPEAIAAA 309


>gi|157154947|ref|YP_001462324.1| malonyl CoA-acyl carrier protein transacylase [Escherichia coli
           E24377A]
 gi|157076977|gb|ABV16685.1| malonyl CoA-acyl carrier protein transacylase [Escherichia coli
           E24377A]
          Length = 309

 Score =  188 bits (478), Expect = 7e-46,   Method: Composition-based stats.
 Identities = 128/311 (41%), Positives = 175/311 (56%), Gaps = 4/311 (1%)

Query: 1   MS-TVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATC 59
           M+     FPGQGSQ +GM  D+  S+P     F E    L  +L  L   G  EEL  T 
Sbjct: 1   MTQFAFVFPGQGSQTVGMLADMAASYPIVEETFAEASAALGYDLWALTQQGPAEELNKTW 60

Query: 60  NAQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRAR 119
             QPAL   S+A  RV ++ G       + +AGHSLGEY+AL  A     +D +RLV  R
Sbjct: 61  QTQPALLTASVALYRVWQQQGGKA---PAMMAGHSLGEYSALVCAGVIDFADAVRLVEMR 117

Query: 120 GKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVK 179
           GK MQEAVP G G+M AIIGLDD  +   C +A+   +    N N  GQVVI+G ++AV+
Sbjct: 118 GKFMQEAVPEGTGAMAAIIGLDDASIAKACEEAAEGQVVSPVNFNSPGQVVIAGHKEAVE 177

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            A   C   GAKRA+ LPVS P H +LM P +  +   L  +T   P VP++ N      
Sbjct: 178 RAGAACKAVGAKRALPLPVSVPSHCALMKPAADKLAVELAKITFNAPTVPVVNNVDVKCE 237

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
           ++ D I   LV Q+   V+W +++++ A  GV+ +YEVG GKVLTGL KRI  +L+A ++
Sbjct: 238 TNGDAIRDALVRQLYNPVQWTKSVEYMAAQGVEHLYEVGPGKVLTGLTKRIVDTLTASAL 297

Query: 300 SKVEDIDLALR 310
           ++   +  AL 
Sbjct: 298 NEPSAMAAALE 308


>gi|186475594|ref|YP_001857064.1| malonyl CoA-acyl carrier protein transacylase [Burkholderia
           phymatum STM815]
 gi|184192053|gb|ACC70018.1| malonyl CoA-acyl carrier protein transacylase [Burkholderia
           phymatum STM815]
          Length = 310

 Score =  188 bits (478), Expect = 7e-46,   Method: Composition-based stats.
 Identities = 133/312 (42%), Positives = 170/312 (54%), Gaps = 4/312 (1%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M     FPGQGSQ +GM     D+    R   +E    LNQ++  L+  G  E+L  T N
Sbjct: 1   MKFAFVFPGQGSQAVGMLNAFADN-AIVRETLQEASDALNQDIGKLIAEGPAEDLNLTTN 59

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
            QP +   + A  R  +  G       + VAGHSLGEYTAL A  A    D + LVR R 
Sbjct: 60  TQPVMLTAAYAIFRAWQAAGG---PAPTIVAGHSLGEYTALVAGGALKFRDAVPLVRFRA 116

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           ++MQ AVP G G M AI+GLDD  V  +C +AS  G+ E  N N   QVVI+G + AV+ 
Sbjct: 117 QAMQNAVPVGQGGMAAILGLDDDTVREVCKEASAAGVVEAVNFNAPAQVVIAGHKAAVEK 176

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A +    KGAKRA+ LPVSAPFHSSL+ P S  ++  L SV  Q P +P++ N   + V+
Sbjct: 177 ACEVAKAKGAKRALPLPVSAPFHSSLLKPASDQLREYLASVDVQVPSIPVVNNVDVAIVN 236

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
               I   LV Q  G VRW E +Q  A  GV  V E G GKVL GL KRID +L   +I 
Sbjct: 237 EPAGIKDALVRQAAGAVRWVECVQSIAKQGVTHVIECGPGKVLAGLTKRIDANLVGAAIV 296

Query: 301 KVEDIDLALRSI 312
               +D  L+ +
Sbjct: 297 DPATLDEVLKVV 308


>gi|218960593|ref|YP_001740368.1| malonyl-CoA-[acyl-carrier-protein] transacylase [Candidatus
           Cloacamonas acidaminovorans]
 gi|167729250|emb|CAO80161.1| malonyl-CoA-[acyl-carrier-protein] transacylase [Candidatus
           Cloacamonas acidaminovorans]
          Length = 310

 Score =  188 bits (478), Expect = 7e-46,   Method: Composition-based stats.
 Identities = 107/311 (34%), Positives = 161/311 (51%), Gaps = 3/311 (0%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M T   FPGQGSQ +GM  D     P  + + +  D   N NL+++M +G +E L  T  
Sbjct: 1   MKTAFVFPGQGSQYVGMANDFIQKDPALKEILDNFDKAHNTNLAEVMASGPEETLKQTSY 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
            QP   A+    I  +       K    +VAGHSLGE++AL A++  +  + + LV  RG
Sbjct: 61  TQP---AILFHSISALYGFQNKSKLQADFVAGHSLGEFSALVASEMITFQEALHLVHKRG 117

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           + M +A      +M AIIGL+  +V  IC++A  VG+    N N   Q VISG  + V+ 
Sbjct: 118 EFMIKANAGVPFAMSAIIGLEPNLVKEICSEAESVGLVRAVNFNTPIQTVISGTAEGVQK 177

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A +    KGAKR + L V  PFH+ L+      +   +  V  +D  +P++ N  A PV 
Sbjct: 178 AGEIAKAKGAKRVIPLVVGGPFHTPLIDKAKDWLMEEMRKVDFKDGKIPVISNVTALPVM 237

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
           +  E   LL  Q+   V W +++Q+  + GV+   E G  KVL+G+ + I+K +   SI 
Sbjct: 238 NGQEERELLARQIVSPVLWVQSVQYMIDQGVQRFIEFGPQKVLSGMIRNINKDVEVFSID 297

Query: 301 KVEDIDLALRS 311
           K EDID  + +
Sbjct: 298 KYEDIDGVVSA 308


>gi|268589215|ref|ZP_06123436.1| malonyl CoA-acyl carrier protein transacylase [Providencia rettgeri
           DSM 1131]
 gi|291315471|gb|EFE55924.1| malonyl CoA-acyl carrier protein transacylase [Providencia rettgeri
           DSM 1131]
          Length = 310

 Score =  188 bits (478), Expect = 8e-46,   Method: Composition-based stats.
 Identities = 125/312 (40%), Positives = 171/312 (54%), Gaps = 4/312 (1%)

Query: 1   MS-TVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATC 59
           M+   + FPGQGSQ +GM   L +        F E    L  +L  L+ NG +EEL  T 
Sbjct: 1   MTQFAMVFPGQGSQSLGMLAALAEENQLVEQTFAEASEALGYDLWALVQNGPEEELNKTW 60

Query: 60  NAQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRAR 119
             QPAL A S+A  RV +          + +AGHSLGEY+AL  A        I+LV  R
Sbjct: 61  QTQPALLAASVAIFRVWKDK---NGAMPTMMAGHSLGEYSALVCAGVIDFKQAIKLVELR 117

Query: 120 GKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVK 179
           GK MQEAVP G G+M AIIGLD+  ++  C +A++  +    N N  GQVVI+G + AV+
Sbjct: 118 GKLMQEAVPEGTGAMYAIIGLDNESIEKACQEAAQGQVVSPVNFNSPGQVVIAGEKAAVE 177

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            A   C   GAKRA+ L VS P H +LM P +  +   L+ +   +P  P++ N      
Sbjct: 178 RAGIACKEAGAKRALPLSVSVPSHCALMKPAAVKLAEALEKIDFCEPDYPVINNVDVKIE 237

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
            S   I   LV Q+   VRW ET++  A+ GV+ + EVG GKVLTGL KRI  +L+AV++
Sbjct: 238 KSAQNIRDALVRQLYNPVRWTETVELMADQGVEHLIEVGPGKVLTGLTKRIVSNLTAVAV 297

Query: 300 SKVEDIDLALRS 311
           +    +  AL +
Sbjct: 298 NDPVSLSTALEN 309


>gi|167630232|ref|YP_001680731.1| malonyl CoA-acyl carrier protein transacylase [Heliobacterium
           modesticaldum Ice1]
 gi|167592972|gb|ABZ84720.1| malonyl CoA-acyl carrier protein transacylase [Heliobacterium
           modesticaldum Ice1]
          Length = 303

 Score =  188 bits (478), Expect = 8e-46,   Method: Composition-based stats.
 Identities = 125/304 (41%), Positives = 174/304 (57%), Gaps = 6/304 (1%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
            T+  FPGQGSQ +GMG DL   + EA  VF E D TL  +LS L + G +EEL  T N 
Sbjct: 3   KTLFMFPGQGSQFVGMGADLVRHYSEACQVFAEADDTLGFSLSRLCFEGPEEELRLTANT 62

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRAR-- 119
           QPAL AVS+A+ RV+   G        +VAGHSLGEY+AL AA + +L+D +RLVR R  
Sbjct: 63  QPALLAVSIAYFRVLAAKGW----KADWVAGHSLGEYSALVAAGSLTLADGLRLVRQRGL 118

Query: 120 GKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVK 179
                     G  + +  +  +        A  +  G+ E AN NG GQVVI+G + AV+
Sbjct: 119 FMQEAVPAGQGTMAAIMGLEAEAVEEVCRQAATALGGVVEPANFNGAGQVVIAGERLAVE 178

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            A +     GAKRA+ L VSAPFH SLM P ++ M  +L +    DPV+P++ N  A+PV
Sbjct: 179 KAMELAKVAGAKRALLLNVSAPFHCSLMRPAAERMAGLLRTAAIADPVIPLVANVTAAPV 238

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
              + +   L+ QV   VRW ++I++ A+ GV    EVG GKVL+GL ++I K    ++ 
Sbjct: 239 CDAERVRENLILQVDHPVRWEQSIRFLADQGVTRFVEVGPGKVLSGLVRKIAKGAEVLAA 298

Query: 300 SKVE 303
             ++
Sbjct: 299 GDIQ 302


>gi|299136310|ref|ZP_07029494.1| malonyl CoA-acyl carrier protein transacylase [Acidobacterium sp.
           MP5ACTX8]
 gi|298602434|gb|EFI58588.1| malonyl CoA-acyl carrier protein transacylase [Acidobacterium sp.
           MP5ACTX8]
          Length = 365

 Score =  188 bits (477), Expect = 8e-46,   Method: Composition-based stats.
 Identities = 136/350 (38%), Positives = 181/350 (51%), Gaps = 41/350 (11%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
              L FPGQGSQ +GMGR LYD+FP AR VFEE D  L   LS +++ G +EEL  T + 
Sbjct: 13  KIALLFPGQGSQTVGMGRALYDTFPAARAVFEEADDALGFALSKIIFEGPEEELKRTEHT 72

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPA+  VS+A +RV+E         I++ AGHSLGEY+A  AA  F  +D +R VR RG+
Sbjct: 73  QPAILTVSIAALRVLEPELKSRGLSIAFAAGHSLGEYSAHVAAGTFGFADAVRTVRLRGQ 132

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDN----------------- 164
            MQ AVP G G+M AI+GL    ++ ICA+ +         D                  
Sbjct: 133 YMQSAVPAGQGAMAAILGLPVEQINDICARVADDLTQAPPQDPGNPSTQAAAAVDALADP 192

Query: 165 ------------------------GGGQVVISGLQDAVKCAADTCLNKGAKRAVFLPVSA 200
                                      Q+VISG   AV+ AA+ C   GAKR V L VS 
Sbjct: 193 NNPASTPVEAASRVSAIVAPANINSPDQIVISGTTAAVERAAELCKEAGAKRTVMLSVSG 252

Query: 201 PFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSIDEISRLLVEQVTGRVRWR 260
           PFHS+LM P    +   L+S+   DP  PI  N  A  ++   E+   L+ QVTG VRW 
Sbjct: 253 PFHSALMQPAQDELTSRLESIAFNDPSFPIAANVDARLMTRGSEVRDALIRQVTGAVRWV 312

Query: 261 ETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVEDIDLALR 310
           E IQ     G  +  EVG GKVL+GL ++ID++L+  ++     ++ AL 
Sbjct: 313 ECIQLLQQSGATNYIEVGPGKVLSGLNRQIDRALATTNVEDPASLEKALA 362


>gi|17987761|ref|NP_540395.1| acyl-carrier-protein S-malonyltransferase [Brucella melitensis bv.
           1 str. 16M]
 gi|256044172|ref|ZP_05447079.1| acyl-carrier-protein S-malonyltransferase [Brucella melitensis bv.
           1 str. Rev.1]
 gi|260563530|ref|ZP_05834016.1| acyl transferase domain-containing protein [Brucella melitensis bv.
           1 str. 16M]
 gi|265990586|ref|ZP_06103143.1| malonyl CoA-acyl carrier protein transacylase [Brucella melitensis
           bv. 1 str. Rev.1]
 gi|17983483|gb|AAL52659.1| malonyl CoA-acyl carrier protein transacylase [Brucella melitensis
           bv. 1 str. 16M]
 gi|260153546|gb|EEW88638.1| acyl transferase domain-containing protein [Brucella melitensis bv.
           1 str. 16M]
 gi|263001370|gb|EEZ13945.1| malonyl CoA-acyl carrier protein transacylase [Brucella melitensis
           bv. 1 str. Rev.1]
          Length = 314

 Score =  188 bits (477), Expect = 8e-46,   Method: Composition-based stats.
 Identities = 173/301 (57%), Positives = 221/301 (73%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M+   TFPGQGSQ +GMG+ L + F EAR VF+EVD  L + LS  M+ G ++ LT T N
Sbjct: 1   MAVAFTFPGQGSQAVGMGKALAEQFAEARAVFDEVDEALGEKLSATMFEGPEDVLTLTAN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
           AQPAL AVSMA  R+ME  G  +K  +SYVAGHSLGEY+ALCAA  FSL+DT RL+R RG
Sbjct: 61  AQPALMAVSMAVQRIMEARGFSLKDKVSYVAGHSLGEYSALCAAGTFSLADTARLLRIRG 120

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
            +MQ+AVP G G+M AIIGL+   V+++C +A   G  +IANDNGGGQ+VISG + AV+ 
Sbjct: 121 NAMQKAVPVGEGAMAAIIGLEHGDVEAVCMEAKASGPVQIANDNGGGQLVISGARAAVEL 180

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           AA     KGAKRA+ LPVSAPFHS+LM P +  M+  L +V K D VVP++ N  A+PV+
Sbjct: 181 AAKLGSEKGAKRAIMLPVSAPFHSTLMAPAADAMREALAAVEKHDSVVPLIANVRAAPVT 240

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
             +EI+ LLVEQVTG+VRWRETI+WF+ +GV ++YEVG GKVLTGLA+RI K +S  ++ 
Sbjct: 241 DANEIAALLVEQVTGQVRWRETIEWFSANGVTTLYEVGCGKVLTGLARRISKDVSGAAVG 300

Query: 301 K 301
            
Sbjct: 301 S 301


>gi|238920261|ref|YP_002933776.1| malonyl CoA-acyl carrier protein transacylase, [Edwardsiella
           ictaluri 93-146]
 gi|238869830|gb|ACR69541.1| malonyl CoA-acyl carrier protein transacylase, putative
           [Edwardsiella ictaluri 93-146]
          Length = 309

 Score =  188 bits (477), Expect = 8e-46,   Method: Composition-based stats.
 Identities = 126/312 (40%), Positives = 174/312 (55%), Gaps = 4/312 (1%)

Query: 1   MST-VLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATC 59
           MST  + FPGQGSQ +GM  DL   +P     F E    L  +L  L+  G  EEL  T 
Sbjct: 1   MSTFAMVFPGQGSQTVGMLADLAAQYPVVGQTFAEASEALGYDLWRLVQQGPAEELNKTW 60

Query: 60  NAQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRAR 119
             QPAL   S+A  RV ++N     +  + +AGHSLGEY+AL  A     +  +RLV  R
Sbjct: 61  QTQPALLTASVAIYRVWQQNHG---KQPAMMAGHSLGEYSALVCAGVLDFTQAVRLVELR 117

Query: 120 GKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVK 179
           GK MQ+AVP G G+M AIIGLD+  + + C  A++  +    N N  GQVVI+G ++AV+
Sbjct: 118 GKLMQQAVPAGTGAMYAIIGLDNDAIAAACTGAAQGQVVAPVNFNSPGQVVIAGEKEAVE 177

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            A   C   GAKRA+ LPVS P H +LM P +  +   L ++    P  P++ N   +  
Sbjct: 178 RAGAACKAAGAKRALPLPVSVPSHCALMKPAADQLAGALQAIAFHAPSCPVINNVDVTAA 237

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
           +  D I   LV Q+   VRW ET+Q  A  GV  + E+G GKVLTGL KRI  +++A ++
Sbjct: 238 TDADAIRDALVRQLYSPVRWTETVQLMAAEGVDHLLEMGPGKVLTGLTKRIVDTMTAAAV 297

Query: 300 SKVEDIDLALRS 311
           +    + +AL  
Sbjct: 298 NDCASLSVALEQ 309


>gi|313673184|ref|YP_004051295.1| (acyl-carrier-protein) s-malonyltransferase [Calditerrivibrio
           nitroreducens DSM 19672]
 gi|312939940|gb|ADR19132.1| (Acyl-carrier-protein) S-malonyltransferase [Calditerrivibrio
           nitroreducens DSM 19672]
          Length = 310

 Score =  188 bits (477), Expect = 8e-46,   Method: Composition-based stats.
 Identities = 129/308 (41%), Positives = 185/308 (60%), Gaps = 6/308 (1%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
              + FPGQGSQ +GMG+D Y+++ E++  FE  D  LN  L+D+M+NG ++EL  T N 
Sbjct: 3   KIAVVFPGQGSQYVGMGKDFYETYSESKKFFETADSVLNYKLTDIMFNGPEDELKITYNT 62

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPAL  VS+A   +++      K D+SY AGHSLGEY+A+ AA   S  D +  V  RGK
Sbjct: 63  QPALLTVSIAIWELIK-----DKVDVSYFAGHSLGEYSAIVAAGGMSFKDAVLAVHNRGK 117

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQA-SRVGICEIANDNGGGQVVISGLQDAVKC 180
            MQEAVP G G+M A++ +D+ ++   C +      I E AN N   Q+V++G  +AV  
Sbjct: 118 FMQEAVPVGTGAMAAVLSMDESIILETCKEISKDGFIVEPANFNSEAQIVVAGHAEAVDK 177

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
             +    KG ++ V LPVSAPFH SLM P    M   L +V  +D   P+  N  AS  +
Sbjct: 178 FIEKIKEKGGRKVVKLPVSAPFHCSLMKPAELKMAEYLKNVQIKDLSKPVFNNVTASMET 237

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
           +  E+   LV+QV+  VRW E I+   + GV + +EVG+G VLTGL K+IDK++   +IS
Sbjct: 238 TSLEVRENLVKQVSSPVRWTELIKNMVSEGVDTFFEVGAGNVLTGLIKKIDKNVKCFNIS 297

Query: 301 KVEDIDLA 308
           K++D+   
Sbjct: 298 KIDDLQTL 305


>gi|260773148|ref|ZP_05882064.1| malonyl CoA-acyl carrier protein transacylase [Vibrio metschnikovii
           CIP 69.14]
 gi|260612287|gb|EEX37490.1| malonyl CoA-acyl carrier protein transacylase [Vibrio metschnikovii
           CIP 69.14]
          Length = 307

 Score =  188 bits (477), Expect = 8e-46,   Method: Composition-based stats.
 Identities = 119/307 (38%), Positives = 167/307 (54%), Gaps = 3/307 (0%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
              + FPGQGSQ IGM  +L + +   +  F +    L  +L  L+  G  E+L  T   
Sbjct: 3   KFAIVFPGQGSQAIGMLAELGEQYDVVKQTFSQASEVLGYDLWALVQQGPAEDLNQTHRT 62

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPA+ A S+A  RV +            +AGHSLGEY+AL  +        I LV  RG+
Sbjct: 63  QPAILAASVAIWRVWQS---LNLPQPEVLAGHSLGEYSALVCSGVIDFQQAISLVELRGR 119

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCA 181
            MQEAVP G G+M AIIGLDD  + + C QA++  I    N N  GQVVI+G ++AV+ A
Sbjct: 120 LMQEAVPAGTGAMYAIIGLDDEAIANACQQAAQGQIVSPVNFNSPGQVVIAGQKEAVERA 179

Query: 182 ADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSS 241
              C   GAKRA+ LPVS P H +LM P ++ +   L  +    P +P++ N      + 
Sbjct: 180 GVLCKESGAKRALPLPVSVPSHCALMKPAAEKLAIALAGLQFNSPSIPVINNVDVLAETD 239

Query: 242 IDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISK 301
             +I   LV Q+   VRW E +Q  ++ G++ + EVG GKVLTGL KRI K+L AV+++ 
Sbjct: 240 PAKIKDALVRQLYNPVRWTEAVQSMSDQGIEKLIEVGPGKVLTGLTKRIVKTLDAVAVND 299

Query: 302 VEDIDLA 308
               +  
Sbjct: 300 SASFEAV 306


>gi|296102890|ref|YP_003613036.1| malonyl CoA-acyl carrier protein transacylase [Enterobacter cloacae
           subsp. cloacae ATCC 13047]
 gi|295057349|gb|ADF62087.1| malonyl CoA-acyl carrier protein transacylase [Enterobacter cloacae
           subsp. cloacae ATCC 13047]
          Length = 309

 Score =  188 bits (477), Expect = 9e-46,   Method: Composition-based stats.
 Identities = 125/312 (40%), Positives = 178/312 (57%), Gaps = 4/312 (1%)

Query: 1   MS-TVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATC 59
           M+     FPGQGSQ +GM  ++  ++P     F E    L  +L  L   G  EEL  T 
Sbjct: 1   MTQFAFVFPGQGSQTVGMLSEMAANYPVIEETFREASDALGYDLWALTQQGPAEELNKTW 60

Query: 60  NAQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRAR 119
             QPAL   S+A  RV ++ G       + +AGHSLGEY+AL  A   + ++ +RLV  R
Sbjct: 61  QTQPALLTASVALWRVWQQKGGKA---PTLLAGHSLGEYSALVCAGVIAFAEAVRLVELR 117

Query: 120 GKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVK 179
           GK MQEAVP G G M AIIGLDD  +   C +++   +    N N  GQVVI+G ++AV+
Sbjct: 118 GKFMQEAVPEGTGGMSAIIGLDDASIAKACEESAEGQVVSPVNFNSPGQVVIAGHKEAVE 177

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            A   C   GAKRA+ LPVS P H +LM P +  +   L+ +T   P + ++ N      
Sbjct: 178 RAGAACKAAGAKRALPLPVSVPSHCALMKPAADKLAVELEKITFNAPTISVVNNVDVKCE 237

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
           ++ + I   LV Q+   V+W +T+++ A+ GV+ +YEVG GKVLTGL KRI  +L+A +I
Sbjct: 238 TTPEAIRDALVRQLYSPVQWTKTVEFMASQGVEHLYEVGPGKVLTGLTKRIVDTLTASAI 297

Query: 300 SKVEDIDLALRS 311
           ++ E I+ AL  
Sbjct: 298 NEPEAIEAALSQ 309


>gi|220935005|ref|YP_002513904.1| (acyl-carrier-protein) S-malonyltransferase [Thioalkalivibrio sp.
           HL-EbGR7]
 gi|219996315|gb|ACL72917.1| (acyl-carrier-protein) S-malonyltransferase [Thioalkalivibrio sp.
           HL-EbGR7]
          Length = 311

 Score =  188 bits (477), Expect = 9e-46,   Method: Composition-based stats.
 Identities = 134/309 (43%), Positives = 174/309 (56%), Gaps = 3/309 (0%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M+    FPGQGSQ +GM   L D+ P+ R  F+E    L  +L  L+ NG +E+L  T N
Sbjct: 1   MTFACVFPGQGSQSLGMLSALSDAHPQVRETFQEASDVLGFDLWSLVQNGPEEDLNRTEN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
            QPA+ A  +A  RV +  G       + +AGHSLGEYTAL  A A   SD   LV  RG
Sbjct: 61  TQPAMLAAGVAVWRVWQAAG---GPAPAVMAGHSLGEYTALVCAGAMGFSDAAGLVAERG 117

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           + MQ AV PG G+M AI+GLDD  V  +CA+A+  G+ E  N N  GQVVI+G   AV  
Sbjct: 118 RLMQGAVAPGQGAMAAILGLDDAQVIEVCARAAEGGVVEAVNFNSPGQVVIAGETAAVDR 177

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A       GAKR+V LPVS P H  LM   ++ +   L SV    P +P++ N   S  S
Sbjct: 178 AVALAAEAGAKRSVKLPVSVPSHCRLMAGAAERLAERLASVAIVSPSIPVIHNVDVSSHS 237

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
              +I  +L  Q+   VRW E++Q  A  GV +V E+G GKVLTGL KRIDK+L+   + 
Sbjct: 238 DPAQIRAVLAAQLHRPVRWVESVQKMAADGVTTVLELGPGKVLTGLNKRIDKTLALACVQ 297

Query: 301 KVEDIDLAL 309
             E +  AL
Sbjct: 298 DPESLAQAL 306


>gi|240850221|ref|YP_002971614.1| malonyl CoA-acyl carrier protein transacylase FabD [Bartonella
           grahamii as4aup]
 gi|240267344|gb|ACS50932.1| malonyl CoA-acyl carrier protein transacylase FabD [Bartonella
           grahamii as4aup]
          Length = 314

 Score =  188 bits (477), Expect = 9e-46,   Method: Composition-based stats.
 Identities = 173/309 (55%), Positives = 226/309 (73%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M     FPGQGSQ++GMG+ L + F  AR+VFEEVD  L + LS +++ G  + LT T N
Sbjct: 1   MGAAFIFPGQGSQLVGMGKALTEQFIAARMVFEEVDDALGEKLSKIIFEGPADVLTLTAN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
           AQPAL AVSMA IRVM++ GLC++  + +VAGHSLGEY+ALCAA  F+L+DT RL+R RG
Sbjct: 61  AQPALMAVSMAVIRVMQQLGLCIEEKVKFVAGHSLGEYSALCAAGTFTLTDTARLLRIRG 120

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
            +MQ AV  G GSM A+IGL++ +V+ IC   S  G+C+IANDNGGGQ+VISG   AV+ 
Sbjct: 121 NAMQAAVAVGEGSMAALIGLEEHIVEEICETVSGEGLCQIANDNGGGQIVISGKAKAVET 180

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A +    KGAKRA+ LPVSAPFHSSLM P +  MK  L +V K  P+VP++ N   +P S
Sbjct: 181 AVEIASTKGAKRALLLPVSAPFHSSLMQPAADAMKKALLTVNKMPPIVPLIANVSVAPES 240

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
           + + I+  LVEQVTGRVRWRETI+W A +GV +++EVGSGKVLTGL +RI+K +  V+I 
Sbjct: 241 NPERITTFLVEQVTGRVRWRETIEWIAANGVDTLFEVGSGKVLTGLTRRINKDIKGVTIG 300

Query: 301 KVEDIDLAL 309
            V++I+ AL
Sbjct: 301 TVDEIESAL 309


>gi|189345717|ref|YP_001942246.1| malonyl CoA-acyl carrier protein transacylase [Chlorobium limicola
           DSM 245]
 gi|189339864|gb|ACD89267.1| malonyl CoA-acyl carrier protein transacylase [Chlorobium limicola
           DSM 245]
          Length = 302

 Score =  188 bits (477), Expect = 9e-46,   Method: Composition-based stats.
 Identities = 122/309 (39%), Positives = 176/309 (56%), Gaps = 7/309 (2%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M     FPGQGSQ  GMGRD++DSFP A  +  + D  L  +++D+M++GS+++L  T  
Sbjct: 1   MK-AFVFPGQGSQYCGMGRDIFDSFPAAHEMMRKADEILGFSITDIMFSGSEDDLRQTRY 59

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
            QPA+   S+A   ++   G+         AGHSLGEY+ALC A A S  D I +V  RG
Sbjct: 60  TQPAVFLHSIAAASLLGNEGVA------MTAGHSLGEYSALCFAGAISFGDAIHIVAKRG 113

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           + MQ A     G+M A+IG+ D  V ++ A+A+  G+ + AN N  GQVVISG   A+K 
Sbjct: 114 ELMQHAGSQNPGTMAALIGMQDSAVANLLAEAASEGVVQAANFNSPGQVVISGEVGAIKK 173

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A +   + GA+ A  L VS  FHS LM P  + +   L+ V  +D  +P+  N  A PV+
Sbjct: 174 ALELAPSHGARMAKELVVSGAFHSPLMKPAEQELAAALELVEIRDARIPVCMNAVAEPVT 233

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
           +  EI + L+ Q+T  V W ++I+    +G+    E+G  KVL GL +RIDKS+    I 
Sbjct: 234 AAAEIRKNLIMQLTSPVLWTQSIEAMIQNGITDFVEIGPQKVLQGLIRRIDKSVRISGID 293

Query: 301 KVEDIDLAL 309
             EDI   +
Sbjct: 294 TAEDIRQIM 302


>gi|307262496|ref|ZP_07544141.1| Malonyl CoA-acyl carrier protein transacylase [Actinobacillus
           pleuropneumoniae serovar 12 str. 1096]
 gi|306867873|gb|EFM99704.1| Malonyl CoA-acyl carrier protein transacylase [Actinobacillus
           pleuropneumoniae serovar 12 str. 1096]
          Length = 311

 Score =  188 bits (477), Expect = 9e-46,   Method: Composition-based stats.
 Identities = 119/311 (38%), Positives = 168/311 (54%), Gaps = 5/311 (1%)

Query: 1   MS-TVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATC 59
           MS   + FPGQGSQ +GM  DL  ++P     F +    L  +L DL+ NG+ E+L  T 
Sbjct: 1   MSNFAMVFPGQGSQAVGMLADLAAAYPIVEETFRQASDVLGYDLWDLVQNGTAEDLGQTQ 60

Query: 60  NAQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRAR 119
             QPAL A S+A  RV ++     +   S +AGHSLGEY+AL  A      D I+LV  R
Sbjct: 61  RTQPALLASSVAIYRVWQQ--KYPELKPSVMAGHSLGEYSALVCAGVLDFQDAIKLVELR 118

Query: 120 GKSMQEAVPPGL--GSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDA 177
           G +MQ+AVP        +  +  +  +     AQA    I    N N  GQVVI+G + A
Sbjct: 119 GNAMQQAVPASTGAMYAIIGLDNEAIINACEQAQAEVGEIVSAVNFNSPGQVVIAGTKAA 178

Query: 178 VKCAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCAS 237
            + A + C   GAKRA+ L VS P H +LM P +  +   L ++T   P+VP++ N   S
Sbjct: 179 AEKAGELCKAAGAKRALPLAVSVPSHCALMKPAADKLAEALQNITLNAPIVPVINNVDVS 238

Query: 238 PVSSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAV 297
             +  + I   LV Q+   VRW ET++  AN GV ++YE+G GKVLTGL  RI K L A 
Sbjct: 239 VETDAEAIRNELVRQLYSPVRWTETVEKMANEGVTTLYEIGPGKVLTGLTSRIVKELKAQ 298

Query: 298 SISKVEDIDLA 308
           +++ +  ++  
Sbjct: 299 AVNDLVSLEAV 309


>gi|238026605|ref|YP_002910836.1| Malonyl CoA-acyl carrier protein transacylase [Burkholderia glumae
           BGR1]
 gi|237875799|gb|ACR28132.1| Malonyl CoA-acyl carrier protein transacylase [Burkholderia glumae
           BGR1]
          Length = 310

 Score =  188 bits (477), Expect = 9e-46,   Method: Composition-based stats.
 Identities = 138/310 (44%), Positives = 174/310 (56%), Gaps = 4/310 (1%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M     FPGQGSQ +GM     D     R   +E    LNQ+L  L+  G  EEL  T N
Sbjct: 1   MKFAFVFPGQGSQSVGMLNAFAD-LAVVRETVQEASDALNQDLGKLIAEGPAEELNLTAN 59

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
            QP +   + A  R  +  G       S VAGHSLGEYTAL AA A +  D + LVR R 
Sbjct: 60  TQPVMLTAAYACYRAWQAAGG---PAPSIVAGHSLGEYTALVAAGAIAFRDAVPLVRFRA 116

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           ++MQ AVP G G M AI+GLDD  V ++CA+AS  G+ E  N N   QVVI+G + AV+ 
Sbjct: 117 QAMQNAVPVGQGGMAAILGLDDDTVRAVCAEASAEGVVEAVNFNAPAQVVIAGAKAAVEK 176

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A +    KGAKRA+ LPVSAPFHSSL+ P S  ++  L SVT   P +P++ N   + VS
Sbjct: 177 ACELAKAKGAKRALPLPVSAPFHSSLLKPASDQLRDYLASVTVNAPAIPLVNNIDVAVVS 236

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
               I   LV Q  G VRW E ++  A  GV  + E G GKVL GL KRID +L+ VS+ 
Sbjct: 237 DPAAIKDALVRQAAGPVRWVECVRHIAGTGVTQLVECGPGKVLAGLTKRIDGTLTGVSVF 296

Query: 301 KVEDIDLALR 310
               +D  L+
Sbjct: 297 DPATLDDVLK 306


>gi|304321797|ref|YP_003855440.1| acyl-carrier-protein S-malonyltransferase [Parvularcula bermudensis
           HTCC2503]
 gi|303300699|gb|ADM10298.1| acyl-carrier-protein S-malonyltransferase [Parvularcula bermudensis
           HTCC2503]
          Length = 314

 Score =  188 bits (477), Expect = 9e-46,   Method: Composition-based stats.
 Identities = 152/310 (49%), Positives = 188/310 (60%), Gaps = 6/310 (1%)

Query: 5   LTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPA 64
             FPGQGSQ +GMG  L D FP A  VFEE D  L +NLS LM+ G  EELT T NAQPA
Sbjct: 10  YIFPGQGSQSVGMGVALRDHFPAAATVFEEADEALGRNLSRLMFEGPSEELTLTENAQPA 69

Query: 65  LTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQ 124
           L  VS+A +R +E  G  +   +  +AGHSLGEYTA CAA A  L+D +RLVR RG++MQ
Sbjct: 70  LLVVSIAALRALEAEGFGLGA-VRSMAGHSLGEYTAYCAAGAIELADAVRLVRLRGEAMQ 128

Query: 125 EAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAADT 184
            AVP G G M A++GLD           +     EIANDN   Q+V+SG   A+      
Sbjct: 129 AAVPVGEGKMAAVLGLDIETAA----ALAAEAGVEIANDNAPSQIVLSGRAAAIDAVCAR 184

Query: 185 CLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSIDE 244
               GAKRA+ L VSAPFHSSLM P ++ M   L     Q P VP+  N   +P +  + 
Sbjct: 185 AKEAGAKRAMLLAVSAPFHSSLMAPAAERMAEALAKTFFQPPKVPVYSNVLTTPPAGEEA 244

Query: 245 ISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVED 304
           I R LV+QVTGRVRW ETI   A  G ++  EVG GKVL+GL KRI KS +A+S  + +D
Sbjct: 245 IKRSLVDQVTGRVRWVETISQMAEDGTETFIEVGPGKVLSGLVKRIAKSATALSFGEPDD 304

Query: 305 IDLALRSIVG 314
           I+  LR  +G
Sbjct: 305 IE-TLRDRLG 313


>gi|17545770|ref|NP_519172.1| acyl-carrier-protein S-malonyltransferase [Ralstonia solanacearum
           GMI1000]
 gi|17428064|emb|CAD14753.1| probable malonyl coa-[acyl-carrier-protein] transacylase [Ralstonia
           solanacearum GMI1000]
          Length = 309

 Score =  188 bits (477), Expect = 9e-46,   Method: Composition-based stats.
 Identities = 129/313 (41%), Positives = 167/313 (53%), Gaps = 4/313 (1%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M+    FPGQGSQ +GM     D  P       E    L Q++  L+  G  +EL  T N
Sbjct: 1   MTFAFVFPGQGSQSVGMLNAFAD-HPVVAATLAEASDALGQDIGKLIAEGPADELNLTTN 59

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
            QP +   ++A  R  +  G       + VAGHSLGEY+AL AA A +  D + LVR R 
Sbjct: 60  TQPVMLTAAVAVYRAWQAAGG---PTPAVVAGHSLGEYSALVAAGAIAFKDAVPLVRFRA 116

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           K+MQEAVP G G M AI+GL D  V + CA+AS  G+ E  N N   QVVI+G + AV+ 
Sbjct: 117 KAMQEAVPVGEGGMAAILGLSDDDVRAACAEASSAGVVEAVNFNAPAQVVIAGAKAAVEK 176

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A +    KGAKRA+ LPVSAPFHSSL+ P S  ++  L  V    P +P++ N   + VS
Sbjct: 177 ACEIAKAKGAKRALPLPVSAPFHSSLLKPASDRLREYLSGVAVGAPAIPVINNVDVALVS 236

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
               I   LV Q    VRW ET+Q     G+  V E G GKVL GL KRID  +   +I 
Sbjct: 237 DPAAIKDALVRQAASPVRWVETVQKMKADGIARVVECGPGKVLAGLTKRIDGDIVGDAIF 296

Query: 301 KVEDIDLALRSIV 313
               ++  L  + 
Sbjct: 297 DPASLEAVLVQLK 309


>gi|317121785|ref|YP_004101788.1| (acyl-carrier-protein) S-malonyltransferase [Thermaerobacter
           marianensis DSM 12885]
 gi|315591765|gb|ADU51061.1| (Acyl-carrier-protein) S-malonyltransferase [Thermaerobacter
           marianensis DSM 12885]
          Length = 317

 Score =  188 bits (477), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 134/311 (43%), Positives = 187/311 (60%), Gaps = 6/311 (1%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
            T + FPGQG+Q +GMGRDLY+ FPEAR VFE+       +++ L + G +E+L  T   
Sbjct: 3   KTAVVFPGQGAQYVGMGRDLYEQFPEARQVFEQASEAAGFDVARLCFEGPEEQLQLTEFQ 62

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPAL AV +A  RV+E  GL      +  AG SLGEY AL AA    L D  R+VR RGK
Sbjct: 63  QPALLAVGVACWRVLEARGLV----PALAAGLSLGEYGALVAAGVLDLGDAARVVRLRGK 118

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGI--CEIANDNGGGQVVISGLQDAVK 179
            MQEAVPPG G+M A++GL+  VV+ +C Q    G    E AN N  GQ+V++G + AV+
Sbjct: 119 FMQEAVPPGEGAMAALLGLEAGVVEDLCRQVMEGGTGVVEPANYNCPGQIVVAGHRAAVE 178

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            A +     GA+++V LPVSAPFH  LM P ++ +  +L  V  +   VP++ N  A PV
Sbjct: 179 AAVERAREAGARKSVLLPVSAPFHCRLMEPAARRLAEVLAEVPMRPARVPVVANVTAEPV 238

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
           +  + I  LL++QV   VRW ++++     G+  + E+G GK LTG A+RID++L AV  
Sbjct: 239 TDPERIRELLIQQVHHPVRWEQSVRRMQQEGITRLVEMGPGKTLTGFARRIDRALEAVPA 298

Query: 300 SKVEDIDLALR 310
              E+I   + 
Sbjct: 299 GTAEEILALVA 309


>gi|324113887|gb|EGC07861.1| malonyl CoA-acyl carrier protein transacylase [Escherichia
           fergusonii B253]
 gi|325497602|gb|EGC95461.1| malonyl-CoA-[acyl-carrier-protein] transacylase [Escherichia
           fergusonii ECD227]
          Length = 309

 Score =  188 bits (477), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 127/311 (40%), Positives = 176/311 (56%), Gaps = 4/311 (1%)

Query: 1   MS-TVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATC 59
           M+     FPGQGSQ +GM  D+  ++P     F E    L  +L  L  NG  EEL  T 
Sbjct: 1   MTQFAFVFPGQGSQTVGMLADMAATYPIVEETFAEASAALGYDLWALTQNGPAEELNKTW 60

Query: 60  NAQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRAR 119
             QPAL   S+A  R+ ++ G    +  + +AGHSLGEY+AL  A     +D +RLV  R
Sbjct: 61  QTQPALLTASVALYRIWQQQGG---KSPAMMAGHSLGEYSALVCAGVIDFADAVRLVEMR 117

Query: 120 GKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVK 179
           GK MQEAVP G G+M AIIGLDD  +   C +A+   +    N N  GQVVI+G ++AV+
Sbjct: 118 GKFMQEAVPEGTGAMAAIIGLDDASIAKACEEAAEGQVVSPVNFNSPGQVVIAGHKEAVE 177

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            A   C   GAKRA+ LPVS P H +LM P +  +   L  +T   P VP++ N      
Sbjct: 178 RAGAACKAAGAKRALPLPVSVPSHCALMKPAADKLAVELAKITFNTPTVPVVNNVDVKCE 237

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
           +  D I   LV Q+   V+W +++++ A  GV+ +YEVG GKVLTGL KRI  +L+A ++
Sbjct: 238 NEGDAIRDALVRQLYNPVQWTKSVEYMAAQGVEHLYEVGPGKVLTGLTKRIVDTLTASAL 297

Query: 300 SKVEDIDLALR 310
           ++   +  AL 
Sbjct: 298 NEPAAMSAALE 308


>gi|221639096|ref|YP_002525358.1| malonyl CoA-acyl carrier protein transacylase [Rhodobacter
           sphaeroides KD131]
 gi|221159877|gb|ACM00857.1| malonyl CoA-acyl carrier protein transacylase [Rhodobacter
           sphaeroides KD131]
          Length = 322

 Score =  188 bits (477), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 157/311 (50%), Positives = 206/311 (66%), Gaps = 1/311 (0%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           MS    FPGQG+Q IGMGR L +++P AR VFEEVD  L + LS L+W+GS EELT T N
Sbjct: 13  MSRAFVFPGQGAQTIGMGRALAEAYPAARAVFEEVDEALGEKLSALIWDGSIEELTLTQN 72

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
           AQPAL A SMA +  +E  GL +    S+VAGHSLGEY+ALCAAK+  LSDT RL+R RG
Sbjct: 73  AQPALMATSMAALAALEVEGLGI-ATASFVAGHSLGEYSALCAAKSLKLSDTARLLRIRG 131

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           ++MQEAVP G+G+M A++GLD      +  +A++  +C+ ANDN   QVV+SG + AV+ 
Sbjct: 132 QAMQEAVPVGVGAMAALLGLDYDTAVEVAHEAAQGEVCQAANDNDPAQVVVSGHKAAVER 191

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A +    +GAKRA+ L VSAPFH +LM   + VM   L +V  + PV P++ N  A  VS
Sbjct: 192 AVEIAKGRGAKRAILLSVSAPFHCALMQHAASVMSEALAAVVIEAPVCPVVVNVRAEAVS 251

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
             D I  LLV QVTG VRWRE++ W  N GV   +E+G+GK L+G+ KRI K  +  +I 
Sbjct: 252 EPDRIRALLVAQVTGAVRWRESVMWMENAGVDEFWEIGAGKALSGMIKRIAKGAATRAIG 311

Query: 301 KVEDIDLALRS 311
             ED+  A  +
Sbjct: 312 TPEDVAAAATA 322


>gi|254486565|ref|ZP_05099770.1| malonyl CoA-acyl carrier protein transacylase [Roseobacter sp.
           GAI101]
 gi|214043434|gb|EEB84072.1| malonyl CoA-acyl carrier protein transacylase [Roseobacter sp.
           GAI101]
          Length = 310

 Score =  188 bits (477), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 147/301 (48%), Positives = 201/301 (66%), Gaps = 1/301 (0%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           MS    +PGQG+Q IGMGRDL D++P A+ VF+EVD  L + LS L+W G  E LT T N
Sbjct: 1   MSIAFVYPGQGAQTIGMGRDLADAYPAAKAVFDEVDEALGEKLSTLIWEGDAEALTLTQN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
           AQPAL A SMA +  +   G+ +    ++VAGHSLGEY ALCAA  FSL+DT RL+R RG
Sbjct: 61  AQPALMATSMAAMAALNAEGITID-KAAFVAGHSLGEYAALCAAGTFSLADTARLLRIRG 119

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           ++MQ AVP G G+M A++GL     + + A A++  +C++AN N   Q V+SG + AV+ 
Sbjct: 120 RAMQAAVPVGQGAMAALLGLSFEQAEQVAADAAQGDVCQVANQNDPAQNVVSGSKAAVER 179

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A D     GAKRA+ LPVSAPFH +LM P ++ M   L  VT   P VP++ N  A  VS
Sbjct: 180 AVDLAKAAGAKRALLLPVSAPFHCALMAPAAEEMAGALADVTMHAPSVPVVANVIAQAVS 239

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
             D+I +LLVEQVTG+VRW  +++W A  GV  ++E+G+GK L+G+ +RI+K ++ V+I 
Sbjct: 240 DPDQIRKLLVEQVTGQVRWLSSVEWMAAQGVTEIWEIGAGKALSGMIRRINKEITCVNIG 299

Query: 301 K 301
            
Sbjct: 300 T 300


>gi|170720710|ref|YP_001748398.1| malonyl CoA-acyl carrier protein transacylase [Pseudomonas putida
           W619]
 gi|169758713|gb|ACA72029.1| malonyl CoA-acyl carrier protein transacylase [Pseudomonas putida
           W619]
          Length = 312

 Score =  188 bits (477), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 117/302 (38%), Positives = 175/302 (57%), Gaps = 3/302 (0%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
           S    FPGQGSQ +GM ++L    P     F+E    L  +L +L+  G +E+L  T   
Sbjct: 4   SLAFVFPGQGSQSLGMLKELGAEKPVIVETFKEASEALGYDLWELVQEGPEEQLNQTDKT 63

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPA+   S+A  R+  + G       ++V+GHSLGEY+AL AA + SL D ++LV+ RG+
Sbjct: 64  QPAILTASIALWRLWLEEGGA---QPAFVSGHSLGEYSALVAAGSLSLKDAVKLVKRRGE 120

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCA 181
            MQEAVP G G+M AI+GL D  V +ICA+A+   +    N N  GQVVI+G   AV  A
Sbjct: 121 LMQEAVPAGHGAMAAILGLGDDDVKAICAEAAEDEVVSAVNFNSPGQVVIAGNVAAVNRA 180

Query: 182 ADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSS 241
            + C  KGAKRA+ LPVS P H +LM P +      ++++  + P +P++ N  A+  + 
Sbjct: 181 IELCKAKGAKRALPLPVSVPSHCALMKPAADRFAEHVNAIDWKAPQIPVVQNVTAAVAAD 240

Query: 242 IDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISK 301
           +D + + L+ Q+   VRW E +Q  A +G  ++ E G GKVL GL KR    ++  +++ 
Sbjct: 241 LDTLKQDLLAQLYQPVRWVECVQTLAANGAVNLVECGPGKVLAGLNKRCADGVTTYNLNT 300

Query: 302 VE 303
            +
Sbjct: 301 PD 302


>gi|253989183|ref|YP_003040539.1| malonyl coa-acyl carrier protein transacylase [Photorhabdus
           asymbiotica subsp. asymbiotica ATCC 43949]
 gi|253780633|emb|CAQ83795.1| malonyl coa-acyl carrier protein transacylase [Photorhabdus
           asymbiotica]
          Length = 310

 Score =  188 bits (476), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 128/312 (41%), Positives = 172/312 (55%), Gaps = 4/312 (1%)

Query: 1   MS-TVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATC 59
           MS   + FPGQGSQ +GM  DL   FP     F E    L  +L  L+  G  EEL  T 
Sbjct: 1   MSEFAMVFPGQGSQSLGMLADLAAEFPVVEHTFAEASDVLGYDLWTLVQQGPAEELNKTW 60

Query: 60  NAQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRAR 119
             QPAL A S+A  R+ ++ G       + +AGHSLGEY+AL  A        I+LV  R
Sbjct: 61  QTQPALLAASVAIWRIWQEKGGKA---PALMAGHSLGEYSALVCAGVIDFKQAIKLVELR 117

Query: 120 GKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVK 179
           GK MQEAVP G G+M AIIGLD+  +D  C +A++  I    N N  GQVVI+G ++AV+
Sbjct: 118 GKLMQEAVPEGTGAMYAIIGLDNESIDRACKEAAQGQIVSPVNFNSPGQVVIAGEKEAVE 177

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            A   C   GAKR + L VSAP H +LM P +  +  +L+ +    P  P++ N      
Sbjct: 178 RAGVACKAAGAKRVLPLAVSAPSHCALMKPAADKLAIVLNGIEFSHPQFPVVNNVDVKIE 237

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
            S + I   LV Q+   VRW ET+++ A   V  + E+G GKVLTGL KRI  +LSA ++
Sbjct: 238 QSAEAIRDALVRQLYNPVRWTETVEFIAGQSVGQLLEIGPGKVLTGLTKRIVDTLSAAAV 297

Query: 300 SKVEDIDLALRS 311
           +    +  AL +
Sbjct: 298 NDTISLATALEN 309


>gi|87307165|ref|ZP_01089310.1| malonyl CoA-acyl carrier protein transacylase [Blastopirellula
           marina DSM 3645]
 gi|87289905|gb|EAQ81794.1| malonyl CoA-acyl carrier protein transacylase [Blastopirellula
           marina DSM 3645]
          Length = 302

 Score =  188 bits (476), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 105/299 (35%), Positives = 159/299 (53%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
                FPGQG+Q +GMG+ L  S P+A  +F+     L  +L++L +NG    L +T  +
Sbjct: 3   KIAFLFPGQGAQYVGMGKQLAASSPKAAELFQRAAEILGYDLAELCFNGPAARLDSTVFS 62

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPAL   S+A +  M +            AG SLGEYTA+  A      D +R+V+ RG 
Sbjct: 63  QPALFVTSIAALESMREENPDALLSCEGTAGLSLGEYTAMVFAGVMQFEDALRVVQIRGA 122

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCA 181
           +MQEA       MV+++GLD   V +ICA+A    I EIAN    G +V+SG  DA +  
Sbjct: 123 AMQEAADAVPSGMVSVLGLDRDQVSAICAEARENEILEIANLLCPGNIVVSGSNDACERV 182

Query: 182 ADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSS 241
                  GA + + L V+  FH+ +M P  + +   L  V    P +P++ N  A P   
Sbjct: 183 PAVAEKVGAMKVMPLAVAGAFHTQIMQPAVEKLTAALADVPMSAPRIPVVSNVDAVPHRD 242

Query: 242 IDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
            +EI +LL++QV   VRW +++++    G    +E+G+G+VL GL KRID+     +I+
Sbjct: 243 PEEIRQLLIQQVCSPVRWEDSMRYLLEAGFNEFFEIGAGRVLRGLMKRIDRKAEFHNIT 301


>gi|312795529|ref|YP_004028451.1| Malonyl-CoA-[acyl-carrier-protein] transacylase [Burkholderia
           rhizoxinica HKI 454]
 gi|312167304|emb|CBW74307.1| Malonyl-CoA-[acyl-carrier-protein] transacylase (EC 2.3.1.39)
           [Burkholderia rhizoxinica HKI 454]
          Length = 310

 Score =  188 bits (476), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 130/314 (41%), Positives = 174/314 (55%), Gaps = 4/314 (1%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M     FPGQGSQ IGM  D +   P  +   EE    L+Q++  L+  G  +EL  T +
Sbjct: 1   MKFAFVFPGQGSQSIGML-DAFGDHPVVKATLEEASDVLSQDIGRLIAQGPADELNLTTH 59

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
            QP +   + A  RV ++ G       + VAGHSLGEYTAL A+ A +  D + LVR R 
Sbjct: 60  TQPVMLTAAYAIYRVWQQAGGVA---PAVVAGHSLGEYTALVASGAITFRDALPLVRFRA 116

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           ++MQ+AVP G G M A++GLDD  V + C++A   GI E  N N   QVVI+G + AV  
Sbjct: 117 QAMQQAVPVGAGGMAAVLGLDDDAVRAACSEAGSAGIVEAVNFNAPAQVVIAGHKTAVDK 176

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A +    KGAKRAV LPVSAPFHSSL+ P S+ ++  L  V    P +P++ N   + VS
Sbjct: 177 ACEIAKAKGAKRAVLLPVSAPFHSSLLKPASERLREYLADVDVCAPQIPVVNNIDVAMVS 236

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
               I   LV Q  G VRW E ++  A   +  V E G GKVL GL +RID +L   +I 
Sbjct: 237 DPAGIKDALVRQAAGPVRWVECVRAIAAQQITHVIECGPGKVLAGLTRRIDANLVGGAIV 296

Query: 301 KVEDIDLALRSIVG 314
               +D  L+ + G
Sbjct: 297 DPASLDDTLKLLQG 310


>gi|189499166|ref|YP_001958636.1| malonyl CoA-acyl carrier protein transacylase [Chlorobium
           phaeobacteroides BS1]
 gi|189494607|gb|ACE03155.1| malonyl CoA-acyl carrier protein transacylase [Chlorobium
           phaeobacteroides BS1]
          Length = 303

 Score =  188 bits (476), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 125/310 (40%), Positives = 178/310 (57%), Gaps = 7/310 (2%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M     FPGQGSQ  GM +++YD +PEAR + +  D  L  +++D+M+NGS+++L  T  
Sbjct: 1   MK-AFVFPGQGSQYCGMAKEIYDRYPEARSLMDRADEILGYSITDIMFNGSEDDLRQTRY 59

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
            QPA+   S+A  +++              AGHSLGEYTALC A A S  D I +V  RG
Sbjct: 60  TQPAIFLHSIAVAKLL------GDNQAGMTAGHSLGEYTALCYADAMSFDDAIHIVAKRG 113

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           + MQ A     G+M A+IG+ D  ++++ A+A   GI + AN N  GQVVISG  DAV+ 
Sbjct: 114 ELMQNAGTINPGTMAAVIGMKDTDLENLLAEAETEGIVQAANFNSPGQVVISGDIDAVRK 173

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A +   +KGA+ A  L VS  FHS LM P  + +K  LD++T  D  +P+  N  A PV 
Sbjct: 174 AVELAPSKGARMAKELVVSGAFHSPLMKPAEEELKASLDAITINDARIPVCMNVVAQPVR 233

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
             +EI   LV Q+T  V+W+++++     GV S  E G  KVL GL KRID+S++   + 
Sbjct: 234 RKEEIRNNLVLQLTSSVKWQQSVEAMIAEGVTSFVETGPQKVLQGLIKRIDRSVTIDGVD 293

Query: 301 KVEDIDLALR 310
             + I   L 
Sbjct: 294 TADQIAQTLS 303


>gi|260879497|ref|ZP_05891852.1| [acyl-carrier-protein] S-malonyltransferase [Vibrio
           parahaemolyticus AN-5034]
 gi|308093542|gb|EFO43237.1| [acyl-carrier-protein] S-malonyltransferase [Vibrio
           parahaemolyticus AN-5034]
          Length = 313

 Score =  188 bits (476), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 128/301 (42%), Positives = 178/301 (59%), Gaps = 3/301 (0%)

Query: 8   PGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPALTA 67
           PGQGSQ +GM  DL + +   +  F E    L  +L  L+ NG  E+L  T   QPAL A
Sbjct: 15  PGQGSQAVGMLADLGEQYDVVKQTFAEASDALGYDLWALVQNGPAEDLNQTFRTQPALLA 74

Query: 68  VSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQEAV 127
            S+A  RV ++ GL      + +AGHSLGEY+AL  A      + I+LV  RGK MQEAV
Sbjct: 75  SSVAIWRVWQELGL---EQPANLAGHSLGEYSALVCAGVIDFKEAIKLVELRGKLMQEAV 131

Query: 128 PPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAADTCLN 187
           P G G+M AIIGLDD V+   C +A++  +    N N  GQVVI+G +DAV+ A   C  
Sbjct: 132 PAGTGAMYAIIGLDDDVIAKACEEAAQGDVVSPVNFNSPGQVVIAGSKDAVERAGALCKE 191

Query: 188 KGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSIDEISR 247
            GAKRA+ LPVS P H +LM P +  +   L+S+    P +P++ N   +  +   +I  
Sbjct: 192 AGAKRALPLPVSVPSHCALMKPAADKLAVALESIEFNTPQLPVINNVDVAAETDPAKIKD 251

Query: 248 LLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVEDIDL 307
            LV Q+   VRW E++Q  +  GV+++ E+G GKVLTGL KRI K+LSA +++ V  ++ 
Sbjct: 252 ALVRQLYSPVRWTESVQLMSEQGVENLLELGPGKVLTGLTKRIVKTLSAAAVNDVASLEA 311

Query: 308 A 308
           A
Sbjct: 312 A 312


>gi|260592149|ref|ZP_05857607.1| malonyl CoA-acyl carrier protein transacylase [Prevotella veroralis
           F0319]
 gi|260535783|gb|EEX18400.1| malonyl CoA-acyl carrier protein transacylase [Prevotella veroralis
           F0319]
          Length = 295

 Score =  188 bits (476), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 98/300 (32%), Positives = 148/300 (49%), Gaps = 7/300 (2%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M     FPGQGSQ +GMG+DLY++ P A+ +F++ D  L   ++D+M+ G+ ++L  T  
Sbjct: 1   MK-AFVFPGQGSQFVGMGKDLYENSPLAKELFDKADEILGFKITDIMFAGTDDQLKETKV 59

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIR-LVRAR 119
            QPA+   S+     +       +     VAGHSLGE++AL AA A S  D ++ +    
Sbjct: 60  TQPAVFLHSVISALCL-----GDEFKPDMVAGHSLGEFSALVAAGALSFEDGLKLVAARA 114

Query: 120 GKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVK 179
               +            I   D+ V +     +    +C  AN N  GQ+VISG  DA+ 
Sbjct: 115 NAMQKACEQNPGTMAAIIGLPDEKVEEICAQVSKEGKVCVAANFNCPGQLVISGSVDAIN 174

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            A +     GAKRA+ L V   FHS LM P    ++  +++     P  P+  N  A P 
Sbjct: 175 EACELLKEAGAKRALPLKVGGAFHSPLMQPAKDELQAAIEATKFNAPKCPVYQNVDALPH 234

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
           +   EI + L+ Q+T  VRW ++ Q     G     E G GK L G+  RID++++A  I
Sbjct: 235 TDPAEIQKNLIAQLTSSVRWTKSAQNMIADGADEFIECGPGKALQGMLGRIDRNVNAHGI 294


>gi|238791860|ref|ZP_04635497.1| Malonyl CoA-acyl carrier protein transacylase [Yersinia intermedia
           ATCC 29909]
 gi|238728964|gb|EEQ20481.1| Malonyl CoA-acyl carrier protein transacylase [Yersinia intermedia
           ATCC 29909]
          Length = 304

 Score =  188 bits (476), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 127/307 (41%), Positives = 173/307 (56%), Gaps = 3/307 (0%)

Query: 5   LTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPA 64
           + FPGQGSQ +GM  DL   FP     F E    L  +L  L+  G  EEL  T   QPA
Sbjct: 1   MVFPGQGSQSLGMLADLAAQFPIVEATFSEASSVLGYSLWQLVQQGPVEELNKTWQTQPA 60

Query: 65  LTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQ 124
           L A S+A  RV +  G  +    + +AGHSLGEY+AL  A        I LV  RGK MQ
Sbjct: 61  LLAASVAIWRVWQHQGGKL---PTMMAGHSLGEYSALVCAGVIDFKQAITLVELRGKLMQ 117

Query: 125 EAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAADT 184
           EAVP G G+M AIIGLD+  +   C ++++  +    N N  GQVVI+G ++AV+ A   
Sbjct: 118 EAVPAGTGAMYAIIGLDNESIAKACEESAQGQVVSPVNFNSPGQVVIAGNKEAVERAGVA 177

Query: 185 CLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSIDE 244
           C   GAKRA+ LPVS P H +LM P +  +   L+++  Q P+ P++ N       S D 
Sbjct: 178 CKAAGAKRALPLPVSVPSHCALMKPAADKLAEALENIEFQAPLFPVVNNVDVKTEVSPDA 237

Query: 245 ISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVED 304
           I   LV Q+   VRW E++++ A  G++ + EVG GKVLTGL KRI  +L+A  ++ V  
Sbjct: 238 IRSALVRQLYNPVRWTESVEFMAAEGIELLLEVGPGKVLTGLTKRIVDTLTAAPVNDVAT 297

Query: 305 IDLALRS 311
           +  AL +
Sbjct: 298 LTSALEN 304


>gi|154500681|ref|ZP_02038719.1| hypothetical protein BACCAP_04354 [Bacteroides capillosus ATCC
           29799]
 gi|150270570|gb|EDM97879.1| hypothetical protein BACCAP_04354 [Bacteroides capillosus ATCC
           29799]
          Length = 312

 Score =  188 bits (476), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 109/314 (34%), Positives = 166/314 (52%), Gaps = 4/314 (1%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           MS    + GQGSQ  GMG DLY+++P  R V +     ++ +L ++ +      L  T  
Sbjct: 1   MSLAFLYAGQGSQHPGMGADLYEAYPAFRAVLDSAAEQVDFDLKEVSFTDVGGVLNQTAY 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
            QPA+ A +     ++ + G+    +  Y AG SLGEY+AL AA  FS ++ + LV  RG
Sbjct: 61  TQPAMVAFAAGVTALLYERGI----EPDYAAGLSLGEYSALHAAGVFSAAEAVSLVAFRG 116

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           K+M +A      +M+A++GLD   + S C QA+ +G+ EIAN N  GQ+VI G + AV+ 
Sbjct: 117 KAMTQAAEGMDCAMMAVLGLDVATLQSACDQAASLGVVEIANYNCPGQLVIGGEKAAVEK 176

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           AA      GAKRA+ L VS PFH+SL+ P    +     +V       P+L N     + 
Sbjct: 177 AAALAKELGAKRALPLKVSGPFHTSLLKPAGDALAERFRTVEFAPMAFPVLFNCLGHEMG 236

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
             D I  LL  QV   VR  +TI+     GV ++ E+G GKVL+G  ++   ++   ++ 
Sbjct: 237 EGDTIPALLERQVQSSVRMEDTIRRMEALGVDTIVEIGPGKVLSGFVRKTCPAIRTFAVE 296

Query: 301 KVEDIDLALRSIVG 314
              D+D    ++ G
Sbjct: 297 TCADLDALTAALKG 310


>gi|304382424|ref|ZP_07364923.1| malonyl-CoA-[acyl-carrier-protein] transacylase [Prevotella marshii
           DSM 16973]
 gi|304336432|gb|EFM02669.1| malonyl-CoA-[acyl-carrier-protein] transacylase [Prevotella marshii
           DSM 16973]
          Length = 298

 Score =  188 bits (476), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 109/302 (36%), Positives = 160/302 (52%), Gaps = 7/302 (2%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M     FPGQG+Q +GMG++LY++ P A+ +FE+ +  L   ++D+M+ G+ +EL  T  
Sbjct: 3   MK-AFVFPGQGAQFVGMGKELYETNPLAKELFEKANSILGYRITDIMFTGTDDELKQTKV 61

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
            QP     ++    V+    +      S VAGHSLGE++AL A+ A +  D +RLV AR 
Sbjct: 62  TQP-----AVFLHSVISALCMGDNFSPSMVAGHSLGEFSALVASGALTFEDGVRLVYARA 116

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQ-ASRVGICEIANDNGGGQVVISGLQDAVK 179
            +MQ+A      +M AIIGLDD  V  IC +      IC  AN N  GQ+VISG  +A+ 
Sbjct: 117 MAMQKACEITPSTMAAIIGLDDAKVIEICTEVNKPGNICVAANFNCPGQLVISGNVEAIN 176

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            A +     GA+RA+ L V   FHS LM P  + ++  ++      P  P+  N  A P 
Sbjct: 177 EACEKLKAAGARRALPLKVGGAFHSPLMQPAKEELQIAIEETLFSSPKCPVYQNVDAKPH 236

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
           +   EI   L+ Q+T  VRW E+++     G     E G G  L G+  RIDK+++   I
Sbjct: 237 TDAAEIKANLIAQLTSPVRWTESVKNMIADGANEFIECGPGAALQGMVSRIDKTMNVHGI 296

Query: 300 SK 301
             
Sbjct: 297 ES 298


>gi|299067018|emb|CBJ38213.1| Malonyl CoA-acyl carrier protein transacylase [Ralstonia
           solanacearum CMR15]
          Length = 309

 Score =  188 bits (476), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 128/313 (40%), Positives = 166/313 (53%), Gaps = 4/313 (1%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M+    FPGQGSQ +GM     D  P       E    L Q++  L+  G  +EL  T N
Sbjct: 1   MTFAFVFPGQGSQSVGMLNAFAD-HPVVAATLAEASDALGQDIGKLIAEGPADELNLTTN 59

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
            QP +   ++A  R  +  G       + VAGHSLGEY+AL AA A +  D + LVR R 
Sbjct: 60  TQPVMLTAAVAVYRAWQAAGG---PTPAVVAGHSLGEYSALVAAGAIAFKDAVPLVRFRA 116

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           K+MQEAVP G G M AI+GL D  V + CA+AS  G+ E  N N   QVVI+G + AV+ 
Sbjct: 117 KAMQEAVPVGEGGMAAILGLSDDDVRAACAEASSAGVVEAVNFNAPAQVVIAGAKAAVEK 176

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A +    KGAKRA+ LPVSAPFHSSL+ P S  ++  L  V    P + ++ N   + VS
Sbjct: 177 ACEIAKAKGAKRALPLPVSAPFHSSLLKPASDRLREYLSGVAVSAPAILVINNVDVALVS 236

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
               I   LV Q    VRW ET+Q     G+  V E G GKVL GL KRID  +   +I 
Sbjct: 237 DPAAIKDALVRQAASPVRWVETVQKMKADGIARVVECGPGKVLAGLTKRIDGDIVGDAIF 296

Query: 301 KVEDIDLALRSIV 313
               ++  L  + 
Sbjct: 297 DPASLEAVLVQLK 309


>gi|163868017|ref|YP_001609221.1| malonyl CoA-acyl carrier protein transacylase [Bartonella
           tribocorum CIP 105476]
 gi|161017668|emb|CAK01226.1| malonyl CoA-acyl carrier protein transacylase [Bartonella
           tribocorum CIP 105476]
          Length = 314

 Score =  188 bits (476), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 171/309 (55%), Positives = 221/309 (71%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M     FPGQGSQ++GMGR L + F  AR+VFEEVD  L + LS++++ G  + LT T N
Sbjct: 1   MGAAFIFPGQGSQLVGMGRALTEQFFAARMVFEEVDDALGEKLSEIIFEGPADVLTLTAN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
           AQPAL AVSMA IRVME+ GL ++  + +VAGHSLGEY+ALCAA   SL+DT RL+R RG
Sbjct: 61  AQPALMAVSMAVIRVMEQLGLRIEEKVKFVAGHSLGEYSALCAAGTLSLTDTARLLRIRG 120

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
            +MQ AV  G GSM A+IGL++ VV+ IC   S  G+C+IANDNGG Q+VISG   AV+ 
Sbjct: 121 NAMQAAVAVGEGSMAALIGLEEHVVEEICKIVSGEGLCQIANDNGGRQIVISGEAKAVET 180

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A +    KGAKRA+ LPVSAPFHSSLM P +  MK  L +V K  P+VP++ N    P S
Sbjct: 181 AVEIASTKGAKRALLLPVSAPFHSSLMQPAADAMKKALLTVNKNAPIVPLIANVSVEPES 240

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
             + I+ LL++QVTGRVRWRETI+W   +GV +++EVGSGKVLTGL +RI+K +   +I 
Sbjct: 241 DPERIATLLIQQVTGRVRWRETIEWIGANGVDTLFEVGSGKVLTGLTRRINKDIKGGTIG 300

Query: 301 KVEDIDLAL 309
            V++I+ AL
Sbjct: 301 TVDEIESAL 309


>gi|218549181|ref|YP_002382972.1| malonyl-CoA-[acyl-carrier-protein] transacylase [Escherichia
           fergusonii ATCC 35469]
 gi|218356722|emb|CAQ89350.1| malonyl-CoA-[acyl-carrier-protein] transacylase [Escherichia
           fergusonii ATCC 35469]
          Length = 309

 Score =  188 bits (476), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 128/311 (41%), Positives = 176/311 (56%), Gaps = 4/311 (1%)

Query: 1   MS-TVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATC 59
           M+     FPGQGSQ +GM  D+  ++P     F E    L  +L  L  NG  EEL  T 
Sbjct: 1   MTQFAFVFPGQGSQTVGMLADMAATYPIVEETFAEASAALGYDLWALTQNGPAEELNKTW 60

Query: 60  NAQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRAR 119
             QPAL   S+A  RV ++ G    +  + +AGHSLGEY+AL  A     +D +RLV  R
Sbjct: 61  QTQPALLTASVALYRVWQQQGG---KSPAMMAGHSLGEYSALVCAGVIDFADAVRLVEMR 117

Query: 120 GKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVK 179
           GK MQEAVP G G+M AIIGLDD  +   C +A+   +    N N  GQVVI+G ++AV+
Sbjct: 118 GKFMQEAVPEGTGAMAAIIGLDDASIAKACEEAAEGQVVSPVNFNSPGQVVIAGHKEAVE 177

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            A   C   GAKRA+ LPVS P H +LM P +  +   L  +T   P VP++ N      
Sbjct: 178 RAGAACKAAGAKRALPLPVSVPSHCALMKPAADKLAVELAKITFNTPTVPVVNNVDVKCE 237

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
           +  D I   LV Q+   V+W +++++ A  GV+ +YEVG GKVLTGL KRI  +L+A ++
Sbjct: 238 NEGDAIRDALVRQLYNPVQWTKSVEYMAAQGVEHLYEVGPGKVLTGLTKRIVDTLTASAL 297

Query: 300 SKVEDIDLALR 310
           ++   +  AL 
Sbjct: 298 NEPAAMSAALE 308


>gi|212635826|ref|YP_002312351.1| malonyl CoA-acyl carrier protein transacylase [Shewanella
           piezotolerans WP3]
 gi|212557310|gb|ACJ29764.1| Malonyl CoA-acyl carrier protein transacylase [Shewanella
           piezotolerans WP3]
          Length = 308

 Score =  188 bits (476), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 123/307 (40%), Positives = 169/307 (55%), Gaps = 3/307 (0%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
           +T   FPGQGSQ +GM  +L +S P     F +    L  +L +L+  G  E L  T   
Sbjct: 3   NTAFVFPGQGSQALGMLAELAESQPVVAETFAQASQVLGYDLWELVQQGPVETLNETDKT 62

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPAL A S+A  R    +G  +      +AGHSLGEY+AL  A        I+LV  RG+
Sbjct: 63  QPALLAASVAIYRAYIASGKTL---PKVMAGHSLGEYSALVCAGVIDFEAAIKLVELRGQ 119

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCA 181
            MQ+AVP G G+M AIIGLD+  +   C +AS+  +    N N  GQVVI+G + AV+ A
Sbjct: 120 LMQQAVPAGTGAMFAIIGLDNDAIAKACEEASQGDVVSPVNYNSPGQVVIAGEKAAVERA 179

Query: 182 ADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSS 241
           A  C   GAK AV LPVS P H  LM P +  +   L+ +    P V +L N   +   +
Sbjct: 180 AALCKENGAKMAVALPVSVPSHCQLMKPAADKLAIALNDIEFSAPSVTVLNNVDVASPVA 239

Query: 242 IDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISK 301
             EI   LV Q+   VRW ET++  A+ G+  ++E+G GKVLTGL+KRI++SL+A +I+ 
Sbjct: 240 EQEIKDALVRQLYCPVRWSETVELMASQGITDLFEIGPGKVLTGLSKRINRSLTAKAIND 299

Query: 302 VEDIDLA 308
                  
Sbjct: 300 AASFAAL 306


>gi|119944846|ref|YP_942526.1| malonyl CoA-acyl carrier protein transacylase [Psychromonas
           ingrahamii 37]
 gi|119863450|gb|ABM02927.1| [Acyl-carrier-protein] S-malonyltransferase [Psychromonas
           ingrahamii 37]
          Length = 313

 Score =  188 bits (476), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 120/310 (38%), Positives = 169/310 (54%), Gaps = 3/310 (0%)

Query: 5   LTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPA 64
             FPGQGSQ +GM  +L  S P     F++    L  +L DL+  G  E L  T   QPA
Sbjct: 6   FAFPGQGSQHVGMLAELAQSCPVVVETFKQASDVLGYDLWDLVQQGPAEILNQTDKTQPA 65

Query: 65  LTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQ 124
           L   S+A  RV  +         S +AGHSLGEY+AL  A      D ++LV  RG+ MQ
Sbjct: 66  LLTASVALWRVWAEQ---KGPTPSVIAGHSLGEYSALVCAGVIEFKDAVKLVELRGQLMQ 122

Query: 125 EAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAADT 184
           +AVP G G+M AIIGLD+  +   C QA+   I    N N  GQVVI+G ++AV+ A   
Sbjct: 123 QAVPAGTGAMSAIIGLDNNKIAECCVQAAEGQIVSPVNFNSPGQVVIAGNKEAVERAGIL 182

Query: 185 CLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSIDE 244
               GAKR + LPVS P H +LM P ++ +   L S+    P + ++ N      S +++
Sbjct: 183 LKEAGAKRVLPLPVSVPSHCALMKPAAEKLAVALQSIHFNTPNIAVINNVDVVAESDVEK 242

Query: 245 ISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVED 304
           I   LV Q+   VRW + ++  A+ G+    E G GKVL+GL +RI+KSL+A  I+    
Sbjct: 243 IKDALVRQLFCPVRWSDIVEKMASDGITIQVEAGPGKVLSGLVRRINKSLTAQVINDNAT 302

Query: 305 IDLALRSIVG 314
           ++ AL ++ G
Sbjct: 303 LEKALAAVKG 312


>gi|196018168|ref|XP_002118753.1| hypothetical protein TRIADDRAFT_34669 [Trichoplax adhaerens]
 gi|190578292|gb|EDV18756.1| hypothetical protein TRIADDRAFT_34669 [Trichoplax adhaerens]
          Length = 312

 Score =  188 bits (476), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 142/312 (45%), Positives = 200/312 (64%), Gaps = 2/312 (0%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M+T   +PGQGSQ +GMG+DLYD+F EA+ VFE V+  LNQNLSD+++NG  ++L  T N
Sbjct: 1   MNTAFIYPGQGSQYVGMGKDLYDNFFEAKEVFEIVNDALNQNLSDIIFNGDSDDLKITSN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRD-ISYVAGHSLGEYTALCAAKAFSLSDTIRLVRAR 119
            QPA+ A SMA  +V+         +  S  AGHSLGEY+ALCA ++  + +T +++RAR
Sbjct: 61  TQPAIMATSMAVFKVLISLSNKKITELCSISAGHSLGEYSALCATESIHMKNTAKILRAR 120

Query: 120 GKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVK 179
           G +MQ+AVP G G+M A+IG D+   + +C   S  G+CEIANDNGGGQ+++SG +DA K
Sbjct: 121 GNAMQKAVPIGKGAMYALIGGDEVAAEEVCKILSENGVCEIANDNGGGQIILSGDKDAFK 180

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
              +   N   ++A+ LPVSAPFHSSLM   ++VM   L     + P + ++ N+ A+  
Sbjct: 181 DINEVVKNFKIRKAIPLPVSAPFHSSLMKEATEVMSQELAKYNFEAPKIDVIANYSANVY 240

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANH-GVKSVYEVGSGKVLTGLAKRIDKSLSAVS 298
            S +EI  LLV+Q+ G+VRWRETI    N   ++   EVG G VLT L KR  K +   S
Sbjct: 241 QSKEEIKDLLVKQIEGKVRWRETIAKMYNEFSIRKFVEVGPGNVLTNLIKREYKDVEVYS 300

Query: 299 ISKVEDIDLALR 310
           +    DI+  L+
Sbjct: 301 LQTANDIENFLK 312


>gi|117921000|ref|YP_870192.1| [Acyl-carrier-protein] S-malonyltransferase [Shewanella sp. ANA-3]
 gi|117613332|gb|ABK48786.1| [Acyl-carrier-protein] S-malonyltransferase [Shewanella sp. ANA-3]
          Length = 308

 Score =  188 bits (476), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 122/307 (39%), Positives = 170/307 (55%), Gaps = 3/307 (0%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
           +    FPGQGSQ +GM  +L  + P     F E    L  +L  L+ +G  E L  T   
Sbjct: 3   NVAFVFPGQGSQALGMLAELAGAQPIVGQTFAEASEVLGYDLWALVQDGPAETLNETDKT 62

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPAL A S+A            K   + +AGHSLGEY+AL  A      D I+LV  RG+
Sbjct: 63  QPALLAASVAI---WRAYVASGKAMPAMLAGHSLGEYSALVCAGVIDFKDAIKLVELRGQ 119

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCA 181
            MQ+AVP G G+M AIIGLD+  + + C +A++  +    N N  GQVVI+G ++AV+ A
Sbjct: 120 LMQQAVPAGTGAMYAIIGLDNDGIANACIEAAQDEVVSPVNFNSPGQVVIAGQKEAVERA 179

Query: 182 ADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSS 241
           A  C   GAK AV LPVS P H +LM P +  +   L+ V    P + ++ N   +  ++
Sbjct: 180 AAACKAAGAKMAVALPVSVPSHCALMKPAADKLAVALNDVQFNAPSITVINNVDVASPTA 239

Query: 242 IDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISK 301
           + +I   LV Q+   VRW ET++  A  G+  + E G GKVLTGLAKRI+KSLSA +++ 
Sbjct: 240 VADIKDALVRQLYCPVRWSETVELMAEKGITQLVECGPGKVLTGLAKRINKSLSAQAVND 299

Query: 302 VEDIDLA 308
           V  +   
Sbjct: 300 VASLAAL 306


>gi|22125651|ref|NP_669074.1| malonyl CoA-acyl carrier protein transacylase [Yersinia pestis KIM
           10]
 gi|45442046|ref|NP_993585.1| malonyl CoA-acyl carrier protein transacylase [Yersinia pestis
           biovar Microtus str. 91001]
 gi|51596794|ref|YP_070985.1| acyl carrier protein S-malonyltransferase [Yersinia
           pseudotuberculosis IP 32953]
 gi|108807922|ref|YP_651838.1| malonyl CoA-acyl carrier protein transacylase [Yersinia pestis
           Antiqua]
 gi|108812193|ref|YP_647960.1| malonyl CoA-acyl carrier protein transacylase [Yersinia pestis
           Nepal516]
 gi|145599131|ref|YP_001163207.1| malonyl CoA-acyl carrier protein transacylase [Yersinia pestis
           Pestoides F]
 gi|149366514|ref|ZP_01888548.1| malonyl CoA-acyl carrier protein transacylase [Yersinia pestis
           CA88-4125]
 gi|162421833|ref|YP_001607830.1| malonyl CoA-acyl carrier protein transacylase [Yersinia pestis
           Angola]
 gi|165925630|ref|ZP_02221462.1| malonyl CoA-acyl carrier protein transacylase [Yersinia pestis
           biovar Orientalis str. F1991016]
 gi|165938481|ref|ZP_02227038.1| malonyl CoA-acyl carrier protein transacylase [Yersinia pestis
           biovar Orientalis str. IP275]
 gi|166008167|ref|ZP_02229065.1| malonyl CoA-acyl carrier protein transacylase [Yersinia pestis
           biovar Antiqua str. E1979001]
 gi|167401709|ref|ZP_02307200.1| malonyl CoA-acyl carrier protein transacylase [Yersinia pestis
           biovar Antiqua str. UG05-0454]
 gi|167421775|ref|ZP_02313528.1| malonyl CoA-acyl carrier protein transacylase [Yersinia pestis
           biovar Orientalis str. MG05-1020]
 gi|167427070|ref|ZP_02318823.1| malonyl CoA-acyl carrier protein transacylase [Yersinia pestis
           biovar Mediaevalis str. K1973002]
 gi|170023926|ref|YP_001720431.1| malonyl CoA-acyl carrier protein transacylase [Yersinia
           pseudotuberculosis YPIII]
 gi|186895865|ref|YP_001872977.1| malonyl CoA-acyl carrier protein transacylase [Yersinia
           pseudotuberculosis PB1/+]
 gi|218928734|ref|YP_002346609.1| malonyl CoA-acyl carrier protein transacylase [Yersinia pestis
           CO92]
 gi|229843698|ref|ZP_04463841.1| malonyl-CoA-[acyl-carrier-protein] transacylase [Yersinia pestis
           biovar Orientalis str. India 195]
 gi|229894442|ref|ZP_04509624.1| malonyl-CoA-[acyl-carrier-protein] transacylase [Yersinia pestis
           Pestoides A]
 gi|229902518|ref|ZP_04517637.1| malonyl-CoA-[acyl-carrier-protein] transacylase [Yersinia pestis
           Nepal516]
 gi|270490305|ref|ZP_06207379.1| hypothetical protein
 gi|294504200|ref|YP_003568262.1| acyl carrier protein S-malonyltransferase [Yersinia pestis Z176003]
 gi|21958562|gb|AAM85325.1|AE013778_11 malonyl-CoA-[acyl-carrier-protein] transacylase [Yersinia pestis
           KIM 10]
 gi|45436909|gb|AAS62462.1| malonyl CoA-acyl carrier protein transacylase [Yersinia pestis
           biovar Microtus str. 91001]
 gi|51590076|emb|CAH21710.1| malonyl CoA-acyl carrier protein transacylase [Yersinia
           pseudotuberculosis IP 32953]
 gi|108775841|gb|ABG18360.1| [Acyl-carrier-protein] S-malonyltransferase [Yersinia pestis
           Nepal516]
 gi|108779835|gb|ABG13893.1| [Acyl-carrier-protein] S-malonyltransferase [Yersinia pestis
           Antiqua]
 gi|115347345|emb|CAL20243.1| malonyl CoA-acyl carrier protein transacylase [Yersinia pestis
           CO92]
 gi|145210827|gb|ABP40234.1| [Acyl-carrier-protein] S-malonyltransferase [Yersinia pestis
           Pestoides F]
 gi|149290888|gb|EDM40963.1| malonyl CoA-acyl carrier protein transacylase [Yersinia pestis
           CA88-4125]
 gi|162354648|gb|ABX88596.1| malonyl CoA-acyl carrier protein transacylase [Yersinia pestis
           Angola]
 gi|165913596|gb|EDR32216.1| malonyl CoA-acyl carrier protein transacylase [Yersinia pestis
           biovar Orientalis str. IP275]
 gi|165922739|gb|EDR39890.1| malonyl CoA-acyl carrier protein transacylase [Yersinia pestis
           biovar Orientalis str. F1991016]
 gi|165992549|gb|EDR44850.1| malonyl CoA-acyl carrier protein transacylase [Yersinia pestis
           biovar Antiqua str. E1979001]
 gi|166960260|gb|EDR56281.1| malonyl CoA-acyl carrier protein transacylase [Yersinia pestis
           biovar Orientalis str. MG05-1020]
 gi|167048814|gb|EDR60222.1| malonyl CoA-acyl carrier protein transacylase [Yersinia pestis
           biovar Antiqua str. UG05-0454]
 gi|167053914|gb|EDR63746.1| malonyl CoA-acyl carrier protein transacylase [Yersinia pestis
           biovar Mediaevalis str. K1973002]
 gi|169750460|gb|ACA67978.1| malonyl CoA-acyl carrier protein transacylase [Yersinia
           pseudotuberculosis YPIII]
 gi|186698891|gb|ACC89520.1| malonyl CoA-acyl carrier protein transacylase [Yersinia
           pseudotuberculosis PB1/+]
 gi|229680564|gb|EEO76661.1| malonyl-CoA-[acyl-carrier-protein] transacylase [Yersinia pestis
           Nepal516]
 gi|229689306|gb|EEO81369.1| malonyl-CoA-[acyl-carrier-protein] transacylase [Yersinia pestis
           biovar Orientalis str. India 195]
 gi|229703461|gb|EEO90478.1| malonyl-CoA-[acyl-carrier-protein] transacylase [Yersinia pestis
           Pestoides A]
 gi|262366251|gb|ACY62808.1| acyl carrier protein S-malonyltransferase [Yersinia pestis D182038]
 gi|270338809|gb|EFA49586.1| [acyl-carrier-protein] S-malonyltransferase [Yersinia pestis KIM
           D27]
 gi|294354659|gb|ADE65000.1| acyl carrier protein S-malonyltransferase [Yersinia pestis Z176003]
 gi|320014738|gb|ADV98309.1| malonyl-CoA-[acyl-carrier-protein] transacylase [Yersinia pestis
           biovar Medievalis str. Harbin 35]
          Length = 309

 Score =  188 bits (476), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 126/309 (40%), Positives = 172/309 (55%), Gaps = 3/309 (0%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
              + FPGQGSQ +GM  DL   FP     F E    L  +L  L+  G  EEL  T   
Sbjct: 3   KFAMVFPGQGSQSLGMLADLAAQFPIVEATFSEASSVLGYDLWQLVQQGPAEELNKTWQT 62

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPAL   S+A  R+ +  G  +    S +AGHSLGEY+AL  A        + LV  RGK
Sbjct: 63  QPALLTASVAIWRIWQHQGGKL---PSLMAGHSLGEYSALVCAGVLDFKQAVSLVELRGK 119

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCA 181
            MQEAVP G G+M AIIGLD+  +   C ++++  +    N N  GQVVI+G +DAV+ A
Sbjct: 120 LMQEAVPEGTGAMYAIIGLDNESIAKACEESAQGQVVSPVNFNSPGQVVIAGNKDAVERA 179

Query: 182 ADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSS 241
              C   GAKRA+ LPVS P H +LM P +  +   L+ +  Q+P+ P++ N       S
Sbjct: 180 GAACKAAGAKRALPLPVSVPSHCALMKPAADKLAVALEKIDFQEPLFPVVNNVDVKAEVS 239

Query: 242 IDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISK 301
              I   LV Q+   VRW E++++ A  GV+ + E+G GKVLTGL KRI  SL+A +++ 
Sbjct: 240 PVAIRSALVRQLYNPVRWTESVEFIAAEGVELLLEIGPGKVLTGLTKRIVDSLAAAAVND 299

Query: 302 VEDIDLALR 310
           V  ++ AL 
Sbjct: 300 VVTLNSALE 308


>gi|294102054|ref|YP_003553912.1| malonyl CoA-acyl carrier protein transacylase [Aminobacterium
           colombiense DSM 12261]
 gi|293617034|gb|ADE57188.1| malonyl CoA-acyl carrier protein transacylase [Aminobacterium
           colombiense DSM 12261]
          Length = 317

 Score =  187 bits (475), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 134/312 (42%), Positives = 189/312 (60%), Gaps = 2/312 (0%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M   L FPGQG+Q +GMG+ LYD+F  AR VF++ DH LN  LS L++ G +E+LT T  
Sbjct: 1   MRYALVFPGQGAQEVGMGKSLYDTFDAARDVFQKADHALNFKLSQLIFEGPEEKLTLTAF 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
            QPA+   S+A  RV+ ++ + V    +++AGHSLGEYTAL AA A SL D +RLV  RG
Sbjct: 61  TQPAILTASIAAYRVLTES-MGVSLKPAFLAGHSLGEYTALVAAGALSLEDGVRLVHLRG 119

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
             MQEAVP G G+M A+IGL+  VV+ +C + +    C+ AN N  GQVVISG    V+ 
Sbjct: 120 SLMQEAVPEGKGAMAALIGLEPDVVEEVCRRVAPNKECQAANFNSPGQVVISGETSFVEK 179

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A +    +GA++AV L VSAPFHS+LM PV+  ++   +      P  PI+ N  A PV 
Sbjct: 180 AVEEAKVQGARKAVMLKVSAPFHSNLMVPVADQLQKAFEKCQWNLPHCPIVANVSAQPVF 239

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
           ++++I + L  Q    V W +++ + A+  V +  E+G G VL GL KR  K L   S  
Sbjct: 240 TVEDIQKALFHQTYSPVLWADSVLYMASQEVDTYLELGPGTVLAGLIKRCQKGLKTYSAM 299

Query: 301 KVEDIDLALRSI 312
             ED+   + ++
Sbjct: 300 NEEDL-RIIAAL 310


>gi|293364842|ref|ZP_06611559.1| malonyl CoA-acyl carrier protein transacylase [Streptococcus oralis
           ATCC 35037]
 gi|307703091|ref|ZP_07640038.1| malonyl CoA-acyl carrier protein transacylase [Streptococcus oralis
           ATCC 35037]
 gi|291316292|gb|EFE56728.1| malonyl CoA-acyl carrier protein transacylase [Streptococcus oralis
           ATCC 35037]
 gi|307623484|gb|EFO02474.1| malonyl CoA-acyl carrier protein transacylase [Streptococcus oralis
           ATCC 35037]
          Length = 306

 Score =  187 bits (475), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 114/308 (37%), Positives = 161/308 (52%), Gaps = 6/308 (1%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
            T   F GQG+Q +GMGRDLYD +P  +   ++    L  +L DL+ +  + +L  T   
Sbjct: 3   KTAFLFAGQGAQYLGMGRDLYDRYPIVKETIDQASQVLGYDLRDLI-DKEETKLNQTRYT 61

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPA+ A S+A  R++++ G         VAG SLGEY+AL A+ A    D + LV  RG 
Sbjct: 62  QPAILATSVAIYRLLKEKGY----QPDMVAGLSLGEYSALVASGALDFEDAVALVAKRGA 117

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCA 181
            MQEA P G G MVA++     V++  C  AS+VG+   AN N   Q+VI G   AV  A
Sbjct: 118 YMQEAAPAGSGKMVAVLNTPVEVIEEACETASKVGVVTPANYNTPSQIVIGGEVAAVDRA 177

Query: 182 ADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSS 241
            +     GAKR + L VS PFH++L+ P S+ +   L+ V   D     L     + V  
Sbjct: 178 VELLQEVGAKRLIPLNVSGPFHTALLEPASQQLAGALEGVNFSD-FTCPLVGNTEAAVME 236

Query: 242 IDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISK 301
              I  LL  QV   VR+ E+I    + GV +  E+G GKVL+G  K+IDK+    ++  
Sbjct: 237 KGRIQELLTRQVKEPVRFYESIAVMQDAGVTNFIEIGPGKVLSGFVKKIDKTAQLANVED 296

Query: 302 VEDIDLAL 309
              +D  L
Sbjct: 297 QASLDALL 304


>gi|99080891|ref|YP_613045.1| [Acyl-carrier-protein] S-malonyltransferase [Ruegeria sp. TM1040]
 gi|99037171|gb|ABF63783.1| [Acyl-carrier-protein] S-malonyltransferase [Ruegeria sp. TM1040]
          Length = 311

 Score =  187 bits (475), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 149/309 (48%), Positives = 201/309 (65%), Gaps = 2/309 (0%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           MS    FPGQG+Q IGMG+ L +++P A+ VF EVD  L ++LS L+W G  E LT T N
Sbjct: 1   MSIAFVFPGQGAQTIGMGKALAEAYPAAKAVFNEVDEALGESLSHLIWEGDIETLTLTQN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
           AQPAL A SMA +R +E  G+ +    ++VAGHSLGEY+AL AA A S++DT RL+R RG
Sbjct: 61  AQPALMATSMAAMRALEAEGVSID-KAAFVAGHSLGEYSALAAAGALSIADTARLLRTRG 119

Query: 121 KSMQEAVPPGLGSMVAIIGLD-DCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVK 179
           ++MQ AVP G+G+M A++GLD + V       A+   + + ANDN   QVV+SG + AV+
Sbjct: 120 QAMQSAVPVGVGAMAALLGLDFETVKAVAAEAAAEGEVVQAANDNDPTQVVVSGHKAAVE 179

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            AA+    KGAKRAV LPVSAPFH +LM P + VM   L  V  + P VP++ N  A  V
Sbjct: 180 RAAEIAKEKGAKRAVMLPVSAPFHCALMQPAADVMAEALAGVEIKAPAVPLIANVRADAV 239

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
           +  D I  LLVEQVTG VRWRE++   A  GV   +E+G+GK L+G+ ++ID+SL +  +
Sbjct: 240 TDPDTIRALLVEQVTGSVRWRESVAAMAAKGVTEFWEIGAGKALSGMIRKIDRSLVSKQV 299

Query: 300 SKVEDIDLA 308
               D+   
Sbjct: 300 GTDADVKAV 308


>gi|153948636|ref|YP_001400554.1| malonyl CoA-acyl carrier protein transacylase [Yersinia
           pseudotuberculosis IP 31758]
 gi|152960131|gb|ABS47592.1| malonyl CoA-acyl carrier protein transacylase [Yersinia
           pseudotuberculosis IP 31758]
          Length = 309

 Score =  187 bits (475), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 126/309 (40%), Positives = 172/309 (55%), Gaps = 3/309 (0%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
              + FPGQGSQ +GM  DL   FP     F E    L  +L  L+  G  EEL  T   
Sbjct: 3   KFAMVFPGQGSQSLGMLADLAAQFPIVEATFSEASSVLGYDLWQLVQQGPAEELNKTWQT 62

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPAL   S+A  R+ +  G  +    S +AGHSLGEY+AL  A        + LV  RGK
Sbjct: 63  QPALLTASVAIWRIWQHQGGKL---PSLMAGHSLGEYSALVCAGVLDFKQAVSLVELRGK 119

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCA 181
            MQEAVP G G+M AIIGLD+  +   C ++++  +    N N  GQVVI+G +DAV+ A
Sbjct: 120 LMQEAVPEGTGAMYAIIGLDNESIAKACEESAQGQVVSPVNFNSPGQVVIAGNKDAVERA 179

Query: 182 ADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSS 241
              C   GAKRA+ LPVS P H +LM P +  +   L+ +  Q+P+ P++ N       S
Sbjct: 180 GAACKAAGAKRALPLPVSVPSHCALMKPAADKLAVALEKIDFQEPLFPVVNNVDVKAEVS 239

Query: 242 IDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISK 301
              I   LV Q+   VRW E++++ A  GV+ + E+G GKVLTGL KRI  SL+A +++ 
Sbjct: 240 PAAIRSALVRQLYNPVRWTESVEFIAAEGVELLLEIGPGKVLTGLTKRIVDSLAAAAVND 299

Query: 302 VEDIDLALR 310
           V  ++ AL 
Sbjct: 300 VVTLNSALE 308


>gi|293391072|ref|ZP_06635406.1| malonyl CoA-acyl carrier protein transacylase [Aggregatibacter
           actinomycetemcomitans D7S-1]
 gi|290951606|gb|EFE01725.1| malonyl CoA-acyl carrier protein transacylase [Aggregatibacter
           actinomycetemcomitans D7S-1]
          Length = 312

 Score =  187 bits (475), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 128/306 (41%), Positives = 174/306 (56%), Gaps = 2/306 (0%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
              + FPGQGSQ +GM  +L   +P  +  F++    L  +L  L+  G  EEL  T   
Sbjct: 3   KFAMVFPGQGSQAVGMLAELAVEYPVVQDTFKQASEALGYDLWQLVQQGPAEELNKTWQT 62

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPAL A S+A  RV ++     +     +AGHSLGEY+AL  A      D ++LV  RGK
Sbjct: 63  QPALLAASVAIYRVWQE--KYPQLKPEVMAGHSLGEYSALVCAGVLDFQDAVKLVELRGK 120

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCA 181
            MQ+AVP G G+M AIIGLD+  + + C QA +  +    N N  GQVVI+G + AV+ A
Sbjct: 121 LMQQAVPEGTGAMYAIIGLDNEAIINACKQAEQGEVVSAVNFNSPGQVVIAGAKAAVERA 180

Query: 182 ADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSS 241
           A  C   GAKRA+ L VS P H +LM P +  +   L+S+T + P V +L N      S 
Sbjct: 181 AALCKEAGAKRALPLAVSVPSHCALMKPAADQLSVSLESITLKAPSVAVLNNVDVKGESE 240

Query: 242 IDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISK 301
            + I   LV Q+   VRW ET+Q  A +GV+ + E+G GKVL GL KRI  SL AVS++ 
Sbjct: 241 AEAIRHALVRQLYSPVRWTETVQKMAGNGVEVLVEIGPGKVLNGLTKRIVDSLQAVSVND 300

Query: 302 VEDIDL 307
           V+ +D 
Sbjct: 301 VKSLDS 306


>gi|50120729|ref|YP_049896.1| acyl carrier protein S-malonyltransferase [Pectobacterium
           atrosepticum SCRI1043]
 gi|49611255|emb|CAG74701.1| malonyl CoA-acyl carrier protein transacylase [Pectobacterium
           atrosepticum SCRI1043]
          Length = 309

 Score =  187 bits (475), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 126/311 (40%), Positives = 179/311 (57%), Gaps = 4/311 (1%)

Query: 1   MS-TVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATC 59
           M+   + FPGQGSQ +GM  +L   +P     F +    L  +L  L   G  EEL  T 
Sbjct: 1   MTQFAMVFPGQGSQTVGMLAELAAEYPVVTETFAQASEVLGYDLWQLTQQGPAEELNKTW 60

Query: 60  NAQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRAR 119
             QP L   S+A  R  ++ G    +  + ++GHSLGEY+AL  A       T+RLV  R
Sbjct: 61  QTQPVLLTASVAIWRAWQQQGG---KTPALMSGHSLGEYSALVCAGVLDFQQTVRLVELR 117

Query: 120 GKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVK 179
           GK MQEAVP G G+M AIIGLD+  +   C ++++  +    N N  GQVVI+G +DAV+
Sbjct: 118 GKLMQEAVPEGTGAMYAIIGLDNDAIAKACEESAQGQVVSPVNFNSPGQVVIAGNKDAVE 177

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            A   C   GAKRA+ LPVS P H +LM P +K +   L+SVT   PV+P++ N  AS  
Sbjct: 178 RAGAACKAAGAKRALPLPVSVPSHCALMEPAAKKLSVALESVTFNSPVIPVVNNVDASIE 237

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
           ++ + I   LV Q+   VRW + +++ A+ GV+S+ EVG GKVLTGL KRI  +L+A ++
Sbjct: 238 TTPEAIRNALVRQLHCPVRWTDCVEFMASQGVESLLEVGPGKVLTGLTKRIVDTLTAAAV 297

Query: 300 SKVEDIDLALR 310
           +    +  A+ 
Sbjct: 298 NDPASLSAAIE 308


>gi|217973737|ref|YP_002358488.1| malonyl CoA-acyl carrier protein transacylase [Shewanella baltica
           OS223]
 gi|217498872|gb|ACK47065.1| malonyl CoA-acyl carrier protein transacylase [Shewanella baltica
           OS223]
          Length = 308

 Score =  187 bits (475), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 126/307 (41%), Positives = 169/307 (55%), Gaps = 3/307 (0%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
           +    FPGQGSQ +GM  +L +S       F E    L  +L  L+  G  E L  T   
Sbjct: 3   NVAFVFPGQGSQALGMLAELAESHAVVGQTFAEASDVLGYDLWALVQQGPVESLNETDKT 62

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPAL A S+A            K   + VAGHSLGEY+AL  A      D I+LV  RG+
Sbjct: 63  QPALLAASVAI---WRAYVASGKPMPAMVAGHSLGEYSALVCAGVMDFKDAIKLVELRGQ 119

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCA 181
            MQ+AVP G G+M AIIGLD+  + + CA+A++  +    N N  GQVVI+G +DAV+ A
Sbjct: 120 LMQQAVPAGTGAMYAIIGLDNEGIANACAEAAQGDVVSPVNFNSPGQVVIAGQKDAVERA 179

Query: 182 ADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSS 241
           A  C   GAK AV LPVS P H +LM P +  +   L+ V    P + ++ N   +  +S
Sbjct: 180 AAACKAAGAKMAVALPVSVPSHCALMKPAADKLAVALNDVQFNPPTITVINNVDVASPTS 239

Query: 242 IDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISK 301
             +I   LV Q+   VRW ET++  A  G+  + E G GKVLTGLAKRI+KSLSA +++ 
Sbjct: 240 AADIKDALVRQLYCPVRWSETVELMAQKGITQLVECGPGKVLTGLAKRINKSLSAQAVND 299

Query: 302 VEDIDLA 308
           V  +   
Sbjct: 300 VASLAAL 306


>gi|332652380|ref|ZP_08418125.1| malonyl CoA-acyl carrier protein transacylase [Ruminococcaceae
           bacterium D16]
 gi|332517526|gb|EGJ47129.1| malonyl CoA-acyl carrier protein transacylase [Ruminococcaceae
           bacterium D16]
          Length = 314

 Score =  187 bits (475), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 105/313 (33%), Positives = 160/313 (51%), Gaps = 6/313 (1%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
                + GQG+Q +GMGRDLY+ +P  R V +     ++ +L  L ++G +++L  T   
Sbjct: 7   KLAFLYAGQGAQHVGMGRDLYEIYPAFRQVLD--SAPVDFDLKKLCFDGPEDQLNDTRYT 64

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QP + A +     ++ + G+       Y AG SLGEY+AL  A  F     I LV  RG+
Sbjct: 65  QPCMVAFAAGVTALLREAGIT----PDYAAGLSLGEYSALQCAGVFDAKTAISLVAFRGQ 120

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCA 181
           +M +AV      M A++G+D   + ++CA+AS  G+ E  N N  GQ+VISG   AV  A
Sbjct: 121 AMADAVQGRPCGMAAVLGMDRDALKAVCAEASDAGVVECTNFNCPGQIVISGDAAAVDKA 180

Query: 182 ADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSS 241
            +     GAKR + L VS PFH+SLM P    ++    SV      +P+L N        
Sbjct: 181 GELAKAAGAKRVLPLKVSGPFHTSLMAPAGDALREKFQSVDFGAMEIPVLFNCLGDLKGE 240

Query: 242 IDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISK 301
            D I  LL +QV   V   +TI+     GV +V E+G G+ L+G  K+  K +    +  
Sbjct: 241 ADTIPNLLEQQVQSSVYLEDTIRRLGELGVDTVVEIGPGRTLSGFVKKTVKGIKCYPVET 300

Query: 302 VEDIDLALRSIVG 314
            E++  A+ ++ G
Sbjct: 301 AEELQAAIAALRG 313


>gi|257462239|ref|ZP_05626656.1| malonyl-CoA-[acyl-carrier-protein] transacylase [Fusobacterium sp.
           D12]
 gi|317059908|ref|ZP_07924393.1| malonyl-CoA-[acyl-carrier-protein] transacylase [Fusobacterium sp.
           D12]
 gi|313685584|gb|EFS22419.1| malonyl-CoA-[acyl-carrier-protein] transacylase [Fusobacterium sp.
           D12]
          Length = 304

 Score =  187 bits (475), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 107/308 (34%), Positives = 175/308 (56%), Gaps = 6/308 (1%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
                FPGQG+Q IGMG+DLY+  P+A+ V + +  +L+ +L  +M+ G+ E+L  T   
Sbjct: 3   KVAFVFPGQGTQYIGMGKDLYEKSPKAKEVMDTMFQSLDFDLKSIMFEGTAEDLKQTKYT 62

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPA+ A S+  + ++++ G+       YVAGHS+GEY A  AA   SL + IRL  ARG+
Sbjct: 63  QPAIVAFSLTLLELVKEKGI----KADYVAGHSVGEYAAYGAAGMLSLEEAIRLTAARGQ 118

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCA 181
            M +      G+M A++G+    +  + ++   V   E  N N   Q VI+G + AV+ A
Sbjct: 119 IMNDVSEKVKGTMAAVLGMSAEKIQEVLSRVEGV--VEAVNFNEPNQTVIAGEKAAVEAA 176

Query: 182 ADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSS 241
                  GA+RA+ L VS PFHSSLM    + +K   +        + ++ N  A  ++S
Sbjct: 177 CLALKEAGARRALPLAVSGPFHSSLMKEAGEKLKEEAEKYHFSMTDIGLVANTTAEVLTS 236

Query: 242 IDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISK 301
           ++E+   +  Q  G V W +TI++ A  GV ++YE+G GKVL+GL K+I++ ++  +I  
Sbjct: 237 VEEVKDEIYHQSFGPVYWVKTIEYLAATGVDTIYEIGPGKVLSGLIKKINREITVKNIET 296

Query: 302 VEDIDLAL 309
           +E+I+  +
Sbjct: 297 LEEIENLM 304


>gi|307246931|ref|ZP_07528996.1| Malonyl CoA-acyl carrier protein transacylase [Actinobacillus
           pleuropneumoniae serovar 1 str. 4074]
 gi|307255913|ref|ZP_07537714.1| Malonyl CoA-acyl carrier protein transacylase [Actinobacillus
           pleuropneumoniae serovar 9 str. CVJ13261]
 gi|307260366|ref|ZP_07542073.1| Malonyl CoA-acyl carrier protein transacylase [Actinobacillus
           pleuropneumoniae serovar 11 str. 56153]
 gi|306852216|gb|EFM84456.1| Malonyl CoA-acyl carrier protein transacylase [Actinobacillus
           pleuropneumoniae serovar 1 str. 4074]
 gi|306861181|gb|EFM93174.1| Malonyl CoA-acyl carrier protein transacylase [Actinobacillus
           pleuropneumoniae serovar 9 str. CVJ13261]
 gi|306865617|gb|EFM97498.1| Malonyl CoA-acyl carrier protein transacylase [Actinobacillus
           pleuropneumoniae serovar 11 str. 56153]
          Length = 311

 Score =  187 bits (475), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 122/311 (39%), Positives = 170/311 (54%), Gaps = 5/311 (1%)

Query: 1   MS-TVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATC 59
           MS   + FPGQGSQ +GM  DL  ++P     F++    L  +L DL+ NGS E+L  T 
Sbjct: 1   MSNFAMVFPGQGSQAVGMLADLATAYPIVEETFKQASDVLGYDLWDLVQNGSAEDLGQTQ 60

Query: 60  NAQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRAR 119
             QPAL A S+A  RV ++     +   S +AGHSLGEY+AL  A      D I+LV  R
Sbjct: 61  RTQPALLASSVAIYRVWQQ--KYPELKPSVMAGHSLGEYSALVCAGVLDFQDAIKLVELR 118

Query: 120 GKSMQEAVP--PGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDA 177
           G +MQ+AVP   G    +  +  +  +     AQA    I    N N  GQVVI+G + A
Sbjct: 119 GNAMQQAVPAGTGAMYAIIGLDNEAIINACEQAQAEVGEIVSAVNFNSPGQVVIAGTKAA 178

Query: 178 VKCAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCAS 237
            + A + C   GAKRA+ L VS P H +LM P +  +   L ++T   PVVP++ N   S
Sbjct: 179 AEKAGELCKAAGAKRALPLAVSVPSHCALMKPAADKLAEALQNITLNAPVVPVINNVDVS 238

Query: 238 PVSSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAV 297
             +  + I   LV Q+   VRW ET++  AN GV ++YE+G GKVLTGL  RI K L A 
Sbjct: 239 VETDAEAIRNALVRQLYSPVRWTETVEKMANEGVTTLYEIGPGKVLTGLTSRIVKELKAQ 298

Query: 298 SISKVEDIDLA 308
           +++ +  ++  
Sbjct: 299 AVNDLVSLEAV 309


>gi|261822063|ref|YP_003260169.1| malonyl CoA-acyl carrier protein transacylase [Pectobacterium
           wasabiae WPP163]
 gi|261606076|gb|ACX88562.1| malonyl CoA-acyl carrier protein transacylase [Pectobacterium
           wasabiae WPP163]
          Length = 309

 Score =  187 bits (475), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 125/311 (40%), Positives = 176/311 (56%), Gaps = 4/311 (1%)

Query: 1   MS-TVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATC 59
           M+   + FPGQGSQ +GM  +L   +P     F +    L  +L  L   G  EEL  T 
Sbjct: 1   MTQFAMVFPGQGSQTVGMLAELAAEYPIVTETFAQASEALGYDLWQLTQQGPAEELNKTW 60

Query: 60  NAQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRAR 119
             QPAL   S+A  R  ++ G    +    ++GHSLGEY+AL  A        +RLV  R
Sbjct: 61  QTQPALLTASVAIWRAWQQQGG---KTPVLMSGHSLGEYSALVCAGVLDFQQAVRLVELR 117

Query: 120 GKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVK 179
           GK MQEAVP G G+M AIIGLD+  +   C  +++  +    N N  GQVVI+G +DAV+
Sbjct: 118 GKLMQEAVPEGTGAMYAIIGLDNDAIAKACEGSAQGQVVSPVNFNSPGQVVIAGNKDAVE 177

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            A   C   GAKRA+ LPVS P H +LM P +K +   L+SV    PV+P++ N  A   
Sbjct: 178 RAGAACKAAGAKRALPLPVSVPSHCALMEPAAKKLAVALESVAFNSPVIPVVNNVDARIE 237

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
           ++ + I   LV Q+   VRW + +++ A+ GV+S+ EVG GKVLTGL KRI  +L+AV++
Sbjct: 238 TTPEAIRDALVRQLHCPVRWTDCVEFMASQGVESLLEVGPGKVLTGLTKRIVDTLTAVAV 297

Query: 300 SKVEDIDLALR 310
           +    +  A+ 
Sbjct: 298 NDPASLSAAIE 308


>gi|153000240|ref|YP_001365921.1| malonyl CoA-acyl carrier protein transacylase [Shewanella baltica
           OS185]
 gi|160874873|ref|YP_001554189.1| malonyl CoA-acyl carrier protein transacylase [Shewanella baltica
           OS195]
 gi|151364858|gb|ABS07858.1| malonyl CoA-acyl carrier protein transacylase [Shewanella baltica
           OS185]
 gi|160860395|gb|ABX48929.1| malonyl CoA-acyl carrier protein transacylase [Shewanella baltica
           OS195]
 gi|315267109|gb|ADT93962.1| malonyl CoA-acyl carrier protein transacylase [Shewanella baltica
           OS678]
          Length = 308

 Score =  187 bits (475), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 126/307 (41%), Positives = 170/307 (55%), Gaps = 3/307 (0%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
           +    FPGQGSQ +GM  +L +S       F E    L  +L  L+  G  E L  T   
Sbjct: 3   NVAFVFPGQGSQALGMLAELAESHAVVGQTFAEASDVLGYDLWALVQQGPVESLNETDKT 62

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPAL A S+A            K   + +AGHSLGEY+AL  A      D I+LV  RG+
Sbjct: 63  QPALLAASVAI---WRAYVASGKPMPAMLAGHSLGEYSALVCAGVMDFKDAIKLVELRGQ 119

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCA 181
            MQ+AVP G G+M AIIGLD+  + + CA+A++  +    N N  GQVVI+G +DAV+ A
Sbjct: 120 LMQQAVPAGTGAMYAIIGLDNEGIANACAEAAQGDVVSPVNFNSPGQVVIAGQKDAVERA 179

Query: 182 ADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSS 241
           A  C   GAK AV LPVS P H +LM P +  +   L+ V    P + ++ N   +  +S
Sbjct: 180 AAACKAAGAKMAVALPVSVPSHCALMKPAADKLAVALNDVQFNAPTITVINNVDVASPTS 239

Query: 242 IDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISK 301
            D+I   LV Q+   VRW ET++  A  G+  + E G GKVLTGLAKRI+KSLSA +++ 
Sbjct: 240 ADDIKDALVRQLYCPVRWSETVELMAQKGITQLVECGPGKVLTGLAKRINKSLSAQAVND 299

Query: 302 VEDIDLA 308
           V  +   
Sbjct: 300 VASLAAL 306


>gi|57233934|ref|YP_181988.1| malonyl CoA-acyl carrier protein transacylase [Dehalococcoides
           ethenogenes 195]
 gi|57224382|gb|AAW39439.1| malonyl CoA-acyl carrier protein transacylase [Dehalococcoides
           ethenogenes 195]
          Length = 310

 Score =  187 bits (475), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 119/308 (38%), Positives = 173/308 (56%), Gaps = 5/308 (1%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
            T   FPGQG+Q +GMGRDLY  F  AR +F+  D  L  +LS L + G +E+L  T N+
Sbjct: 5   KTAYVFPGQGAQFVGMGRDLYSEFHSARELFDLADKALGFSLSKLCFEGPEEDLKDTRNS 64

Query: 62  QPALTAVSMAFIRVMEKNGLCV-KRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
           Q A+   S+  +    ++G      + S+VAGHSLGEY+AL A         I L R RG
Sbjct: 65  QSAIVGHSLCALAAFIESGKSNLLPEPSFVAGHSLGEYSALGAGGILPYPQAILLARKRG 124

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           + M EA     G+M A++GL + ++            C IAN N  GQ+VISGL++ V+ 
Sbjct: 125 ELMAEAAAKTPGAMAAVLGLSEEILA----DICLKTGCYIANYNSPGQLVISGLKETVEK 180

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A+      GA + V L VS  FH+ LM+P S  +K +LDS       +P++ N  ASP++
Sbjct: 181 ASAQAAESGAMKVVPLQVSGGFHTPLMSPASAGLKAVLDSTGFDTARIPLVANTSASPLT 240

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
           +  +I   LV Q+TG V+W+++I+     GV +  E+G GKVL GL KRI++S+S  +I+
Sbjct: 241 NPQDIKSELVNQLTGGVQWQKSIENMIAAGVNTFVEIGPGKVLAGLIKRINRSVSIYNIN 300

Query: 301 KVEDIDLA 308
               I   
Sbjct: 301 DAASIQNF 308


>gi|74317568|ref|YP_315308.1| [Acyl-carrier-protein] S-malonyltransferase [Thiobacillus
           denitrificans ATCC 25259]
 gi|74057063|gb|AAZ97503.1| malonyl CoA-acyl carrier protein transacylase [Thiobacillus
           denitrificans ATCC 25259]
          Length = 310

 Score =  187 bits (475), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 129/310 (41%), Positives = 169/310 (54%), Gaps = 4/310 (1%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M     FPGQGSQ +GM +         R  F E    L Q+L  L+  G  E L  T N
Sbjct: 5   MKLAFVFPGQGSQSVGMMQGWGARADI-RATFAEASDALGQDLWALVTEGPAELLNQTVN 63

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
            QPA+ A  +A  R  +  G         +AGHSLGEY AL AA A S  D I+LVR R 
Sbjct: 64  TQPAMLAADVAAWRAWQTQGGA---KPVVLAGHSLGEYAALVAADALSFVDAIKLVRFRA 120

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           ++MQ AVP G+G+M AI+GLDD  V ++CA A+   + E  N N  GQVVI+G + AV+ 
Sbjct: 121 EAMQSAVPEGVGAMAAILGLDDDAVRAVCADAAAGEVVEAVNLNSPGQVVIAGNKGAVER 180

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A      +GAKRA+ LPVS P HSSLM P ++ +   L++V    P +P+L N       
Sbjct: 181 AMALAKERGAKRALPLPVSVPSHSSLMRPAAEKLLAYLENVAISAPRIPVLHNTDVQSHD 240

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
               I   L +Q+   VRW ET++     GV+ V E G GKVL GL KRID SL+A+++ 
Sbjct: 241 EAAAIRAALAKQLHTPVRWVETVRALKAAGVERVIECGPGKVLAGLNKRIDDSLAALALV 300

Query: 301 KVEDIDLALR 310
               +  AL 
Sbjct: 301 DEASLQAALN 310


>gi|15603780|ref|NP_246854.1| acyl carrier protein S-malonyltransferase [Pasteurella multocida
           subsp. multocida str. Pm70]
 gi|12722348|gb|AAK03999.1| FabD [Pasteurella multocida subsp. multocida str. Pm70]
          Length = 312

 Score =  187 bits (475), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 122/307 (39%), Positives = 170/307 (55%), Gaps = 2/307 (0%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
              + FPGQGSQ +GM  +L   +P     F++    L  +L  L+  G  EEL  T   
Sbjct: 3   KFAMVFPGQGSQAVGMLAELATEYPVVEETFKQASDVLGYDLWQLVQQGPAEELNKTWQT 62

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPAL A S+A  RV ++           +AGHSLGEY+AL  A A    D ++LV  RGK
Sbjct: 63  QPALLAASVAIYRVWQE--KYPHLKPDVMAGHSLGEYSALVCAGALDFQDAVKLVELRGK 120

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCA 181
            MQ+AVP G G+M AIIGLD+  + S CA A++  +    N N  GQVVI+G + AV+ A
Sbjct: 121 LMQQAVPEGTGAMYAIIGLDNEAIISACADAAQGEVVSAVNFNSPGQVVIAGAKAAVERA 180

Query: 182 ADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSS 241
           A  C + GAKRA+ L VS P H +LM P +  +   LD++  + P   ++ N   +  + 
Sbjct: 181 AAACKDAGAKRALPLAVSVPSHCALMKPAADQLAVSLDNIAIRTPTTAVINNVDVACETE 240

Query: 242 IDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISK 301
             EI   LV Q+   VRW ET++  A  GV+ + EVG  KVLTGL KRI   L A +++ 
Sbjct: 241 NSEIRHALVRQLYSPVRWTETVERMAKDGVQVLVEVGPNKVLTGLTKRIVADLQATAVND 300

Query: 302 VEDIDLA 308
           +  ++  
Sbjct: 301 LTSLNAV 307


>gi|227326850|ref|ZP_03830874.1| acyl carrier protein S-malonyltransferase [Pectobacterium
           carotovorum subsp. carotovorum WPP14]
          Length = 309

 Score =  187 bits (474), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 125/311 (40%), Positives = 179/311 (57%), Gaps = 4/311 (1%)

Query: 1   MS-TVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATC 59
           M+   + FPGQGSQ +GM  +L   +P     F +    L  +L  L   G  EEL  T 
Sbjct: 1   MTQFAMVFPGQGSQTVGMLAELAAEYPIVTETFAQASEVLGYDLWQLTQQGPAEELNKTW 60

Query: 60  NAQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRAR 119
             QPAL   S+A  RV ++ G    +  + ++GHSLGEY+AL  A        +RLV  R
Sbjct: 61  QTQPALLTASVAIWRVWQQQGG---KTPALMSGHSLGEYSALVCAGVLDFQQAVRLVELR 117

Query: 120 GKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVK 179
           GK MQEAVP G G+M AIIGLD+  +   C ++++  +    N N  GQVVI+G +DAV+
Sbjct: 118 GKLMQEAVPEGTGAMYAIIGLDNEAIAKACEESAQGQVVSPVNFNSPGQVVIAGNKDAVE 177

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            A   C   GAKRA+ LPVS P H +LM P +K +   L+SVT   PV+P++ N  A   
Sbjct: 178 RAGAACKAAGAKRALPLPVSVPSHCALMEPAAKKLAVALESVTFNSPVIPVVNNVDARIE 237

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
           ++ + I   LV Q+   VRW + +++ A+ G++S+ EVG GKVLTGL KRI  +L+A ++
Sbjct: 238 TTPEAIRDALVRQLHCPVRWTDCVEFMASQGIESLLEVGPGKVLTGLTKRIVDTLTAAAV 297

Query: 300 SKVEDIDLALR 310
           +    +  A+ 
Sbjct: 298 NDPASLSAAIE 308


>gi|255003912|ref|ZP_05278713.1| malonyl CoA-acyl carrier protein transacylase (fabD) [Anaplasma
           marginale str. Virginia]
          Length = 331

 Score =  187 bits (474), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 136/307 (44%), Positives = 183/307 (59%), Gaps = 1/307 (0%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
           S V  FPGQGSQ +GMGR++YDS P AR VF EVD TL ++LS +++ G +E LT+TCNA
Sbjct: 8   SVVFMFPGQGSQFVGMGREVYDSSPAARRVFHEVDETLGRHLSRIIFQGPEEALTSTCNA 67

Query: 62  QPALTAVSMAFIRVMEKN-GLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
           Q AL  VS+A +R +E+N G  +   + YV GHS+GEYTAL  +K   L    RL+  RG
Sbjct: 68  QLALMTVSVALVRALEENLGGPITDAVKYVLGHSVGEYTALHVSKVIGLPSVARLLDVRG 127

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           K+M  A     G M A+IG     V+++ A+AS  GICE+ANDN  GQVV+SG + A++ 
Sbjct: 128 KAMHRASSLCCGGMAALIGGSLSEVEAVAARASEYGICEVANDNCTGQVVVSGTESALQQ 187

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
                   G K+ + L VS PFHSSLM      +   +D +    P V ++ N  AS  S
Sbjct: 188 LPKLIEGTGIKKVIRLRVSGPFHSSLMRLACNEIGDFVDQLEMNPPEVEMVFNVSASTHS 247

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
             + I  L+V QV  RVRWRE+I++    G     EVG G+VL GL KRID S+    + 
Sbjct: 248 DCNAIRNLMVRQVVSRVRWRESIEYLIGCGCSEFIEVGPGQVLVGLLKRIDNSVRGFGVD 307

Query: 301 KVEDIDL 307
            +E +  
Sbjct: 308 SMESVRA 314


>gi|56416438|ref|YP_153512.1| malonyl CoA-acyl carrier protein transacylase [Anaplasma marginale
           str. St. Maries]
 gi|222474808|ref|YP_002563223.1| malonyl CoA-acyl carrier protein transacylase (fabD) [Anaplasma
           marginale str. Florida]
 gi|56387670|gb|AAV86257.1| malonyl CoA-acyl carrier protein transacylase [Anaplasma marginale
           str. St. Maries]
 gi|222418944|gb|ACM48967.1| malonyl CoA-acyl carrier protein transacylase (fabD) [Anaplasma
           marginale str. Florida]
          Length = 339

 Score =  187 bits (474), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 136/307 (44%), Positives = 183/307 (59%), Gaps = 1/307 (0%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
           S V  FPGQGSQ +GMGR++YDS P AR VF EVD TL ++LS +++ G +E LT+TCNA
Sbjct: 16  SVVFMFPGQGSQFVGMGREVYDSSPAARRVFHEVDETLGRHLSRIIFQGPEEALTSTCNA 75

Query: 62  QPALTAVSMAFIRVMEKN-GLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
           Q AL  VS+A +R +E+N G  +   + YV GHS+GEYTAL  +K   L    RL+  RG
Sbjct: 76  QLALMTVSVALVRALEENLGGPITDAVKYVLGHSVGEYTALHVSKVIGLPSVARLLDVRG 135

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           K+M  A     G M A+IG     V+++ A+AS  GICE+ANDN  GQVV+SG + A++ 
Sbjct: 136 KAMHRASSLCCGGMAALIGGSLSEVEAVAARASEYGICEVANDNCTGQVVVSGTESALQQ 195

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
                   G K+ + L VS PFHSSLM      +   +D +    P V ++ N  AS  S
Sbjct: 196 LPKLIEGTGIKKVIRLRVSGPFHSSLMRLACNEIGDFVDQLEMNPPEVEMVFNVSASTHS 255

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
             + I  L+V QV  RVRWRE+I++    G     EVG G+VL GL KRID S+    + 
Sbjct: 256 DCNAIRNLMVRQVVSRVRWRESIEYLIGCGCSEFIEVGPGQVLVGLLKRIDNSVRGFGVD 315

Query: 301 KVEDIDL 307
            +E +  
Sbjct: 316 SMESVRA 322


>gi|322391449|ref|ZP_08064918.1| exopolyphosphatase [Streptococcus peroris ATCC 700780]
 gi|321145532|gb|EFX40924.1| exopolyphosphatase [Streptococcus peroris ATCC 700780]
          Length = 306

 Score =  187 bits (474), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 108/309 (34%), Positives = 159/309 (51%), Gaps = 6/309 (1%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
            T   F GQG+Q +GMGR+LYD +   +   ++    L  +L DL+ +  + +L  T   
Sbjct: 3   KTAFLFTGQGAQHLGMGRELYDQYSIVKETIDQASQVLGYDLRDLI-DNDEAKLNQTRYT 61

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPA+ A S+A  R++++ G         VAG SLGEY+AL A+ A    D + LV  RG 
Sbjct: 62  QPAILATSVAIYRLLKEKGY----QPDIVAGLSLGEYSALVASGALDFEDAVALVAKRGA 117

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCA 181
            M++A P G G MVA++     V++  C +AS++G+   AN N   Q+VI G   AV  A
Sbjct: 118 YMEKAAPAGSGKMVAVLNTPVEVIEKACQEASQLGVVTPANYNTPSQIVIGGEVAAVDRA 177

Query: 182 ADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSS 241
            +     GAKR + L VS PFH++L+ P S+ +   L  V   D     L     + V  
Sbjct: 178 VELLQEAGAKRLIPLNVSGPFHTALLEPASQKLAHALTEVEFSD-FACPLVGNTEAEVMK 236

Query: 242 IDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISK 301
            + I+ LL  QV   VR+ E+I      GV    E+G GKVL+G  K+IDK+    ++  
Sbjct: 237 KERIAELLTRQVKEPVRFYESIAVMHEAGVTRFIEIGPGKVLSGFVKKIDKTAQLANVED 296

Query: 302 VEDIDLALR 310
              +   L 
Sbjct: 297 QTSLQTLLE 305


>gi|49474090|ref|YP_032132.1| acyl-carrier-protein S-malonyltransferase [Bartonella quintana str.
           Toulouse]
 gi|49239594|emb|CAF25951.1| Malonyl CoA-acyl carrier protein transacylase [Bartonella quintana
           str. Toulouse]
          Length = 314

 Score =  187 bits (474), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 174/312 (55%), Positives = 223/312 (71%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M    TFPGQGSQ+IGMG+ L + F  AR+VFEEVD  L + LSD+++ G  + LT T N
Sbjct: 1   MVAAFTFPGQGSQLIGMGKALTEQFVAARMVFEEVDDALGEKLSDIIFEGPADVLTLTAN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
           AQPAL AVS+A IRVME+ GL ++  + +VAGHSLGEY+ALCA   FSL+DT RL+R RG
Sbjct: 61  AQPALMAVSIAVIRVMEQLGLNIETKVKFVAGHSLGEYSALCAVGTFSLTDTARLLRIRG 120

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
            +MQ AV  G GSM A+IGLD+  V+ IC   S  GIC+IANDNGGGQ+VISG   AV+ 
Sbjct: 121 NAMQAAVAIGEGSMAALIGLDEKDVEKICQTVSGEGICQIANDNGGGQIVISGKTKAVEK 180

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A +    KGAKRA+ LPVSAPFHS LM P +  MK  L +V K  P+VP++ N   +P S
Sbjct: 181 AIEVASKKGAKRALLLPVSAPFHSDLMQPAAVAMKNALLTVNKTAPIVPLVANVSVTPES 240

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
             + I  LLV QVTGRVRWRETI+W   +GV +++EVGSGKVLTGLA+RI+K +  +++ 
Sbjct: 241 DPERIVALLVHQVTGRVRWRETIEWIGANGVDTLFEVGSGKVLTGLARRINKDIKGLTVG 300

Query: 301 KVEDIDLALRSI 312
             E+I+ AL+ +
Sbjct: 301 TAEEIEAALKVL 312


>gi|312962567|ref|ZP_07777057.1| acyl-carrier-protein S-malonyltransferase [Pseudomonas fluorescens
           WH6]
 gi|311283147|gb|EFQ61738.1| acyl-carrier-protein S-malonyltransferase [Pseudomonas fluorescens
           WH6]
          Length = 312

 Score =  187 bits (474), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 121/305 (39%), Positives = 175/305 (57%), Gaps = 5/305 (1%)

Query: 1   MST--VLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTAT 58
           MST     FPGQGSQ +GM  +L   +P     F+E    L  +L  L   G +E+L  T
Sbjct: 1   MSTSLAFVFPGQGSQSLGMLAELGAQYPLILDTFKEASDALGYDLWALTQQGPEEQLNQT 60

Query: 59  CNAQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRA 118
              QPA+   S+A  R+    G       ++VAGHSLGEY+AL AA + +L + ++LV  
Sbjct: 61  DKTQPAILTASIALWRLWLAEGGA---RPAFVAGHSLGEYSALVAAGSLTLGEAVKLVER 117

Query: 119 RGKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAV 178
           RG+ MQ+AVP G G M AI+GLDD VV   CA+A++  +    N N  GQVVI+G + AV
Sbjct: 118 RGQLMQDAVPAGQGGMAAILGLDDAVVIEACAEAAQGEVVSAVNFNSPGQVVIAGAKAAV 177

Query: 179 KCAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASP 238
           + A + C  +GAKRA+ LPVS P H  LM P ++     + ++  Q P +P++ N  A+ 
Sbjct: 178 ERAIEGCKARGAKRALPLPVSVPSHCELMRPAAERFAESIAAINWQAPQIPLVQNVSAAV 237

Query: 239 VSSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVS 298
            + ++ + R L+EQ+   VRW E++Q  A +G   + E G GKVL GL KR    +S  +
Sbjct: 238 AADLETLKRDLLEQLYKPVRWVESVQALAANGATELVECGPGKVLAGLNKRCADGVSTAN 297

Query: 299 ISKVE 303
           ++  E
Sbjct: 298 LNTPE 302


>gi|330720096|gb|EGG98508.1| Malonyl CoA-acyl carrier protein transacylase [gamma
           proteobacterium IMCC2047]
          Length = 308

 Score =  187 bits (474), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 125/302 (41%), Positives = 172/302 (56%), Gaps = 3/302 (0%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
           S    FPGQGSQ +GM  D+ + FP+ +  F+E    L  +L  L   G  EEL  T   
Sbjct: 4   SLAFVFPGQGSQAVGMLADVAEKFPQVKATFDEASAVLGTDLWQLTQEGPAEELNRTDMT 63

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPAL   S+A  RV  + G       +Y++GHSLGEY+AL  A A +  D ++LV  RG 
Sbjct: 64  QPALLTASVALWRVWNEQGGA---KPAYMSGHSLGEYSALVCAGAIAFEDAVKLVNKRGL 120

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCA 181
            MQ AVP G G+M AIIGLDD  ++S C QA++  +    N N  GQVVI+G  DAV  A
Sbjct: 121 FMQSAVPAGEGAMAAIIGLDDAAIESACEQAAQGEVVSAVNYNSPGQVVIAGQTDAVNRA 180

Query: 182 ADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSS 241
           ++ C   GAKRA+ LPVS P H +LM P ++ +   L+++T   P +P+L N  A     
Sbjct: 181 SELCKEAGAKRALPLPVSVPSHCALMKPAAEQLAAELEAITVNTPDIPVLQNVTAEVTMD 240

Query: 242 IDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISK 301
              I   LV+Q+   V W + +   A  GV+ + E G GKVL+GL KRI + L+  +++ 
Sbjct: 241 ATAIKDNLVQQLYRPVLWVDCVNNMAGKGVERMLECGPGKVLSGLNKRISRGLAVATVAD 300

Query: 302 VE 303
           VE
Sbjct: 301 VE 302


>gi|229098321|ref|ZP_04229268.1| Malonyl CoA-acyl carrier protein transacylase [Bacillus cereus
           Rock3-29]
 gi|228685219|gb|EEL39150.1| Malonyl CoA-acyl carrier protein transacylase [Bacillus cereus
           Rock3-29]
          Length = 314

 Score =  187 bits (474), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 123/314 (39%), Positives = 179/314 (57%), Gaps = 5/314 (1%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
                FPGQGSQ +GMGR L ++  E   VF + D  L+ +LS++++ G QE+LT T NA
Sbjct: 3   KIAFLFPGQGSQAVGMGRQLAENNNEVAKVFAKADEVLHDSLSEVIFEGPQEKLTLTTNA 62

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPAL   S A +  +++  +       +VAGHSLGEY+AL AA A +  D +  VR RG+
Sbjct: 63  QPALLTTSFAILTALKEYDIT----PDFVAGHSLGEYSALVAAGAITFEDAVYAVRKRGE 118

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQAS-RVGICEIANDNGGGQVVISGLQDAVKC 180
            M+EAVP G G+M AI+G D  ++  +  + +      +IAN N   Q+VISG    V+ 
Sbjct: 119 YMEEAVPGGEGAMAAILGADPDMLKRVTEEVTSEGYAVQIANMNSTKQIVISGTNQGVEL 178

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A+      GAKRA+ L VS PFHSSLM P ++  + +LD +T QD  +P++ N  A  ++
Sbjct: 179 ASQRAKENGAKRAISLKVSGPFHSSLMKPAAEKFQSVLDEITIQDTNIPVIANVTADVIT 238

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
              +I   L+EQ+   V W  +I+     GV    E+G GKVL GL K ID S+ A +I 
Sbjct: 239 RGADIQEKLIEQLYSPVLWYPSIETMVKQGVDIFIEIGPGKVLAGLMKSIDSSVKAYAIY 298

Query: 301 KVEDIDLALRSIVG 314
               +   + ++ G
Sbjct: 299 DEATLKDTISNLRG 312


>gi|229117338|ref|ZP_04246716.1| Malonyl CoA-acyl carrier protein transacylase [Bacillus cereus
           Rock1-3]
 gi|228666238|gb|EEL21702.1| Malonyl CoA-acyl carrier protein transacylase [Bacillus cereus
           Rock1-3]
          Length = 314

 Score =  187 bits (474), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 123/314 (39%), Positives = 179/314 (57%), Gaps = 5/314 (1%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
                FPGQGSQ +GMGR L ++  E   VF + D  L+ +LS++++ G QE+LT T NA
Sbjct: 3   KIAFLFPGQGSQAVGMGRQLAENNNEVAKVFAKADEVLHDSLSEVIFEGPQEKLTLTTNA 62

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPAL   S A +  +++  +       +VAGHSLGEY+AL AA A +  D +  VR RG+
Sbjct: 63  QPALLTTSFAILTALKEYDIT----PDFVAGHSLGEYSALVAAGAITFEDAVYAVRKRGE 118

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQAS-RVGICEIANDNGGGQVVISGLQDAVKC 180
            M+EAVP G G+M AI+G D  ++  +  + +      +IAN N   Q+VISG    V+ 
Sbjct: 119 YMEEAVPGGEGAMAAILGADPDMLKRVTEEVTSEGYAVQIANMNSTKQIVISGTIQGVEL 178

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A+      GAKRA+ L VS PFHSSLM P ++  + +LD +T QD  +P++ N  A  ++
Sbjct: 179 ASQRAKENGAKRAISLKVSGPFHSSLMKPAAEKFQSVLDEITIQDTNIPVIANVTADVIT 238

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
              +I   L+EQ+   V W  +I+     GV    E+G GKVL GL K ID S+ A +I 
Sbjct: 239 RGADIQEKLIEQLYSPVLWYPSIETMVKQGVDIFIEIGPGKVLAGLMKSIDSSVKAYAIY 298

Query: 301 KVEDIDLALRSIVG 314
               +   + ++ G
Sbjct: 299 DEATLKDTISNLRG 312


>gi|138894710|ref|YP_001125163.1| malonyl CoA-acyl carrier protein transacylase (FabD) [Geobacillus
           thermodenitrificans NG80-2]
 gi|196247671|ref|ZP_03146373.1| malonyl CoA-acyl carrier protein transacylase [Geobacillus sp.
           G11MC16]
 gi|134266223|gb|ABO66418.1| Malonyl CoA-acyl carrier protein transacylase (FabD) [Geobacillus
           thermodenitrificans NG80-2]
 gi|196212455|gb|EDY07212.1| malonyl CoA-acyl carrier protein transacylase [Geobacillus sp.
           G11MC16]
          Length = 314

 Score =  187 bits (474), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 126/314 (40%), Positives = 187/314 (59%), Gaps = 5/314 (1%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
                FPGQGSQ +GM +D  D    AR V E  D  L   LS LM+NG QEELT T NA
Sbjct: 3   KIAFLFPGQGSQTVGMAKDAADHDARARAVIEAADERLGFPLSALMFNGPQEELTLTYNA 62

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPAL   S+A + +++  G        YVAGHSLGEYTAL AA A S +D +  VR RG+
Sbjct: 63  QPALLTASIALLELVKAAG----LKADYVAGHSLGEYTALVAAGAMSFADAVYAVRRRGE 118

Query: 122 SMQEAVPPGLGSMVAIIGLD-DCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
            M EAVP G G+M A++G++ + +        ++    E AN N  GQ+VISG +  V+ 
Sbjct: 119 LMDEAVPAGEGTMAAVLGMEGEVLEAVTNEITAQGDPVEPANFNCPGQIVISGSKAGVEK 178

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A      +GAKR + L VS PFHS+LM P ++ ++ +L  +  +D  +P++ N  A PV 
Sbjct: 179 AGQLAKERGAKRVIPLEVSGPFHSALMKPAAEQLQEVLSGLVIRDADIPVIANVTAEPVM 238

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
           + ++I+RLL+EQ+   VRW ++++     GV +  E+G GKVL+GL K+ID++    +++
Sbjct: 239 NKEDIARLLIEQLYSPVRWEQSVRTLLALGVDTFLEIGPGKVLSGLVKKIDRNARIYAVN 298

Query: 301 KVEDIDLALRSIVG 314
            +  ++  + ++ G
Sbjct: 299 DLASLEATVAALKG 312


>gi|152976218|ref|YP_001375735.1| acyl-carrier-protein S-malonyltransferase [Bacillus cereus subsp.
           cytotoxis NVH 391-98]
 gi|152024970|gb|ABS22740.1| malonyl CoA-acyl carrier protein transacylase [Bacillus cytotoxicus
           NVH 391-98]
          Length = 316

 Score =  187 bits (474), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 122/314 (38%), Positives = 183/314 (58%), Gaps = 5/314 (1%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
                FPGQGSQ +GMG+ L ++  +   VF++ D  LN+ LS +++ G QE+LT T NA
Sbjct: 3   KLAFLFPGQGSQAVGMGKQLAENNKKVAEVFQKADQVLNEPLSQVIFEGPQEKLTLTTNA 62

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPAL   S A +  + +  +       YVAGHSLGEY+AL A +A +  D +  VR RG+
Sbjct: 63  QPALLTTSFAILTALNEYDIT----PDYVAGHSLGEYSALVAVEALTFEDAVYAVRKRGE 118

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQASR-VGICEIANDNGGGQVVISGLQDAVKC 180
            M+EAVP G G+M AI+G D  ++  +  + +      +IAN N   Q+VISG +  V+ 
Sbjct: 119 YMEEAVPGGEGAMAAILGADPNMLKQVTEEVTNEGHAVQIANMNSVKQIVISGTKQGVEL 178

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A+     KGAKRA+ L VS PFHSSLM P ++  K +L+ +  QD  +P++ N  A  ++
Sbjct: 179 ASQKAKEKGAKRAIPLRVSGPFHSSLMKPAAEKFKSVLNEIAIQDAKIPVIANVTADCMT 238

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
           + +EI   L+EQ+   V W  ++++    GV +  E+G GKVL GL K ID S+   ++ 
Sbjct: 239 NREEIQEKLIEQLYSPVLWYPSMEYMIEQGVDTFIEIGPGKVLAGLMKAIDSSVKVYTVY 298

Query: 301 KVEDIDLALRSIVG 314
             E +   + S+ G
Sbjct: 299 DEETLKDTISSLRG 312


>gi|77864472|gb|ABB05105.1| LipPks4 [Streptomyces aureofaciens]
          Length = 3277

 Score =  187 bits (474), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 90/318 (28%), Positives = 141/318 (44%), Gaps = 15/318 (4%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNL----SDLMWNGSQEELT 56
           MS    F GQG+Q +GMGR+LYD+FP  R   ++V   L+  L     ++MW+   E L+
Sbjct: 557 MS-AFLFTGQGAQRVGMGRELYDTFPAFRNALDKVCAVLDPLLPRPSREVMWDEDPEALS 615

Query: 57  ATCNAQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLV 116
            T   QP L A+ +A  R++E  G+        VAGHS+GE  A       SL+D   LV
Sbjct: 616 RTEFTQPTLFAIEVALFRLLESWGI----HPDAVAGHSIGEIAAAHVTGVLSLTDACVLV 671

Query: 117 RARGKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQD 176
            ARG+         L     +I +     + +       G  +IA  N    VVISG + 
Sbjct: 672 AARGRL-----MQALPHDGVMIAIQATEDEVLPLLEKVTGQADIAAVNAPEAVVISGAET 726

Query: 177 AVKCAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCA 236
            V+      L    +R   L VS  FHS LM P+ K  + +++ ++   P +P +     
Sbjct: 727 EVEHV-AGILTAQGRRVKRLTVSHAFHSPLMDPILKDFQTVVEGLSFHQPSLPFVSTVTG 785

Query: 237 SPVSSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSA 296
           +   +        V  V   VR+ + ++     GV+   E+G   +LTGL ++   + + 
Sbjct: 786 TVAGAEITEPAYWVRHVRQTVRFADGLRTLHELGVRKFIEIGPDAILTGLVEQTLDTQAV 845

Query: 297 VSISKVEDIDLALRSIVG 314
             + +  D   A     G
Sbjct: 846 PVLRRDRDEVRAAVEAAG 863



 Score =  182 bits (462), Expect = 5e-44,   Method: Composition-based stats.
 Identities = 90/318 (28%), Positives = 142/318 (44%), Gaps = 16/318 (5%)

Query: 3    TVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNL----SDLMWNGSQEELTAT 58
            T   F GQG+Q +GMGR+LYD+FP  R   +EV   L+  L     ++MW+   E L+ T
Sbjct: 2291 TAFLFTGQGAQRVGMGRELYDTFPAFRKALDEVCAVLDPLLPRPSREVMWDEDPEALSRT 2350

Query: 59   CNAQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRA 118
               QP L A+ +A  R++E  G+        VAGHS+GE  A       SL+D   LV A
Sbjct: 2351 EFTQPTLFAIEVALFRLLESWGI----HPDAVAGHSIGEIAAAHVTGVLSLTDACVLVAA 2406

Query: 119  RGKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAV 178
            RG+     +   L     +I +     + +       G  +IA  N    VV+SG +  V
Sbjct: 2407 RGR-----LMQALPHDGVMIAVQATEDEVLPLLEKVTGQADIAAVNAPEAVVVSGAETEV 2461

Query: 179  KCAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASP 238
            +      L    +R   L VS  FHS LM P+ K  + +++ ++ + P +P +     + 
Sbjct: 2462 EHV-AGILTAQGRRVKRLTVSHAFHSPLMDPILKDFQTVVEGLSFRQPSLPFVSTVTGTV 2520

Query: 239  VSSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLA--KRIDKSLSA 296
              +        V  V   VR+ + ++     GV+   E+G   +LTGL    +   + + 
Sbjct: 2521 AGAEITEPAYWVRHVRQTVRFADGLRTLHGLGVRKFIEIGPDAILTGLVEQNQTLDTQAV 2580

Query: 297  VSISKVEDIDLALRSIVG 314
              + +  D   A    VG
Sbjct: 2581 PVLRRDRDEVRAAVEAVG 2598


>gi|256822411|ref|YP_003146374.1| malonyl CoA-acyl carrier protein transacylase [Kangiella koreensis
           DSM 16069]
 gi|256795950|gb|ACV26606.1| malonyl CoA-acyl carrier protein transacylase [Kangiella koreensis
           DSM 16069]
          Length = 309

 Score =  187 bits (474), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 125/310 (40%), Positives = 174/310 (56%), Gaps = 3/310 (0%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
            T   FPGQGSQ +GM  D+ D +P     F E    L  +L  L+    + +L  T   
Sbjct: 3   KTAFIFPGQGSQAVGMLADIADKYPVIEHTFAEASEALGYDLWQLVQKDEEGKLNQTEFT 62

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPAL   S+A  R+ ++ G       +++AGHSLGEY+AL AA    L+D ++LV ARG+
Sbjct: 63  QPALLTASVALWRLWQQEGGT---KPAFLAGHSLGEYSALVAAGVIELADAVKLVEARGQ 119

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCA 181
            MQ AVP G G M AIIGLDD  V   CA A++  + E  N N  GQVVI+G  DAV+ A
Sbjct: 120 FMQLAVPAGTGKMAAIIGLDDEKVRDACALAAQDEVVEAVNYNSPGQVVIAGSADAVERA 179

Query: 182 ADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSS 241
            + C   GAKRA+ LPVS P H +LM P +  +  ML+S+    P +P++ N   +  + 
Sbjct: 180 MEACKTAGAKRALPLPVSVPSHCALMRPAADKLAHMLESINISAPTIPVINNVDVAIETE 239

Query: 242 IDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISK 301
              I   L+ Q+   VRW ET+Q        ++ E G G VL GLAKRID+ L+A  ++ 
Sbjct: 240 PKAIKDALIRQLYNPVRWTETVQKLKAEDAINLLECGPGNVLCGLAKRIDRELNAAPLAS 299

Query: 302 VEDIDLALRS 311
           ++  + AL +
Sbjct: 300 LDKFEAALSA 309


>gi|237808938|ref|YP_002893378.1| malonyl CoA-acyl carrier protein transacylase [Tolumonas auensis
           DSM 9187]
 gi|237501199|gb|ACQ93792.1| malonyl CoA-acyl carrier protein transacylase [Tolumonas auensis
           DSM 9187]
          Length = 311

 Score =  187 bits (474), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 123/311 (39%), Positives = 179/311 (57%), Gaps = 3/311 (0%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
              + FPGQGSQ +GM  +L +++P  +  F E    L  +L +L+  G  EEL  T   
Sbjct: 3   KFAIAFPGQGSQSVGMLAELAEAYPIIKETFAEASAVLGYDLFELVTQGPAEELNKTWKT 62

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPAL   S+A  R+ +  G       + +AGHSLGEY+AL  A A + +D ++LV  RG+
Sbjct: 63  QPALLTSSVALWRLWQAQGGAT---PAVMAGHSLGEYSALVCAGALNFTDAVKLVELRGQ 119

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCA 181
           +MQ AVP G+G+M AIIGLD+  + + C +A+   +    N N  GQVVI+G ++AV+ A
Sbjct: 120 AMQRAVPEGVGAMAAIIGLDNDSIAANCEKAAEDQVVSPVNFNSPGQVVIAGHKEAVERA 179

Query: 182 ADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSS 241
                  GAKRA+ LPVS P H +LM P +  +   LD++  + PV+P++ N   + V+ 
Sbjct: 180 NVLMKESGAKRALPLPVSVPSHCALMKPAADELAVALDALDVKAPVIPVINNADVATVTD 239

Query: 242 IDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISK 301
              I   L+ Q+   VRW ET++  AN  V    E+G GKVLTGL KRIDK +   +I+ 
Sbjct: 240 PAAIKDALIRQLYSPVRWTETVERMANEDVTFEIEMGPGKVLTGLVKRIDKRVDGCAIND 299

Query: 302 VEDIDLALRSI 312
           V  +  AL  +
Sbjct: 300 VAGLQDALSKV 310


>gi|85059037|ref|YP_454739.1| malonyl CoA-(acyl-carrier-protein) transacylase [Sodalis
           glossinidius str. 'morsitans']
 gi|84779557|dbj|BAE74334.1| malonyl CoA-(acyl-carrier-protein) transacylase [Sodalis
           glossinidius str. 'morsitans']
          Length = 309

 Score =  187 bits (474), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 124/311 (39%), Positives = 175/311 (56%), Gaps = 4/311 (1%)

Query: 1   MST-VLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATC 59
           M+   + FPGQGSQ +GM  +L          F E    L  +L   +  G  EEL  T 
Sbjct: 1   MTVFAMVFPGQGSQTVGMLTELAADHAVVEATFAESSAVLGYDLWQRVQQGPAEELNKTW 60

Query: 60  NAQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRAR 119
             QPAL A S+A  RV ++ G  V    + +AGHSLGEY+AL  A +   +  I LV  R
Sbjct: 61  VTQPALLASSVAIWRVWQQQGGQV---PALMAGHSLGEYSALVCAGSLDFAAAIALVALR 117

Query: 120 GKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVK 179
           GK MQ+AVP G G+M AIIGLD   + + C QA++  +    N N  GQVVI+G ++AV+
Sbjct: 118 GKLMQDAVPAGTGAMSAIIGLDSDAIAAACEQAAQGQVVSPVNFNSPGQVVIAGHKEAVE 177

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            A   C   GAKRA+ LPVS P H +LM P ++ +   L++VT   P +P++ N      
Sbjct: 178 RAGLACKEAGAKRALPLPVSVPSHCALMKPAAEKLAQALEAVTFAAPQIPVINNVDVRAE 237

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
                I + LV Q+   VRW E++++ A+ GV+ + E+G GKVLTGL KRID +LS   +
Sbjct: 238 QHSTAIRQALVRQLYSPVRWTESVEYLASQGVEVLLEIGPGKVLTGLTKRIDGNLSGAEV 297

Query: 300 SKVEDIDLALR 310
           + +  +  A+ 
Sbjct: 298 NDLASLAAAIE 308


>gi|89098689|ref|ZP_01171571.1| acyl-carrier-protein S-malonyltransferase [Bacillus sp. NRRL
           B-14911]
 gi|89086651|gb|EAR65770.1| acyl-carrier-protein S-malonyltransferase [Bacillus sp. NRRL
           B-14911]
          Length = 315

 Score =  187 bits (474), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 122/314 (38%), Positives = 185/314 (58%), Gaps = 5/314 (1%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
                FPGQGSQ +GMG+ L +S  + + VF++ D  LN  LS L++ G QE LT T NA
Sbjct: 3   KIAFLFPGQGSQTVGMGKSLAESDNKVKAVFDQADQRLNDKLSSLIFEGPQETLTLTVNA 62

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPAL   S+A +    ++G+       Y AGHSLGEYTAL AA + S  D +  VR RG+
Sbjct: 63  QPALLTTSIAILAKFRESGI----RADYTAGHSLGEYTALVAAGSISFEDAVHAVRKRGE 118

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQAS-RVGICEIANDNGGGQVVISGLQDAVKC 180
            M+ AVP G G+M A++GL    + ++  + S +    ++AN N  GQ+VISG +  V+ 
Sbjct: 119 FMEAAVPNGEGTMAAVLGLGRDELRAVTEEISGKGHPVQLANLNCPGQIVISGSRQGVEQ 178

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A+      GAKR + L VS PFHSSLM P ++ ++ +LDS+T  D  +P++ N  A+ ++
Sbjct: 179 ASAKAKEAGAKRVLPLDVSGPFHSSLMKPAAENLRGVLDSITVSDAQIPVISNVSAAEMT 238

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
              +I   LV+Q+   V W ++I+     GV +  E+G GKVL+GL K++++S    ++S
Sbjct: 239 ESGDIKEKLVQQLYSPVLWEDSIERMIGLGVDTFIEIGPGKVLSGLVKKVNRSAKTYAVS 298

Query: 301 KVEDIDLALRSIVG 314
                  A+ ++ G
Sbjct: 299 DEASCAAAIEALKG 312


>gi|291278584|ref|YP_003495419.1| [acyl-carrier-protein] S-malonyltransferase [Deferribacter
           desulfuricans SSM1]
 gi|290753286|dbj|BAI79663.1| [acyl-carrier-protein] S-malonyltransferase [Deferribacter
           desulfuricans SSM1]
          Length = 308

 Score =  187 bits (474), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 122/305 (40%), Positives = 173/305 (56%), Gaps = 6/305 (1%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
                FPGQGSQ +GMG+D +D F E +++ E+ D  L  +LS LM++G +EEL  T N 
Sbjct: 3   KIAAVFPGQGSQYVGMGKDFFDKFEEYKVLIEKADEILKYDLSKLMFDGPEEELRLTYNT 62

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPAL  +S+    +++      K +    AGHSLGEY+A+ AA   +  D +  V  RGK
Sbjct: 63  QPALLVMSVGIFNLIK-----DKINFDGFAGHSLGEYSAVVAAGGLTFEDALLAVHNRGK 117

Query: 122 SMQEAVPPGLGSMVAIIGLD-DCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
            MQEAVP G+G+M A+IG + + V     + +    + E AN N   Q+V++G  DAV+ 
Sbjct: 118 FMQEAVPVGVGAMAAVIGANVEDVERLCISISKEGFLVEPANYNSSNQIVVAGHSDAVEE 177

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
                    AKR V LPVSAPFH +LM P  + MK  L+ V   D   P+  N  A    
Sbjct: 178 FMSRAKEISAKRVVKLPVSAPFHCALMKPAEEKMKNYLEKVRFSDIDKPVYSNVTADLEF 237

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
              EI   L++QV+  VRW + I+     G  +  E+G+G VLTGL K+I++ +  V+IS
Sbjct: 238 KATEIKENLIKQVSSPVRWSQLIEKMIEDGFTTFVEIGAGNVLTGLIKKINRQVKTVNIS 297

Query: 301 KVEDI 305
           KVED+
Sbjct: 298 KVEDL 302


>gi|282878572|ref|ZP_06287353.1| [acyl-carrier-protein] S-malonyltransferase [Prevotella buccalis
           ATCC 35310]
 gi|281299363|gb|EFA91751.1| [acyl-carrier-protein] S-malonyltransferase [Prevotella buccalis
           ATCC 35310]
          Length = 294

 Score =  187 bits (474), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 105/300 (35%), Positives = 156/300 (52%), Gaps = 7/300 (2%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M     FPGQGSQ +GMG++LYD+   A+ +F++ +  L   ++D+M++G+ E+L  T  
Sbjct: 1   MK-AFVFPGQGSQFVGMGKELYDNNETAKELFDKANEVLGYRITDIMFDGTDEQLKETKV 59

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
            QP     ++    V+    +        VAGHSLGE++AL AA A S  D ++LV AR 
Sbjct: 60  TQP-----AVFLHSVISALCMGDAFKPDMVAGHSLGEFSALVAAGALSFEDGLKLVYARA 114

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQV-VISGLQDAVK 179
            +MQ+A     G+M AIIGL D  V+ IC + S+ G   I  +       VISG ++ ++
Sbjct: 115 MAMQKACEVAPGTMAAIIGLPDEKVEEICQEVSKEGKVVIPANYNCPGQLVISGDKEGIE 174

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            A +     GAKRA+ L V   FHS LM P    ++  +++ T   P  P+  N    P 
Sbjct: 175 EACEKLKAAGAKRALPLKVGGAFHSPLMQPAKDELQKAIEATTVNTPQCPVYQNVDGKPY 234

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
           +   +I   L+ Q+T  VRW  T+Q     G     E G GK L G+  RI K ++   I
Sbjct: 235 TDAAKIKANLIAQLTSSVRWTTTVQNMIADGATDFTECGPGKALQGMIGRISKEVTVHGI 294


>gi|59712348|ref|YP_205124.1| malonyl-CoA:(acyl carrier protein) S-malonyltransferase [Vibrio
           fischeri ES114]
 gi|59480449|gb|AAW86236.1| malonyl-CoA:(acyl carrier protein) S-malonyltransferase [Vibrio
           fischeri ES114]
          Length = 304

 Score =  187 bits (474), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 128/302 (42%), Positives = 176/302 (58%), Gaps = 3/302 (0%)

Query: 7   FPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPALT 66
           FPGQGSQ +GM  +L +        F E    L  +L  L+ NG  E+L  T   QPAL 
Sbjct: 5   FPGQGSQAVGMLAELGEQHEVVTQTFAEASDALGYDLWSLVQNGPAEDLNQTFRTQPALL 64

Query: 67  AVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQEA 126
           A S+A  RV ++ GL      S +AGHSLGEY+AL  A      + I+LV  RG+ MQEA
Sbjct: 65  ATSVALWRVWQEQGLA---QPSVLAGHSLGEYSALVCAGVIDFKEAIKLVELRGQLMQEA 121

Query: 127 VPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAADTCL 186
           VP G+G+M AIIGLD+  +   C +A++  +    N N  GQVVI+G +DAV+ A   C 
Sbjct: 122 VPAGVGAMYAIIGLDNESIAKACEEAAQGEVVSPVNFNSPGQVVIAGNKDAVERAGVLCK 181

Query: 187 NKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSIDEIS 246
             GAKRA+ LPVS P H +LM P +  +   L+++    P +P++ N      +   +I 
Sbjct: 182 EAGAKRALPLPVSVPSHCALMKPAADKLAVALENIEFNTPTLPVINNVDVIAETDPAKIK 241

Query: 247 RLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVEDID 306
             LV Q+ G VRW E ++  A  GV+++YEVG GKVLTGL KRI KSLSA +++    ++
Sbjct: 242 DALVRQLYGPVRWTEVVEKMAEQGVETLYEVGPGKVLTGLTKRIVKSLSAAAVNDAASLE 301

Query: 307 LA 308
            A
Sbjct: 302 AA 303


>gi|120554786|ref|YP_959137.1| malonyl CoA-acyl carrier protein transacylase [Marinobacter
           aquaeolei VT8]
 gi|120324635|gb|ABM18950.1| [Acyl-carrier-protein] S-malonyltransferase [Marinobacter aquaeolei
           VT8]
          Length = 312

 Score =  187 bits (474), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 114/311 (36%), Positives = 171/311 (54%), Gaps = 3/311 (0%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M +   FPGQGSQ +GM     +++P     F+E  + L  +L  L  +G  EEL  T  
Sbjct: 1   MKSAFVFPGQGSQSLGMLSAAAEAWPMITETFDEASNVLGYDLWHLCQHGPAEELNKTMV 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
            QPAL   S+       +  +       +VAGHSLGEY+AL AA++    + ++LV+ RG
Sbjct: 61  TQPALLTASVGL---WRQWCVSDGPRPDFVAGHSLGEYSALVAAESLDFIEAVKLVQLRG 117

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           + MQ+AVP G G M AI+GL+D  V S C +++   +    N N  GQVVI+G   AV+ 
Sbjct: 118 ELMQDAVPEGQGRMAAILGLEDSDVVSACEESAEGDVVAAVNFNAPGQVVIAGSAAAVER 177

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A + C  KGA++A+ LPVS P H +LM   ++ +   L+ +   D V+P++ N  A P  
Sbjct: 178 AIEACKAKGARKAMPLPVSVPSHCALMKGAAEQLAEALEDIRFNDAVIPVVQNVNAEPAR 237

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
             + +   L++Q+   V W  ++Q  +  GV    E G+GKVL GL KRID+SL    I 
Sbjct: 238 DAEVLKANLLKQLYSPVLWTNSVQRLSTEGVGVAVECGAGKVLAGLIKRIDRSLPVHGIE 297

Query: 301 KVEDIDLALRS 311
             + +  AL++
Sbjct: 298 SPDSLAEALKA 308


>gi|330815974|ref|YP_004359679.1| Malonyl CoA-acyl carrier protein transacylase [Burkholderia
           gladioli BSR3]
 gi|327368367|gb|AEA59723.1| Malonyl CoA-acyl carrier protein transacylase [Burkholderia
           gladioli BSR3]
          Length = 310

 Score =  187 bits (473), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 133/310 (42%), Positives = 173/310 (55%), Gaps = 4/310 (1%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M     FPGQGSQ +GM     +     R   +E    L Q+L  L+  G  EEL  T N
Sbjct: 1   MKFAFVFPGQGSQAVGMLNAFAE-LAVVRETVQEASDALGQDLGKLIAEGPAEELNLTTN 59

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
            QP +   + A  R  ++ G       S VAGHSLGEYTAL AA A +  D + LVR R 
Sbjct: 60  TQPVMLTAAYACYRAWQEAGG---PAPSIVAGHSLGEYTALVAAGALAFRDAVPLVRFRA 116

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           ++MQ AVP G G M AI+GLDD  V ++CA+A+  G+ E  N N   QVVI+G + AV+ 
Sbjct: 117 QAMQNAVPVGEGGMAAILGLDDDTVRAVCAEAAAAGVVEAVNFNAPAQVVIAGAKAAVEK 176

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A +    KGAKRA+ LPVSAPFHSSL+ P S  ++  L +VT   P +P++ N   + VS
Sbjct: 177 ACEIAKAKGAKRALPLPVSAPFHSSLLKPASDQLRDYLATVTIDAPRIPVVNNIDVAVVS 236

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
               I   LV Q  G VRW E ++  A  GV  + E G GKVLTGL KRID  L+  ++ 
Sbjct: 237 DPAAIKDALVRQAAGPVRWVECVRHIAGTGVTQLVECGPGKVLTGLTKRIDGELAGAAVY 296

Query: 301 KVEDIDLALR 310
               +D  L+
Sbjct: 297 DPATLDDVLK 306


>gi|300716233|ref|YP_003741036.1| hypothetical protein EbC_16540 [Erwinia billingiae Eb661]
 gi|299062069|emb|CAX59185.1| uncharacterized protein [Erwinia billingiae Eb661]
          Length = 307

 Score =  187 bits (473), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 126/310 (40%), Positives = 173/310 (55%), Gaps = 4/310 (1%)

Query: 1   MS-TVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATC 59
           M+   + FPGQGSQ +GM  +L    P     F E    L  +L  L+  G  EEL  T 
Sbjct: 1   MTQFAMVFPGQGSQTVGMLAELAAENPLVEKTFAEASAALGYDLWALVQQGPVEELNKTW 60

Query: 60  NAQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRAR 119
             QPAL   S+A  RV ++ G    +  + +AGHSLGEY+AL  A   +  + I+LV  R
Sbjct: 61  QTQPALLTASVAIFRVWQEKGG---KMPAMLAGHSLGEYSALVCAGVIAFDEAIKLVELR 117

Query: 120 GKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVK 179
           GK MQEAVP G G+M AIIGLDD  +   C ++++  +    N N  GQVVI+G ++AV+
Sbjct: 118 GKLMQEAVPEGTGAMQAIIGLDDASIAKACEESAQGQVVSPVNFNSPGQVVIAGNKEAVE 177

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            A   C   GAKRA+ LPVS P H +LM P +  +   L+ +T   P  P++ N      
Sbjct: 178 RAGAACKAAGAKRALPLPVSVPSHCALMKPAADKLAVALEKLTFNAPTFPVVNNVDVQCE 237

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
           +S + I   LV Q+   VRW E +++ A  GV S+ EVG GKVLTGL KRI  +L+A  +
Sbjct: 238 TSAEAIRSALVRQLYNPVRWTECVEFMAQEGVTSLLEVGPGKVLTGLTKRIVDTLTAAPV 297

Query: 300 SKVEDIDLAL 309
           +    +  AL
Sbjct: 298 NDPASLSAAL 307


>gi|109157753|pdb|2G1H|A Chain A, Structure Of E.Coli Fabd Complexed With Glycerol
 gi|109157771|pdb|2G2O|A Chain A, Structure Of E.Coli Fabd Complexed With Sulfate
 gi|109157772|pdb|2G2Y|A Chain A, Structure Of E.Coli Fabd Complexed With Malonate
 gi|110590180|pdb|2G2Z|A Chain A, Structure Of E.Coli Fabd Complexed With Malonyl-Coa
          Length = 308

 Score =  187 bits (473), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 127/307 (41%), Positives = 173/307 (56%), Gaps = 3/307 (0%)

Query: 4   VLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQP 63
              FPGQGSQ +GM  D+  S+P     F E    L  +L  L   G  EEL  T   QP
Sbjct: 4   AFVFPGQGSQTVGMLADMAASYPIVEETFAEASAALGYDLWALTQQGPAEELNKTWQTQP 63

Query: 64  ALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSM 123
           AL   S+A  RV ++ G       + +AGHSLGEY+AL  A     +D +RLV  RGK M
Sbjct: 64  ALLTASVALYRVWQQQGGKA---PAMMAGHSLGEYSALVCAGVIDFADAVRLVEMRGKFM 120

Query: 124 QEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAAD 183
           QEAVP G G+M AIIGLDD  +   C +A+   +    N N  GQVVI+G ++AV+ A  
Sbjct: 121 QEAVPEGTGAMAAIIGLDDASIAKACEEAAEGQVVSPVNFNSPGQVVIAGHKEAVERAGA 180

Query: 184 TCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSID 243
            C   GAKRA+ LPVS P H +LM P +  +   L  +T   P VP++ N      ++ D
Sbjct: 181 ACKAAGAKRALPLPVSVPSHCALMKPAADKLAVELAKITFNAPTVPVVNNVDVKCETNGD 240

Query: 244 EISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVE 303
            I   LV Q+   V+W +++++ A  GV+ +YEVG GKVLTGL KRI  +L+A ++++  
Sbjct: 241 AIRDALVRQLYNPVQWTKSVEYMAAQGVEHLYEVGPGKVLTGLTKRIVDTLTASALNEPS 300

Query: 304 DIDLALR 310
            +  AL 
Sbjct: 301 AMAAALE 307


>gi|58698326|ref|ZP_00373242.1| malonyl CoA-acyl carrier protein transacylase [Wolbachia
           endosymbiont of Drosophila ananassae]
 gi|225630572|ref|YP_002727363.1| malonyl CoA-acyl carrier protein transacylase [Wolbachia sp. wRi]
 gi|58535150|gb|EAL59233.1| malonyl CoA-acyl carrier protein transacylase [Wolbachia
           endosymbiont of Drosophila ananassae]
 gi|225592553|gb|ACN95572.1| malonyl CoA-acyl carrier protein transacylase [Wolbachia sp. wRi]
          Length = 326

 Score =  187 bits (473), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 140/308 (45%), Positives = 187/308 (60%), Gaps = 3/308 (0%)

Query: 4   VLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQP 63
           +  FPGQGSQ +GMGR LY  F  AR VF EVD  L + LS L++NG  EELT T NAQP
Sbjct: 2   IFAFPGQGSQFVGMGRSLYSEFSVARQVFNEVDSILGRKLSHLIFNGPIEELTITENAQP 61

Query: 64  ALTAVSMAFIRVMEKNGL---CVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
           A+ AVS+A +RVME           ++ YV GHS+GEYTALCAA A +L   I+L++ R 
Sbjct: 62  AIMAVSIAMLRVMEHMFGKSLFTDHNVKYVCGHSVGEYTALCAAGALTLESAIKLLKVRS 121

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           ++M EA     G MVA++G +   V+ I       GICEIANDNGGGQVVISG ++A++ 
Sbjct: 122 EAMHEASLKCKGGMVALLGAEINEVEDILKSVQIDGICEIANDNGGGQVVISGTREALEM 181

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
             D   N   ++ + L VS PFHSSLM P  + +   L  +    P+VP++ N  A   S
Sbjct: 182 LPDLFKNSSVRKLIKLQVSGPFHSSLMKPADEKVLEFLKGIKITRPIVPLITNVTAKEES 241

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
               I  LL +QV  RV+WRE + + ++ G+    E+G  KVL+ L KRID+S+S  +I 
Sbjct: 242 DPKVIKTLLAKQVVSRVKWREMVLYMSSRGINKFVEIGPNKVLSNLVKRIDQSISTKNID 301

Query: 301 KVEDIDLA 308
            + DID  
Sbjct: 302 SIGDIDSF 309


>gi|255264146|ref|ZP_05343488.1| malonyl CoA-acyl carrier protein transacylase [Thalassiobium sp.
           R2A62]
 gi|255106481|gb|EET49155.1| malonyl CoA-acyl carrier protein transacylase [Thalassiobium sp.
           R2A62]
          Length = 312

 Score =  187 bits (473), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 153/309 (49%), Positives = 209/309 (67%), Gaps = 1/309 (0%)

Query: 4   VLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQP 63
              FPGQG+Q IGMG DL  + PEA+ VF+EVD  L +NLS L+W G   ELT T NAQP
Sbjct: 3   AFVFPGQGAQAIGMGHDLATTVPEAQAVFQEVDDALGENLSKLIWGGDIAELTLTQNAQP 62

Query: 64  ALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSM 123
           AL A S+A +R +E  G+ +    S+VAGHSLGEY+AL AA A SL+DT RL+R RGK+M
Sbjct: 63  ALMATSIAAMRALEARGVSIDA-ASFVAGHSLGEYSALAAAGAISLADTARLLRIRGKAM 121

Query: 124 QEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAAD 183
           Q+AVP G+G+M A++GLD     ++ A+A++  +C+ ANDN   QVV+SG + A++ A D
Sbjct: 122 QDAVPVGVGAMAALLGLDFEAAQAVAAEAAQGDVCQAANDNDPSQVVVSGHKAAIERAVD 181

Query: 184 TCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSID 243
               +GAKRAV LPVSAPFH +LM P +  M   L  V    P VP++ N  A+ VS  D
Sbjct: 182 IAKERGAKRAVLLPVSAPFHCALMQPAADAMATALAEVQISTPAVPVIANVRAAAVSDPD 241

Query: 244 EISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVE 303
           EI  LLVEQVTG VRWRE++Q     GV  ++E+G+GK L+G+ +RI++ ++  ++    
Sbjct: 242 EIRALLVEQVTGSVRWRESVQQMDAEGVTKIWEIGAGKALSGMVRRINRDITCRAVGTSA 301

Query: 304 DIDLALRSI 312
           D+D A+ S+
Sbjct: 302 DVDAAVASL 310


>gi|70729179|ref|YP_258915.1| acyl-carrier-protein S-malonyltransferase [Pseudomonas fluorescens
           Pf-5]
 gi|68343478|gb|AAY91084.1| malonyl CoA-acyl carrier protein transacylase [Pseudomonas
           fluorescens Pf-5]
          Length = 312

 Score =  187 bits (473), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 119/302 (39%), Positives = 170/302 (56%), Gaps = 3/302 (0%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
           S    FPGQGSQ +GM  +L   +P     F+E    L  +L  L   G  E L  T   
Sbjct: 4   SLAFVFPGQGSQSLGMLAELGAQYPLILDTFKEASDALGYDLWALTQEGPAELLNQTDKT 63

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPA+   S+A  RV    G       ++VAGHSLGEY+AL AA + +L +  +LV  RG+
Sbjct: 64  QPAILTASIALWRVWLAEGGA---RPAFVAGHSLGEYSALVAAGSLTLGEAAKLVERRGQ 120

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCA 181
            MQEAVP G G M AI+GL+D  V + CA+A++  +    N N  GQVVI+G + AV  A
Sbjct: 121 LMQEAVPAGQGGMAAILGLEDADVVAACAEAAQGEVVSAVNYNSPGQVVIAGAKAAVDRA 180

Query: 182 ADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSS 241
            + C  +GAKRA+ LPVS P H  LM P ++     + ++  Q P +P++ N  A+  + 
Sbjct: 181 IEGCKARGAKRAMPLPVSVPSHCELMRPAAERFAESIAAINWQAPQIPLVQNVSAAVAAD 240

Query: 242 IDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISK 301
           +D + R L+EQ+   VRW E++Q  A +G   + E G GKVL GL KR  + +S  +++ 
Sbjct: 241 LDTLKRDLLEQLYKPVRWVESVQTLAANGATELVECGPGKVLAGLNKRCAEGVSTSNLNT 300

Query: 302 VE 303
            +
Sbjct: 301 PD 302


>gi|229592108|ref|YP_002874227.1| malonyl CoA-acyl carrier protein transacylase [Pseudomonas
           fluorescens SBW25]
 gi|229363974|emb|CAY51510.1| malonyl CoA-acyl carrier protein transacylase [Pseudomonas
           fluorescens SBW25]
          Length = 312

 Score =  187 bits (473), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 121/305 (39%), Positives = 175/305 (57%), Gaps = 5/305 (1%)

Query: 1   MST--VLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTAT 58
           MST     FPGQGSQ +GM  +L   +P     F+E    L  +L  L   G +E+L  T
Sbjct: 1   MSTSLAFVFPGQGSQSLGMLAELGAQYPLILDTFKEASDALGYDLWALTQQGPEEQLNQT 60

Query: 59  CNAQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRA 118
              QPA+   S+A  R+    G       ++VAGHSLGEY+AL AA + +L + ++LV  
Sbjct: 61  DKTQPAILTASIALWRLWLAEGGA---RPAFVAGHSLGEYSALVAAGSLTLGEAVKLVER 117

Query: 119 RGKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAV 178
           RG+ MQEAVP G G M AI+GLDD VV   CA+A++  +    N N  GQVVI+G + AV
Sbjct: 118 RGQLMQEAVPAGQGGMAAILGLDDAVVIEACAEAAQGEVVSAVNFNSPGQVVIAGAKAAV 177

Query: 179 KCAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASP 238
           + A + C  +GAKRA+ LPVS P H  LM P ++     + ++  Q P +P++ N  A+ 
Sbjct: 178 ERAIEGCKARGAKRALPLPVSVPSHCELMRPAAERFAESIAAINWQAPQIPLVQNVSAAV 237

Query: 239 VSSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVS 298
            + ++ + R L+EQ+   VRW E++Q  A +G   + E G GKVL GL KR    +S  +
Sbjct: 238 AADLETLKRDLLEQLYKPVRWVESVQTLAANGATELVECGPGKVLAGLNKRCADGVSTAN 297

Query: 299 ISKVE 303
           ++  +
Sbjct: 298 LNTPD 302


>gi|21674924|ref|NP_662989.1| malonyl CoA-acyl carrier protein transacylase [Chlorobium tepidum
           TLS]
 gi|21648152|gb|AAM73331.1| malonyl CoA-acyl carrier protein transacylase [Chlorobium tepidum
           TLS]
          Length = 305

 Score =  187 bits (473), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 126/308 (40%), Positives = 176/308 (57%), Gaps = 7/308 (2%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M     FPGQGSQ  GMGRDLY+ FPEA+ + ++ D  L  +++++M+NGS++EL  T  
Sbjct: 1   MK-AFVFPGQGSQYCGMGRDLYERFPEAQELMDKADSILGFSITNIMFNGSEDELKQTRY 59

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
            Q A+   S A   ++ + G      +   AGHSLGEYTALC + A S  D +RLV  RG
Sbjct: 60  TQLAIFLHSFAAATLLGREG------VKMAAGHSLGEYTALCFSGAISFEDAVRLVAKRG 113

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           + MQ A     G+M AIIG+ D  +D++  +AS  GI + AN N  GQ+VISG  DAV+ 
Sbjct: 114 ELMQNAGQQNPGTMAAIIGMADDALDALLEEASASGIVQAANFNSPGQIVISGDVDAVRK 173

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A +   +KGA+ A  L VS  FHS LM P  K     LD++  +D  +P+  N  A PV+
Sbjct: 174 AVELASSKGARMAKELVVSGAFHSPLMKPAEKEFAETLDTIAIRDAEIPVCMNVVAKPVT 233

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
           +  EI   L+ Q+T  V W +++Q   + G+    EVG  KVL GL KRI KS     + 
Sbjct: 234 AATEIRANLISQLTSSVLWSQSVQAMVDAGITEFVEVGPQKVLQGLIKRISKSTMCSGVD 293

Query: 301 KVEDIDLA 308
             + +D  
Sbjct: 294 TADQVDAM 301


>gi|15801209|ref|NP_287226.1| acyl carrier protein S-malonyltransferase [Escherichia coli O157:H7
           EDL933]
 gi|15830724|ref|NP_309497.1| acyl carrier protein S-malonyltransferase [Escherichia coli O157:H7
           str. Sakai]
 gi|168783621|ref|ZP_02808628.1| malonyl CoA-acyl carrier protein transacylase [Escherichia coli
           O157:H7 str. EC4076]
 gi|168790589|ref|ZP_02815596.1| malonyl CoA-acyl carrier protein transacylase [Escherichia coli
           O157:H7 str. EC869]
 gi|195940639|ref|ZP_03086021.1| acyl carrier protein S-malonyltransferase [Escherichia coli O157:H7
           str. EC4024]
 gi|208816188|ref|ZP_03257367.1| malonyl CoA-acyl carrier protein transacylase [Escherichia coli
           O157:H7 str. EC4045]
 gi|208822464|ref|ZP_03262783.1| malonyl CoA-acyl carrier protein transacylase [Escherichia coli
           O157:H7 str. EC4042]
 gi|209398076|ref|YP_002269936.1| malonyl CoA-acyl carrier protein transacylase [Escherichia coli
           O157:H7 str. EC4115]
 gi|217328003|ref|ZP_03444085.1| malonyl CoA-acyl carrier protein transacylase [Escherichia coli
           O157:H7 str. TW14588]
 gi|254792474|ref|YP_003077311.1| malonyl-CoA-[acyl-carrier-protein] transacylase [Escherichia coli
           O157:H7 str. TW14359]
 gi|261227004|ref|ZP_05941285.1| malonyl-CoA-[acyl-carrier-protein] transacylase [Escherichia coli
           O157:H7 str. FRIK2000]
 gi|261256238|ref|ZP_05948771.1| malonyl-CoA-[acyl-carrier-protein] transacylase [Escherichia coli
           O157:H7 str. FRIK966]
 gi|291282112|ref|YP_003498930.1| Malonyl CoA-acyl carrier protein transacylase [Escherichia coli
           O55:H7 str. CB9615]
 gi|77416424|sp|Q8X8I7|FABD_ECO57 RecName: Full=Malonyl CoA-acyl carrier protein transacylase;
           Short=MCT
 gi|12514636|gb|AAG55838.1|AE005319_7 malonyl-CoA-[acyl-carrier-protein] transacylase [Escherichia coli
           O157:H7 str. EDL933]
 gi|13360934|dbj|BAB34893.1| malonyl-CoA-[acyl-carrier-protein] transacylase [Escherichia coli
           O157:H7 str. Sakai]
 gi|188999056|gb|EDU68042.1| malonyl CoA-acyl carrier protein transacylase [Escherichia coli
           O157:H7 str. EC4076]
 gi|189369986|gb|EDU88402.1| malonyl CoA-acyl carrier protein transacylase [Escherichia coli
           O157:H7 str. EC869]
 gi|208732836|gb|EDZ81524.1| malonyl CoA-acyl carrier protein transacylase [Escherichia coli
           O157:H7 str. EC4045]
 gi|208737949|gb|EDZ85632.1| malonyl CoA-acyl carrier protein transacylase [Escherichia coli
           O157:H7 str. EC4042]
 gi|209159476|gb|ACI36909.1| malonyl CoA-acyl carrier protein transacylase [Escherichia coli
           O157:H7 str. EC4115]
 gi|209773218|gb|ACI84921.1| malonyl-CoA-[acyl-carrier-protein [Escherichia coli]
 gi|209773220|gb|ACI84922.1| malonyl-CoA-[acyl-carrier-protein [Escherichia coli]
 gi|209773222|gb|ACI84923.1| malonyl-CoA-[acyl-carrier-protein [Escherichia coli]
 gi|209773224|gb|ACI84924.1| malonyl-CoA-[acyl-carrier-protein [Escherichia coli]
 gi|209773226|gb|ACI84925.1| malonyl-CoA-[acyl-carrier-protein [Escherichia coli]
 gi|217318430|gb|EEC26856.1| malonyl CoA-acyl carrier protein transacylase [Escherichia coli
           O157:H7 str. TW14588]
 gi|254591874|gb|ACT71235.1| malonyl-CoA-[acyl-carrier-protein] transacylase [Escherichia coli
           O157:H7 str. TW14359]
 gi|290761985|gb|ADD55946.1| Malonyl CoA-acyl carrier protein transacylase [Escherichia coli
           O55:H7 str. CB9615]
 gi|320637543|gb|EFX07343.1| malonyl-CoA-[acyl-carrier-protein] transacylase [Escherichia coli
           O157:H7 str. G5101]
 gi|320643104|gb|EFX12305.1| malonyl-CoA-[acyl-carrier-protein] transacylase [Escherichia coli
           O157:H- str. 493-89]
 gi|320648562|gb|EFX17217.1| malonyl-CoA-[acyl-carrier-protein] transacylase [Escherichia coli
           O157:H- str. H 2687]
 gi|320653876|gb|EFX21950.1| malonyl-CoA-[acyl-carrier-protein] transacylase [Escherichia coli
           O55:H7 str. 3256-97 TW 07815]
 gi|320659356|gb|EFX26925.1| malonyl-CoA-[acyl-carrier-protein] transacylase [Escherichia coli
           O55:H7 str. USDA 5905]
 gi|320664491|gb|EFX31642.1| malonyl-CoA-[acyl-carrier-protein] transacylase [Escherichia coli
           O157:H7 str. LSU-61]
 gi|326339314|gb|EGD63128.1| Malonyl CoA-acyl carrier protein transacylase [Escherichia coli
           O157:H7 str. 1125]
          Length = 309

 Score =  187 bits (473), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 128/311 (41%), Positives = 176/311 (56%), Gaps = 4/311 (1%)

Query: 1   MS-TVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATC 59
           M+     FPGQGSQ +GM  D+  S+P     F E    L  +L  L   G  EEL  T 
Sbjct: 1   MTQFAFVFPGQGSQTVGMLADMAASYPIVEETFAEASAALGYDLWALTQQGPAEELNKTW 60

Query: 60  NAQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRAR 119
             QPAL   S+A  RV +++G       + +AGHSLGEY+AL  A     +D +RLV  R
Sbjct: 61  QTQPALLTASVALYRVWQQHGGKA---PAMMAGHSLGEYSALVCAGVIDFADAVRLVEMR 117

Query: 120 GKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVK 179
           GK MQEAVP G G+M AIIGLDD  +   C +A+   +    N N  GQVVI+G ++AV+
Sbjct: 118 GKFMQEAVPEGTGAMAAIIGLDDASIGKACEEAAEGQVVSPVNFNSPGQVVIAGHKEAVE 177

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            A   C   GAKRA+ LPVS P H +LM P +  +   L  +T   P VP++ N      
Sbjct: 178 RAGAACKAAGAKRALPLPVSVPSHCALMKPAADKLAVELAKITFNAPTVPVVNNVDVKCE 237

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
           ++ D I   LV Q+   V+W +++++ A  GV+ +YEVG GKVLTGL KRI  +L+A ++
Sbjct: 238 TNGDAIRDALVRQLYNPVQWTKSVEYMAAQGVEHLYEVGPGKVLTGLTKRIVDTLTASAL 297

Query: 300 SKVEDIDLALR 310
           ++   +  AL 
Sbjct: 298 NEPSAMAAALE 308


>gi|227111678|ref|ZP_03825334.1| acyl carrier protein S-malonyltransferase [Pectobacterium
           carotovorum subsp. brasiliensis PBR1692]
          Length = 309

 Score =  187 bits (473), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 125/311 (40%), Positives = 179/311 (57%), Gaps = 4/311 (1%)

Query: 1   MS-TVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATC 59
           M+   + FPGQGSQ +GM  +L   +P     F +    L  +L  L   G  EEL  T 
Sbjct: 1   MTQFAMVFPGQGSQTVGMLAELAAEYPIVTETFAQASEALGYDLWQLTQQGPAEELNKTW 60

Query: 60  NAQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRAR 119
             QPAL   S+A  RV ++ G    +  + ++GHSLGEY+AL  A        +RLV  R
Sbjct: 61  QTQPALLTASVAIWRVWQQQGG---KTPALMSGHSLGEYSALVCAGVLDFQQAVRLVELR 117

Query: 120 GKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVK 179
           GK MQEAVP G G+M AIIGLD+  +   C ++++  +    N N  GQVVI+G +DAV+
Sbjct: 118 GKLMQEAVPEGTGAMYAIIGLDNEAIAKACEESAQGQVVSPVNFNSPGQVVIAGNKDAVE 177

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            A   C   GAKRA+ LPVS P H +LM P +K +   L+SVT   PV+P++ N  A   
Sbjct: 178 RAGAACKAAGAKRALPLPVSVPSHCALMEPAAKKLAVALESVTFNSPVIPVVNNVDARIE 237

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
           ++ + I   LV Q+   VRW + +++ A+ G++S+ EVG GKVLTGL KRI  +L+A ++
Sbjct: 238 TTPEAIRDALVRQLHCPVRWTDCVEFMASKGIESLLEVGPGKVLTGLTKRIVDTLTAAAV 297

Query: 300 SKVEDIDLALR 310
           +    +  A+ 
Sbjct: 298 NDPASLSAAIE 308


>gi|71083409|ref|YP_266128.1| [acyl-carrier-protein] S-malonyltransferase [Candidatus
           Pelagibacter ubique HTCC1062]
 gi|71062522|gb|AAZ21525.1| [acyl-carrier-protein] S-malonyltransferase [Candidatus
           Pelagibacter ubique HTCC1062]
          Length = 310

 Score =  187 bits (473), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 119/305 (39%), Positives = 184/305 (60%), Gaps = 2/305 (0%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M +V  FPGQGSQ++GMG+DL+  +   + +F+E D TL  +LS+L+ NG +EEL  T N
Sbjct: 1   MFSV-IFPGQGSQLVGMGKDLHAKYSLVQDLFKEADETLGFSLSNLILNGPKEELDLTEN 59

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
            QPA+  +S +  +++++          + AGHSLGEY+AL AA + S SDT+++++ RG
Sbjct: 60  TQPAIFLLSYSIFKLIKEEFKIDLDKAKFYAGHSLGEYSALTAAGSLSFSDTLKILKIRG 119

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
            +MQ +VP G+G MVA++G +  ++  I  +      C IANDN  GQ+V+SG  + ++ 
Sbjct: 120 NAMQNSVPKGVGGMVAVLGSEIEIIKKIIDENKDKYECFIANDNSVGQIVLSGKIEDLEK 179

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
                L     + + LPVSAPFH  LM   + VMK  +  +   +P   ++ N     +S
Sbjct: 180 IM-VDLKASNIKNIKLPVSAPFHCKLMNNATLVMKEEIAKLNFNEPKNILISNVTGKEIS 238

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
           + +E+  LLV+Q+   VRWRE++      GV    E+G GKVL+GL KRIDK++   +I+
Sbjct: 239 NSNELKELLVKQIESSVRWRESVLLMIEKGVTEFIEIGPGKVLSGLIKRIDKNVKVSAIN 298

Query: 301 KVEDI 305
             EDI
Sbjct: 299 SEEDI 303


>gi|83945282|ref|ZP_00957631.1| acyl-carrier-protein S-malonyltransferase [Oceanicaulis alexandrii
           HTCC2633]
 gi|83851452|gb|EAP89308.1| acyl-carrier-protein S-malonyltransferase [Oceanicaulis alexandrii
           HTCC2633]
          Length = 313

 Score =  187 bits (473), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 144/314 (45%), Positives = 192/314 (61%), Gaps = 1/314 (0%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M+   TFPGQGSQ +GMG+ L +SF  AR VFEEVD  L Q LS LMW+G  EELT T N
Sbjct: 1   MALAFTFPGQGSQAVGMGKPLAESFASARAVFEEVDDALGQKLSQLMWDGPIEELTLTEN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
           AQPA+ AVS+A +  ++ +         +VAGHSLGEY+ALCAA A S+SD  +L++ RG
Sbjct: 61  AQPAIMAVSLAAMAALKSDFDVDVTAAKFVAGHSLGEYSALCAAGAVSVSDAAKLLKLRG 120

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           +SMQ+AVP G G+M A++G +    +     A   GI  IANDN  GQ+VISG + AV  
Sbjct: 121 QSMQKAVPVGQGAMAALLGAEMEQAEKAIELAGSEGIVTIANDNAPGQIVISGDKAAVDA 180

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A     + G ++A+ LPVSAPFH  LM P +  M   L S    +P VP++ N  A  VS
Sbjct: 181 AVAAIKDLGVRKAMLLPVSAPFHCPLMEPAADAMADALKSAAISNPSVPVVTNVSAGAVS 240

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
             + +   LVEQVTG+VRWRE++ W    GV+   E G+ KVLT + KR  K     ++ 
Sbjct: 241 DAETLRTQLVEQVTGKVRWRESVDWMHGQGVEQFVEAGA-KVLTTMLKRHIKEAQGTALV 299

Query: 301 KVEDIDLALRSIVG 314
             +D++    S+ G
Sbjct: 300 TADDLEAFAASLKG 313


>gi|225850203|ref|YP_002730437.1| malonyl CoA-acyl carrier protein transacylase [Persephonella marina
           EX-H1]
 gi|225645269|gb|ACO03455.1| malonyl CoA-acyl carrier protein transacylase [Persephonella marina
           EX-H1]
          Length = 326

 Score =  187 bits (473), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 118/307 (38%), Positives = 171/307 (55%), Gaps = 5/307 (1%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
                FPGQGSQ  GMGRD+Y+S+P+ R + E+V+  L  +L+++++   Q ++  T   
Sbjct: 25  KIAFVFPGQGSQYKGMGRDIYESYPQIRELHEKVNERLGFDLTEIIFEDDQ-KINLTQFT 83

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPAL   S +    ++           Y+AGHSLGE+TAL    +    D + +   RGK
Sbjct: 84  QPALVLTSYSVFYALKDK--KPDLLPDYLAGHSLGEFTALAVGGSIDPVDAVWITHIRGK 141

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCA 181
            MQEAVP G+G M AIIGL    ++ I    + V   EIAN N   Q VISG ++AV+ A
Sbjct: 142 LMQEAVPEGVGGMAAIIGLKSEDIEKIIKDINGVV--EIANYNSYEQTVISGEKEAVEKA 199

Query: 182 ADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSS 241
                 KGAK+ V L VS P HSSL+   ++     LD +  +D  +P++ N  A P+  
Sbjct: 200 MKILKEKGAKKVVPLAVSVPAHSSLLRDKAEEFGKYLDEIQIKDLKIPVVSNVTARPIKG 259

Query: 242 IDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISK 301
            DEI   L       VRW +++++    GV S YE+G  KVL+GL KRID+SL+  ++  
Sbjct: 260 SDEIKEELKVHFYSPVRWVQSVEFMIKDGVNSFYEIGPKKVLSGLIKRIDRSLNIKNVEN 319

Query: 302 VEDIDLA 308
           +EDI+  
Sbjct: 320 LEDIEKL 326


>gi|114562674|ref|YP_750187.1| malonyl CoA-acyl carrier protein transacylase [Shewanella
           frigidimarina NCIMB 400]
 gi|114333967|gb|ABI71349.1| [Acyl-carrier-protein] S-malonyltransferase [Shewanella
           frigidimarina NCIMB 400]
          Length = 308

 Score =  187 bits (473), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 122/309 (39%), Positives = 164/309 (53%), Gaps = 3/309 (0%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
           +    FPGQGSQ +GM  +L  S       F E    L  +L DL+ NG  E L  T   
Sbjct: 3   NVAFVFPGQGSQAVGMLAELAQSNDVIGKTFAEASDALGYDLWDLVANGPAETLNETDKT 62

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPAL   S+A            K   S +AGHSLGEY+AL  A     +D ++LV  RGK
Sbjct: 63  QPALLTASVAI---WRAYQASNKTMPSLLAGHSLGEYSALVCAGVIEFTDAVKLVELRGK 119

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCA 181
            MQ+AVP G G+M AIIGLDD  +   CA+++   +    N N  GQVVI+G + AV+ A
Sbjct: 120 LMQQAVPAGSGAMFAIIGLDDDAIAKACAESAEGSVVSPVNYNSPGQVVIAGEKAAVERA 179

Query: 182 ADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSS 241
           A  C   GAK  V LPVS P H +LM P +  +   L  VT  +P + ++ N   +  + 
Sbjct: 180 AAACKAAGAKMTVALPVSVPSHCALMKPAADELAKALIEVTFSEPTINVVNNVDVAMPTD 239

Query: 242 IDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISK 301
              I   LV Q+   VRW E++++ A  GV  + E G GKVLTGL KRI+KS+SA +++ 
Sbjct: 240 SQAIKDALVRQLYCPVRWSESVEFMATQGVTKLIECGPGKVLTGLTKRINKSISAQAVND 299

Query: 302 VEDIDLALR 310
                  + 
Sbjct: 300 AASFAALVE 308


>gi|302383703|ref|YP_003819526.1| malonyl CoA-acyl carrier protein transacylase [Brevundimonas
           subvibrioides ATCC 15264]
 gi|302194331|gb|ADL01903.1| malonyl CoA-acyl carrier protein transacylase [Brevundimonas
           subvibrioides ATCC 15264]
          Length = 316

 Score =  187 bits (473), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 145/316 (45%), Positives = 196/316 (62%), Gaps = 4/316 (1%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M+  L FPGQGSQ +GMG  L ++F  AR VF E+D  L Q+LS LM +G +++LT T N
Sbjct: 1   MTLALLFPGQGSQAVGMGAVLAETFASAREVFAEIDQALGQDLSGLMRDGPEDQLTLTEN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
           AQPAL AVS+A +R+++K         ++VAGHSLGEY+AL AA A S++DT RL++ RG
Sbjct: 61  AQPALMAVSLAVMRLLDKEFGVSVDRAAFVAGHSLGEYSALAAAGALSIADTARLLKLRG 120

Query: 121 KSMQEAVPPGL--GSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAV 178
           ++MQ AVP G    + +     D  + ++  A  + VG C +ANDN  G VVISG + AV
Sbjct: 121 QAMQRAVPVGQGAMASLIGPKTDLALAEAAAAAGAEVGTCVVANDNNNGNVVISGDKAAV 180

Query: 179 KCAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASP 238
             A +     GA+    L VSAPFH  LM P +  M   L S     P VP++ N  A P
Sbjct: 181 DRAIEKAKELGARAI-PLNVSAPFHCPLMQPAADEMAAALASANLIAPSVPVVANVTARP 239

Query: 239 VSSIDEISRLLVEQVTGRVRWRETIQWFANH-GVKSVYEVGSGKVLTGLAKRIDKSLSAV 297
            +  D + RLLVEQVTGRVRWRE++ W A   GV    E+GSGKVLTG+AKRI     ++
Sbjct: 240 ETDADTLRRLLVEQVTGRVRWRESMMWMAGEGGVTRFVEIGSGKVLTGMAKRIAPDAESL 299

Query: 298 SISKVEDIDLALRSIV 313
           +++  EDI+   +S+ 
Sbjct: 300 ALNTPEDIEAFAKSLA 315


>gi|317503264|ref|ZP_07961319.1| malonyl-CoA-[acyl-carrier-protein] transacylase [Prevotella salivae
           DSM 15606]
 gi|315665621|gb|EFV05233.1| malonyl-CoA-[acyl-carrier-protein] transacylase [Prevotella salivae
           DSM 15606]
          Length = 295

 Score =  187 bits (473), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 100/300 (33%), Positives = 150/300 (50%), Gaps = 7/300 (2%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M     FPGQG+Q +GMG+DLY++   A+  F+  D  L   ++++M+NG+ E+L  T  
Sbjct: 1   MK-AFVFPGQGAQFVGMGKDLYETNALAKKYFDRADEILGFKITEIMFNGTDEQLKETKV 59

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIR-LVRAR 119
            QPA+   S+     +         + + VAGHSLGE++AL A+ A    D +R +    
Sbjct: 60  TQPAVFLHSVIQALCL-----GDSFNPAMVAGHSLGEFSALVASGALDFEDGLRLVASRA 114

Query: 120 GKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVK 179
               +            I   D+ V +   + +S   I   AN N  GQ+VISG  +AV 
Sbjct: 115 NAMQKACEINSGTMAAIIGLPDEKVEEICASVSSEGDIVVAANYNCPGQLVISGNVNAVN 174

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            A +     GAKRA+ L VS  FHS LM P    ++  ++  T + P  P+  N  A P 
Sbjct: 175 AACEKLKEAGAKRALPLKVSGAFHSPLMQPAKDELQAAIEKTTFKTPKCPVYQNVDAKPH 234

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
           +  +EI   L+ Q+T  VRW  ++Q   + G     E G GK L G+  RIDK+++A  I
Sbjct: 235 TDAEEIKLNLIAQLTSPVRWTASVQTMIHDGADDFTECGPGKALQGMIGRIDKNVNAHGI 294


>gi|300727910|ref|ZP_07061288.1| hypothetical protein
 gi|299774752|gb|EFI71366.1| [acyl-carrier-protein] S-malonyltransferase [Prevotella bryantii
           B14]
          Length = 295

 Score =  187 bits (473), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 113/301 (37%), Positives = 163/301 (54%), Gaps = 7/301 (2%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M     FPGQGSQ +GMG+DLYD+ P A+ +F++ +  L   ++D+M+ G+ E+L  T  
Sbjct: 1   MK-AFVFPGQGSQFVGMGKDLYDNNPLAKELFDKANEILGFKITDIMFAGTDEQLKETKV 59

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
            QPA+   S+     +         +    AGHSLGE++AL AA A S  D ++LV AR 
Sbjct: 60  TQPAVFLHSVISALCL-----GDDFNPDMTAGHSLGEFSALVAAGALSFEDGLKLVAARA 114

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQV-VISGLQDAVK 179
            +MQ+A     G+M AIIGL D VV+ +C++ S  G   +A +       VISG  DA+ 
Sbjct: 115 NAMQKACEANPGTMAAIIGLADDVVEKVCSEVSADGNIVVAANYNCPGQLVISGNVDAIN 174

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            A +     GAKRA+ LPVS  FHS LM      ++  ++  T   P  P+  N  A P 
Sbjct: 175 AACEKLKEAGAKRALPLPVSGAFHSPLMQLAKDELEAAIEKTTFNAPKCPVYQNVDAQPH 234

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
           +  DEI   L+ Q+TG VRW  ++Q     G     E G G+ L G+  RID++++A  I
Sbjct: 235 TDADEIKNNLIAQLTGSVRWTSSVQNMIAAGADEFVECGPGRALRGMIGRIDRNVNAHGI 294

Query: 300 S 300
            
Sbjct: 295 D 295


>gi|260060615|ref|YP_003193695.1| malonyl CoA-acyl carrier protein transacylase [Robiginitalea
           biformata HTCC2501]
 gi|88784745|gb|EAR15914.1| malonyl CoA-acyl carrier protein transacylase [Robiginitalea
           biformata HTCC2501]
          Length = 295

 Score =  187 bits (473), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 116/298 (38%), Positives = 168/298 (56%), Gaps = 8/298 (2%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M     FPGQG+Q  GMG+DLYD FP+A+++FE+ +  L  +++++M+NGS E+L  T  
Sbjct: 1   MK-AYVFPGQGAQFSGMGKDLYDKFPQAQVLFEQANDILGFSITEVMFNGSAEDLKKTEV 59

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
            QPA+   S+   RV+             VAGHSLGE++AL A    S  + ++LV  R 
Sbjct: 60  TQPAIFLHSVILSRVL-----GDSFAPDMVAGHSLGEFSALVANNTLSFEEGLKLVSQRA 114

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           ++MQ+A      +M A++GL+D VV+ +C  A   G    AN N  GQ+VISG   AV+ 
Sbjct: 115 RAMQKACEAQQSTMAAVLGLEDAVVEEVC--ARVDGTVVAANYNCPGQLVISGEVAAVEA 172

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A +     GA+RA+ LPV   FHS LM P  + +   +      +P  PI  N  AS V+
Sbjct: 173 ACEQLKEAGARRALILPVGGAFHSPLMEPAREELAQAITKAKFSEPSCPIYQNVTASAVT 232

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVS 298
            ID I   L+ Q+T  VRW ++++     G     EVG GKVL GL K+I+  ++A S
Sbjct: 233 DIDAIRHNLIAQLTAPVRWTQSVRQMVADGATEFIEVGPGKVLQGLVKKIESGVAAES 290


>gi|294011590|ref|YP_003545050.1| [acyl-carrier-protein] S-malonyltransferase [Sphingobium japonicum
           UT26S]
 gi|292674920|dbj|BAI96438.1| [acyl-carrier-protein] S-malonyltransferase [Sphingobium japonicum
           UT26S]
          Length = 312

 Score =  187 bits (473), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 133/313 (42%), Positives = 191/313 (61%), Gaps = 2/313 (0%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M     FPGQGSQ +GMG+ L D+ P A+ +F+EVD  L+Q+L  +M  G + +LT T N
Sbjct: 1   MMRAFLFPGQGSQSVGMGKALADASPAAKELFQEVDDALSQHLFRIMVEGPESDLTLTEN 60

Query: 61  AQPALTAVS-MAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRAR 119
           AQPA+ A +      +  + G  +     YVAGHSLGEY+ALCAA+AF +  T +L++ R
Sbjct: 61  AQPAIMANALATLRVMQREGGFSLAEKGDYVAGHSLGEYSALCAAEAFDIGTTAKLLKLR 120

Query: 120 GKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVK 179
           G++MQ AVP G G+M A++G D     ++   A++  +C +ANDN   QVVISG + A++
Sbjct: 121 GRAMQAAVPVGEGAMAALLGADIEKAQALAEAAAQGEVCTVANDNDPTQVVISGHRGAIE 180

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            A     + G +R V LPVSAPFH  LM P ++ M+  L       P++P+  N  AS +
Sbjct: 181 RAVALVKDHGIRRGVLLPVSAPFHCPLMQPAAEAMEDALGKAAINTPLLPVYANVLASAI 240

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
           +  DEI   LVEQVTGRVRWRE++    + GV    E+G GKVL  + KRI    +  S+
Sbjct: 241 ADPDEIRLRLVEQVTGRVRWRESVAAMWDAGVNEFVELG-GKVLGPMVKRIAPDATVRSV 299

Query: 300 SKVEDIDLALRSI 312
             ++DI+ AL ++
Sbjct: 300 VTMDDIEAALGAL 312


>gi|306814059|ref|ZP_07448232.1| malonyl-CoA-[acyl-carrier-protein] transacylase [Escherichia coli
           NC101]
 gi|305852696|gb|EFM53144.1| malonyl-CoA-[acyl-carrier-protein] transacylase [Escherichia coli
           NC101]
 gi|324007860|gb|EGB77079.1| malonyl CoA-acyl carrier protein transacylase [Escherichia coli MS
           57-2]
          Length = 309

 Score =  186 bits (472), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 128/311 (41%), Positives = 175/311 (56%), Gaps = 4/311 (1%)

Query: 1   MS-TVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATC 59
           M+     FPGQGSQ +GM  D+  S+P     F E    L  +L  L   G  EEL  T 
Sbjct: 1   MTQFAFVFPGQGSQTVGMLADMAASYPIVEETFAEASAALGYDLWALTQQGPAEELNKTW 60

Query: 60  NAQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRAR 119
             QPAL   S+A  RV ++ G       + +AGHSLGEY+AL  A     +D +RLV  R
Sbjct: 61  QTQPALLTASVALYRVWQQQGGKA---PAMMAGHSLGEYSALVCAGVIDFADAVRLVEMR 117

Query: 120 GKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVK 179
           GK MQEAVP G G+M AIIGLDD  +   C +A+   +    N N  GQVVI+G ++AV+
Sbjct: 118 GKFMQEAVPEGTGAMAAIIGLDDASIGKACEEAAEGQVVSPVNFNSPGQVVIAGHKEAVE 177

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            A   C   GAKRA+ LPVS P H +LM P +  +   L  +T   P VP++ N      
Sbjct: 178 RAGAACKAAGAKRALPLPVSVPSHCALMKPAADKLAVELAKITFNAPTVPVVNNVDVKCE 237

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
           ++ D I   LV Q+   V+W +++++ A  GV+ +YEVG GKVLTGL KRI  +L+A ++
Sbjct: 238 TNGDAIRDALVRQLYNPVQWTKSVEYMAAQGVEHLYEVGPGKVLTGLTKRIVDTLTASAL 297

Query: 300 SKVEDIDLALR 310
           ++   +  AL 
Sbjct: 298 NEPSAMAAALE 308


>gi|153005598|ref|YP_001379923.1| malonyl CoA-acyl carrier protein transacylase [Anaeromyxobacter sp.
           Fw109-5]
 gi|152029171|gb|ABS26939.1| malonyl CoA-acyl carrier protein transacylase [Anaeromyxobacter sp.
           Fw109-5]
          Length = 313

 Score =  186 bits (472), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 135/314 (42%), Positives = 174/314 (55%), Gaps = 6/314 (1%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
                FPGQGSQ +GMG+DL+D FPEAR VFE VD  L + LS L + G ++ L  T N 
Sbjct: 3   KLAFVFPGQGSQAVGMGKDLHDRFPEARAVFEAVDAALGERLSALCFEGPEDRLRLTANT 62

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QP++  VS A                + VAGHSLGEY+AL AA A   +   + VRARG 
Sbjct: 63  QPSILTVSAAAAA----VLAARGVVPALVAGHSLGEYSALVAAGACGAAAAAKAVRARGT 118

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSIC--AQASRVGICEIANDNGGGQVVISGLQDAVK 179
            MQEAVP G G+M A++GLD   V  IC    A    +   AN N   Q VI+G   AV+
Sbjct: 119 FMQEAVPAGEGAMSAVLGLDPAKVREICAAVAAETGAVVSPANYNEPAQTVIAGAAGAVE 178

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            A       GAKR + LPVSAPFH +LM PV   ++ +L  +    P  P++ N  A P 
Sbjct: 179 QAGVRLKEAGAKRVLPLPVSAPFHCALMAPVKARLEPVLREIPWAAPRCPVVTNVEARPN 238

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
           +    I  LLVEQVT  VRW E ++     GV  V EVG GKVL+GLAKRID+S+   ++
Sbjct: 239 ADAGRIVPLLVEQVTAPVRWIECVEELVRQGVTRVVEVGRGKVLSGLAKRIDRSVETWNV 298

Query: 300 SKVEDIDLALRSIV 313
                ++  L ++ 
Sbjct: 299 EDGASLEKTLAALA 312


>gi|315608750|ref|ZP_07883728.1| malonyl-CoA-[acyl-carrier-protein] transacylase [Prevotella buccae
           ATCC 33574]
 gi|315249600|gb|EFU29611.1| malonyl-CoA-[acyl-carrier-protein] transacylase [Prevotella buccae
           ATCC 33574]
          Length = 294

 Score =  186 bits (472), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 108/300 (36%), Positives = 155/300 (51%), Gaps = 7/300 (2%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M     FPGQGSQ +GMG+DLY++   A+ +F++ D  L   ++D+M+ G+ E+L  T  
Sbjct: 1   MK-AFVFPGQGSQFVGMGKDLYENNALAKELFDKADEILGFKITDIMFAGTDEQLKQTNV 59

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
            QPA+   S+     +           + VAGHSLGE++AL AA A S  D ++LV AR 
Sbjct: 60  TQPAVFLHSVISALCL-----GDDFKPAMVAGHSLGEFSALVAAGALSFEDGLKLVAARA 114

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQV-VISGLQDAVK 179
            +MQ+A     G+M AIIGL D  V+ +C++ S  G   +A +       VISG  +AV 
Sbjct: 115 NAMQKACEANPGTMAAIIGLSDEKVEEVCSEVSANGQIVVAANYNCPGQLVISGNVEAVN 174

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            A +     GAKRA+ L V   FHS LM P    ++  ++      P  P+  N  A   
Sbjct: 175 AACEKLKEAGAKRALPLKVGGAFHSPLMQPAKDELQAAIEQTEFAAPSCPVYQNVDAKAH 234

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
           +   EI   L  Q+T  VRW  ++Q     G     E G GK L G+  RIDK+++   I
Sbjct: 235 TDAAEIKANLTAQLTSPVRWTASVQAMIADGADDFTECGPGKALQGMIGRIDKNVAVKGI 294


>gi|288926991|ref|ZP_06420886.1| malonyl CoA-acyl carrier protein transacylase [Prevotella buccae
           D17]
 gi|288336237|gb|EFC74623.1| malonyl CoA-acyl carrier protein transacylase [Prevotella buccae
           D17]
          Length = 294

 Score =  186 bits (472), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 108/300 (36%), Positives = 155/300 (51%), Gaps = 7/300 (2%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M     FPGQGSQ +GMG+DLY++   A+ +F++ D  L   ++D+M+ G+ E+L  T  
Sbjct: 1   MK-AFVFPGQGSQFVGMGKDLYENNALAKELFDKADEILGFKITDIMFAGTDEQLKQTNV 59

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
            QPA+   S+     +           + VAGHSLGE++AL AA A S  D ++LV AR 
Sbjct: 60  TQPAVFLHSVISALCL-----GDDFKPAMVAGHSLGEFSALVAAGALSFEDGLKLVAARA 114

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQV-VISGLQDAVK 179
            +MQ+A     G+M AIIGL D  V+ +C++ S  G   +A +       VISG  +AV 
Sbjct: 115 NAMQKACEANPGTMAAIIGLSDEKVEEVCSEVSADGQIVVAANYNCPGQLVISGNVEAVN 174

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            A +     GAKRA+ L V   FHS LM P    ++  ++      P  P+  N  A   
Sbjct: 175 AACEKLKEAGAKRALPLKVGGAFHSPLMQPAKDELQAAIEQTEFAAPSCPVYQNVDAKAH 234

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
           +   EI   L  Q+T  VRW  ++Q     G     E G GK L G+  RIDK+++   I
Sbjct: 235 TDAAEIKANLTAQLTSPVRWTASVQAMIADGADDFTECGPGKALQGMIGRIDKNVAVKGI 294


>gi|332758253|gb|EGJ88576.1| malonyl CoA-acyl carrier protein transacylase [Shigella flexneri
           4343-70]
 gi|333005722|gb|EGK25240.1| malonyl CoA-acyl carrier protein transacylase [Shigella flexneri
           K-218]
          Length = 309

 Score =  186 bits (472), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 127/311 (40%), Positives = 174/311 (55%), Gaps = 4/311 (1%)

Query: 1   MS-TVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATC 59
           M+     FPGQGSQ +GM  D+  S+P     F E    L  +L  L   G  EEL  T 
Sbjct: 1   MTQFAFVFPGQGSQTVGMLADMAASYPIVEETFAEASAALGYDLWALTQQGPAEELNKTW 60

Query: 60  NAQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRAR 119
             QPAL   S+A  RV ++ G       + +AGHSLGEY+AL  A     +D +RLV  R
Sbjct: 61  QTQPALLTASVALYRVWQQQGGKA---PAMMAGHSLGEYSALVCAGVIDFADAVRLVEMR 117

Query: 120 GKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVK 179
           GK MQEAVP G G+M AIIGLDD  +   C +A+   +    N N  GQVVI+G ++AV+
Sbjct: 118 GKFMQEAVPEGTGAMAAIIGLDDAPIAKACEEAAEGQVVSPVNFNSPGQVVIAGHKEAVE 177

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            A   C   GAKRA+ LPVS P H +LM P +  +   L  +T   P V ++ N      
Sbjct: 178 RAGAACKAAGAKRALPLPVSVPSHCALMKPAADKLAVELAKITFNAPTVSVVNNVDVKCE 237

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
           ++ D I   LV Q+   V+W +++++ A  GV+ +YEVG GKVLTGL KRI  +L+A ++
Sbjct: 238 TNGDAIRDALVRQLYNPVQWTKSVEYMAAQGVEHLYEVGPGKVLTGLTKRIVDTLTASAL 297

Query: 300 SKVEDIDLALR 310
           ++   +  AL 
Sbjct: 298 NEPSAMAAALE 308


>gi|309799745|ref|ZP_07693960.1| malonyl CoA-acyl carrier protein transacylase [Streptococcus
           infantis SK1302]
 gi|308116634|gb|EFO54095.1| malonyl CoA-acyl carrier protein transacylase [Streptococcus
           infantis SK1302]
          Length = 306

 Score =  186 bits (472), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 108/310 (34%), Positives = 161/310 (51%), Gaps = 6/310 (1%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
            T   F GQG+Q +GMG +LYD +   +   ++    L  +L DL+ +  + +L  T   
Sbjct: 3   KTAFLFAGQGAQYLGMGHELYDQYAIVKETIDQASQVLGYDLRDLI-DNDETKLHQTRYT 61

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPA+ A S+A  R++++ G         VAG SLGEY+AL A+ A    D + LV  RG 
Sbjct: 62  QPAILATSVAIYRLLKEKGY----QPDMVAGLSLGEYSALVASGALDFEDAMALVAKRGA 117

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCA 181
            M+EA P G G MVA++     V++  C +AS++G+   AN N   Q+VI G   AV  A
Sbjct: 118 YMEEAAPAGSGKMVAVLNTPVEVIEKACQEASQLGVVTPANYNTPSQIVIGGEVAAVDRA 177

Query: 182 ADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSS 241
            +     GAKR + L VS PFH++L+ P S+ +   ++ V   D  V  L     + V  
Sbjct: 178 VELLQEAGAKRLIPLNVSGPFHTALLEPASQKLAQAIEDVEFSD-FVCPLVGNTEANVVG 236

Query: 242 IDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISK 301
            + I+ LL  QV   VR+ E+I      GV    E+G GKVL+G  K+IDK+    ++  
Sbjct: 237 KERIAELLTRQVKEPVRFYESIAVMQEAGVTRFIEIGPGKVLSGFVKKIDKTAQLANVED 296

Query: 302 VEDIDLALRS 311
              +   L +
Sbjct: 297 QASLQALLEN 306


>gi|26988642|ref|NP_744067.1| malonyl CoA-acyl carrier protein transacylase [Pseudomonas putida
           KT2440]
 gi|24983423|gb|AAN67531.1|AE016381_8 malonyl CoA-acyl carrier protein transacylase [Pseudomonas putida
           KT2440]
          Length = 312

 Score =  186 bits (472), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 118/302 (39%), Positives = 174/302 (57%), Gaps = 3/302 (0%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
           S    FPGQGSQ +GM  +L    P     F+E    L  +L  L+ +G +E+L  T   
Sbjct: 4   SLAFVFPGQGSQSLGMLAELGAEKPVIIETFKEASEALGYDLWKLVQDGPEEQLNQTDKT 63

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPA+   S+A  R+  + G       ++V+GHSLGEY+AL AA + SL D +RLV  RG+
Sbjct: 64  QPAILTASIALWRLWLEEGGA---KPAFVSGHSLGEYSALVAAGSISLKDAVRLVERRGQ 120

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCA 181
            MQEAVP G G+M AI+GLDD VV  +CA+A+   +    N N  GQVVI+G + AV  A
Sbjct: 121 LMQEAVPAGHGAMAAILGLDDAVVVELCAEAAEDEVVSAVNFNSPGQVVIAGNKAAVDRA 180

Query: 182 ADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSS 241
            + C  KGAKRA+ L VS P H +LM P ++     ++++  + P +P++ N  A+  + 
Sbjct: 181 MELCKAKGAKRALPLAVSVPSHCALMKPAAERFAESVNAIEWKAPQIPVVQNVTAAVAAD 240

Query: 242 IDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISK 301
           +D +   L+ Q+   VRW E +Q  A +G  ++ E G GKVL GL KR    ++  +++ 
Sbjct: 241 LDALKHDLLAQLYQPVRWVECVQTLAANGAVNLVECGPGKVLAGLNKRCADGVTTYNLNT 300

Query: 302 VE 303
            +
Sbjct: 301 PD 302


>gi|16129055|ref|NP_415610.1| malonyl-CoA-[acyl-carrier-protein] transacylase [Escherichia coli
           str. K-12 substr. MG1655]
 gi|26247232|ref|NP_753272.1| acyl carrier protein S-malonyltransferase [Escherichia coli CFT073]
 gi|89107938|ref|AP_001718.1| malonyl-CoA-[acyl-carrier-protein] transacylase [Escherichia coli
           str. K-12 substr. W3110]
 gi|91210244|ref|YP_540230.1| malonyl CoA-acyl carrier protein transacylase [Escherichia coli
           UTI89]
 gi|110641268|ref|YP_668998.1| malonyl CoA-acyl carrier protein transacylase [Escherichia coli
           536]
 gi|117623277|ref|YP_852190.1| malonyl-CoA-[acyl-carrier-protein] transacylase [Escherichia coli
           APEC O1]
 gi|157160618|ref|YP_001457936.1| malonyl CoA-acyl carrier protein transacylase [Escherichia coli HS]
 gi|170020513|ref|YP_001725467.1| malonyl CoA-acyl carrier protein transacylase [Escherichia coli
           ATCC 8739]
 gi|170080743|ref|YP_001730063.1| malonyl-CoA-[acyl-carrier-protein] transacylase [Escherichia coli
           str. K-12 substr. DH10B]
 gi|170683344|ref|YP_001744087.1| malonyl CoA-acyl carrier protein transacylase [Escherichia coli
           SMS-3-5]
 gi|187730061|ref|YP_001880738.1| malonyl CoA-acyl carrier protein transacylase [Shigella boydii CDC
           3083-94]
 gi|188496403|ref|ZP_03003673.1| malonyl CoA-acyl carrier protein transacylase [Escherichia coli
           53638]
 gi|215486303|ref|YP_002328734.1| malonyl-CoA-[acyl-carrier-protein] transacylase [Escherichia coli
           O127:H6 str. E2348/69]
 gi|218553669|ref|YP_002386582.1| malonyl-CoA-[acyl-carrier-protein] transacylase [Escherichia coli
           IAI1]
 gi|218557973|ref|YP_002390886.1| malonyl-CoA-[acyl-carrier-protein] transacylase [Escherichia coli
           S88]
 gi|218689044|ref|YP_002397256.1| malonyl-CoA-[acyl-carrier-protein] transacylase [Escherichia coli
           ED1a]
 gi|218700405|ref|YP_002408034.1| malonyl-CoA-[acyl-carrier-protein] transacylase [Escherichia coli
           IAI39]
 gi|218704501|ref|YP_002412020.1| malonyl-CoA-[acyl-carrier-protein] transacylase [Escherichia coli
           UMN026]
 gi|227886552|ref|ZP_04004357.1| malonyl-CoA-[acyl-carrier-protein] transacylase [Escherichia coli
           83972]
 gi|237706923|ref|ZP_04537404.1| malonyl CoA-acyl carrier protein transacylase [Escherichia sp.
           3_2_53FAA]
 gi|238900346|ref|YP_002926142.1| malonyl-CoA-[acyl-carrier-protein] transacylase [Escherichia coli
           BW2952]
 gi|253773885|ref|YP_003036716.1| malonyl CoA-acyl carrier protein transacylase [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|254161198|ref|YP_003044306.1| acyl carrier protein S-malonyltransferase [Escherichia coli B str.
           REL606]
 gi|256018652|ref|ZP_05432517.1| acyl carrier protein S-malonyltransferase [Shigella sp. D9]
 gi|256023211|ref|ZP_05437076.1| acyl carrier protein S-malonyltransferase [Escherichia sp. 4_1_40B]
 gi|260843332|ref|YP_003221110.1| malonyl-CoA-[acyl-carrier-protein] transacylase FabD [Escherichia
           coli O103:H2 str. 12009]
 gi|293404378|ref|ZP_06648372.1| malonyl CoA-acyl carrier protein transacylase [Escherichia coli
           FVEC1412]
 gi|293409457|ref|ZP_06653033.1| malonyl CoA-acyl carrier protein transacylase [Escherichia coli
           B354]
 gi|293414385|ref|ZP_06657034.1| malonyl CoA-acyl carrier protein transacylase [Escherichia coli
           B185]
 gi|293433381|ref|ZP_06661809.1| malonyl CoA-acyl carrier protein transacylase [Escherichia coli
           B088]
 gi|298380157|ref|ZP_06989762.1| malonyl CoA-acyl carrier protein transacylase [Escherichia coli
           FVEC1302]
 gi|300816792|ref|ZP_07097012.1| malonyl CoA-acyl carrier protein transacylase [Escherichia coli MS
           107-1]
 gi|300899612|ref|ZP_07117850.1| malonyl CoA-acyl carrier protein transacylase [Escherichia coli MS
           198-1]
 gi|300902482|ref|ZP_07120464.1| malonyl CoA-acyl carrier protein transacylase [Escherichia coli MS
           84-1]
 gi|300918697|ref|ZP_07135276.1| malonyl CoA-acyl carrier protein transacylase [Escherichia coli MS
           115-1]
 gi|300922617|ref|ZP_07138716.1| malonyl CoA-acyl carrier protein transacylase [Escherichia coli MS
           182-1]
 gi|300928357|ref|ZP_07143891.1| malonyl CoA-acyl carrier protein transacylase [Escherichia coli MS
           187-1]
 gi|300938658|ref|ZP_07153386.1| malonyl CoA-acyl carrier protein transacylase [Escherichia coli MS
           21-1]
 gi|300948677|ref|ZP_07162758.1| malonyl CoA-acyl carrier protein transacylase [Escherichia coli MS
           116-1]
 gi|300956246|ref|ZP_07168555.1| malonyl CoA-acyl carrier protein transacylase [Escherichia coli MS
           175-1]
 gi|300974394|ref|ZP_07172606.1| malonyl CoA-acyl carrier protein transacylase [Escherichia coli MS
           45-1]
 gi|300982565|ref|ZP_07176187.1| malonyl CoA-acyl carrier protein transacylase [Escherichia coli MS
           200-1]
 gi|301029694|ref|ZP_07192748.1| malonyl CoA-acyl carrier protein transacylase [Escherichia coli MS
           196-1]
 gi|301305674|ref|ZP_07211763.1| malonyl CoA-acyl carrier protein transacylase [Escherichia coli MS
           124-1]
 gi|301328540|ref|ZP_07221601.1| malonyl CoA-acyl carrier protein transacylase [Escherichia coli MS
           78-1]
 gi|301644505|ref|ZP_07244500.1| malonyl CoA-acyl carrier protein transacylase [Escherichia coli MS
           146-1]
 gi|307137727|ref|ZP_07497083.1| malonyl-CoA-[acyl-carrier-protein] transacylase [Escherichia coli
           H736]
 gi|307310131|ref|ZP_07589781.1| malonyl CoA-acyl carrier protein transacylase [Escherichia coli W]
 gi|309796565|ref|ZP_07690972.1| malonyl CoA-acyl carrier protein transacylase [Escherichia coli MS
           145-7]
 gi|312968831|ref|ZP_07783038.1| malonyl CoA-acyl carrier protein transacylase [Escherichia coli
           2362-75]
 gi|331641635|ref|ZP_08342770.1| malonyl CoA-acyl carrier protein transacylase [Escherichia coli
           H736]
 gi|331646349|ref|ZP_08347452.1| malonyl CoA-acyl carrier protein transacylase [Escherichia coli
           M605]
 gi|331662500|ref|ZP_08363423.1| malonyl CoA-acyl carrier protein transacylase [Escherichia coli
           TA143]
 gi|331667492|ref|ZP_08368356.1| malonyl CoA-acyl carrier protein transacylase [Escherichia coli
           TA271]
 gi|331672608|ref|ZP_08373397.1| malonyl CoA-acyl carrier protein transacylase [Escherichia coli
           TA280]
 gi|331676882|ref|ZP_08377578.1| malonyl CoA-acyl carrier protein transacylase [Escherichia coli
           H591]
 gi|331682595|ref|ZP_08383214.1| malonyl CoA-acyl carrier protein transacylase [Escherichia coli
           H299]
 gi|332279721|ref|ZP_08392134.1| malonyl-CoA-[acyl-carrier-protein] transacylase [Shigella sp. D9]
 gi|77416723|sp|P0AAJ0|FABD_ECOL6 RecName: Full=Malonyl CoA-acyl carrier protein transacylase;
           Short=MCT
 gi|77416724|sp|P0AAI9|FABD_ECOLI RecName: Full=Malonyl CoA-acyl carrier protein transacylase;
           Short=MCT
 gi|157831981|pdb|1MLA|A Chain A, The Escherichia Coli Malonyl-Coa:acyl Carrier Protein
           Transacylase At 1.5-Angstroms Resolution. Crystal
           Structure Of A Fatty Acid Synthase Component
 gi|26107633|gb|AAN79832.1|AE016759_106 Malonyl CoA-acyl carrier protein transacylase [Escherichia coli
           CFT073]
 gi|41364|emb|CAA77658.1| malonyl CoA-acyl carrier protein transacylase [Escherichia coli
           K-12]
 gi|145887|gb|AAA23742.1| malonyl coenzyme A-acyl carrier protein transacylase [Escherichia
           coli]
 gi|1651535|dbj|BAA35900.1| malonyl-CoA-[acyl-carrier-protein] transacylase [Escherichia coli
           str. K12 substr. W3110]
 gi|1787334|gb|AAC74176.1| malonyl-CoA-[acyl-carrier-protein] transacylase [Escherichia coli
           str. K-12 substr. MG1655]
 gi|91071818|gb|ABE06699.1| malonyl CoA-acyl carrier protein transacylase [Escherichia coli
           UTI89]
 gi|110342860|gb|ABG69097.1| malonyl CoA-acyl carrier protein transacylase [Escherichia coli
           536]
 gi|115512401|gb|ABJ00476.1| malonyl-CoA-[acyl-carrier-protein] transacylase [Escherichia coli
           APEC O1]
 gi|157066298|gb|ABV05553.1| malonyl CoA-acyl carrier protein transacylase [Escherichia coli HS]
 gi|169755441|gb|ACA78140.1| malonyl CoA-acyl carrier protein transacylase [Escherichia coli
           ATCC 8739]
 gi|169888578|gb|ACB02285.1| malonyl-CoA-[acyl-carrier-protein] transacylase [Escherichia coli
           str. K-12 substr. DH10B]
 gi|170521062|gb|ACB19240.1| malonyl CoA-acyl carrier protein transacylase [Escherichia coli
           SMS-3-5]
 gi|187427053|gb|ACD06327.1| malonyl CoA-acyl carrier protein transacylase [Shigella boydii CDC
           3083-94]
 gi|188491602|gb|EDU66705.1| malonyl CoA-acyl carrier protein transacylase [Escherichia coli
           53638]
 gi|215264375|emb|CAS08732.1| malonyl-CoA-[acyl-carrier-protein] transacylase [Escherichia coli
           O127:H6 str. E2348/69]
 gi|218360437|emb|CAQ97991.1| malonyl-CoA-[acyl-carrier-protein] transacylase [Escherichia coli
           IAI1]
 gi|218364742|emb|CAR02432.1| malonyl-CoA-[acyl-carrier-protein] transacylase [Escherichia coli
           S88]
 gi|218370391|emb|CAR18196.1| malonyl-CoA-[acyl-carrier-protein] transacylase [Escherichia coli
           IAI39]
 gi|218426608|emb|CAR07436.1| malonyl-CoA-[acyl-carrier-protein] transacylase [Escherichia coli
           ED1a]
 gi|218431598|emb|CAR12477.1| malonyl-CoA-[acyl-carrier-protein] transacylase [Escherichia coli
           UMN026]
 gi|226898133|gb|EEH84392.1| malonyl CoA-acyl carrier protein transacylase [Escherichia sp.
           3_2_53FAA]
 gi|227836756|gb|EEJ47222.1| malonyl-CoA-[acyl-carrier-protein] transacylase [Escherichia coli
           83972]
 gi|238861713|gb|ACR63711.1| malonyl-CoA-[acyl-carrier-protein] transacylase [Escherichia coli
           BW2952]
 gi|242376895|emb|CAQ31613.1| malonyl-CoA-ACP transacylase [Escherichia coli BL21(DE3)]
 gi|253324929|gb|ACT29531.1| malonyl CoA-acyl carrier protein transacylase [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|253973099|gb|ACT38770.1| acyl carrier protein S-malonyltransferase [Escherichia coli B str.
           REL606]
 gi|253977313|gb|ACT42983.1| acyl carrier protein S-malonyltransferase [Escherichia coli
           BL21(DE3)]
 gi|257758479|dbj|BAI29976.1| malonyl-CoA-[acyl-carrier-protein] transacylase FabD [Escherichia
           coli O103:H2 str. 12009]
 gi|260449769|gb|ACX40191.1| malonyl CoA-acyl carrier protein transacylase [Escherichia coli
           DH1]
 gi|281178201|dbj|BAI54531.1| malonyl-CoA-[acyl-carrier-protein] transacylase [Escherichia coli
           SE15]
 gi|291324200|gb|EFE63622.1| malonyl CoA-acyl carrier protein transacylase [Escherichia coli
           B088]
 gi|291428964|gb|EFF01989.1| malonyl CoA-acyl carrier protein transacylase [Escherichia coli
           FVEC1412]
 gi|291434443|gb|EFF07416.1| malonyl CoA-acyl carrier protein transacylase [Escherichia coli
           B185]
 gi|291469925|gb|EFF12409.1| malonyl CoA-acyl carrier protein transacylase [Escherichia coli
           B354]
 gi|294493728|gb|ADE92484.1| malonyl CoA-acyl carrier protein transacylase [Escherichia coli
           IHE3034]
 gi|298279855|gb|EFI21363.1| malonyl CoA-acyl carrier protein transacylase [Escherichia coli
           FVEC1302]
 gi|299877382|gb|EFI85593.1| malonyl CoA-acyl carrier protein transacylase [Escherichia coli MS
           196-1]
 gi|300307146|gb|EFJ61666.1| malonyl CoA-acyl carrier protein transacylase [Escherichia coli MS
           200-1]
 gi|300316915|gb|EFJ66699.1| malonyl CoA-acyl carrier protein transacylase [Escherichia coli MS
           175-1]
 gi|300356814|gb|EFJ72684.1| malonyl CoA-acyl carrier protein transacylase [Escherichia coli MS
           198-1]
 gi|300405514|gb|EFJ89052.1| malonyl CoA-acyl carrier protein transacylase [Escherichia coli MS
           84-1]
 gi|300410637|gb|EFJ94175.1| malonyl CoA-acyl carrier protein transacylase [Escherichia coli MS
           45-1]
 gi|300414155|gb|EFJ97465.1| malonyl CoA-acyl carrier protein transacylase [Escherichia coli MS
           115-1]
 gi|300421053|gb|EFK04364.1| malonyl CoA-acyl carrier protein transacylase [Escherichia coli MS
           182-1]
 gi|300451832|gb|EFK15452.1| malonyl CoA-acyl carrier protein transacylase [Escherichia coli MS
           116-1]
 gi|300456397|gb|EFK19890.1| malonyl CoA-acyl carrier protein transacylase [Escherichia coli MS
           21-1]
 gi|300463615|gb|EFK27108.1| malonyl CoA-acyl carrier protein transacylase [Escherichia coli MS
           187-1]
 gi|300530566|gb|EFK51628.1| malonyl CoA-acyl carrier protein transacylase [Escherichia coli MS
           107-1]
 gi|300839102|gb|EFK66862.1| malonyl CoA-acyl carrier protein transacylase [Escherichia coli MS
           124-1]
 gi|300844932|gb|EFK72692.1| malonyl CoA-acyl carrier protein transacylase [Escherichia coli MS
           78-1]
 gi|301077169|gb|EFK91975.1| malonyl CoA-acyl carrier protein transacylase [Escherichia coli MS
           146-1]
 gi|306909849|gb|EFN40343.1| malonyl CoA-acyl carrier protein transacylase [Escherichia coli W]
 gi|307553093|gb|ADN45868.1| malonyl CoA-acyl carrier protein transacylase [Escherichia coli ABU
           83972]
 gi|307627438|gb|ADN71742.1| malonyl-CoA-[acyl-carrier-protein] transacylase [Escherichia coli
           UM146]
 gi|308119877|gb|EFO57139.1| malonyl CoA-acyl carrier protein transacylase [Escherichia coli MS
           145-7]
 gi|309701364|emb|CBJ00665.1| malonyl CoA-acyl carrier protein transacylase [Escherichia coli
           ETEC H10407]
 gi|312286233|gb|EFR14146.1| malonyl CoA-acyl carrier protein transacylase [Escherichia coli
           2362-75]
 gi|315060369|gb|ADT74696.1| malonyl-CoA-[acyl-carrier-protein] transacylase [Escherichia coli
           W]
 gi|315135724|dbj|BAJ42883.1| malonyl CoA-acyl carrier protein transacylase [Escherichia coli
           DH1]
 gi|315253892|gb|EFU33860.1| malonyl CoA-acyl carrier protein transacylase [Escherichia coli MS
           85-1]
 gi|315287418|gb|EFU46829.1| malonyl CoA-acyl carrier protein transacylase [Escherichia coli MS
           110-3]
 gi|315291054|gb|EFU50417.1| malonyl CoA-acyl carrier protein transacylase [Escherichia coli MS
           153-1]
 gi|315296653|gb|EFU55948.1| malonyl CoA-acyl carrier protein transacylase [Escherichia coli MS
           16-3]
 gi|320174243|gb|EFW49404.1| Malonyl CoA-acyl carrier protein transacylase [Shigella dysenteriae
           CDC 74-1112]
 gi|320186960|gb|EFW61673.1| Malonyl CoA-acyl carrier protein transacylase [Shigella flexneri
           CDC 796-83]
 gi|320200987|gb|EFW75571.1| Malonyl CoA-acyl carrier protein transacylase [Escherichia coli
           EC4100B]
 gi|323190512|gb|EFZ75785.1| malonyl CoA-acyl carrier protein transacylase [Escherichia coli
           RN587/1]
 gi|323379070|gb|ADX51338.1| malonyl CoA-acyl carrier protein transacylase [Escherichia coli
           KO11]
 gi|323937832|gb|EGB34096.1| malonyl CoA-acyl carrier protein transacylase [Escherichia coli
           E1520]
 gi|323942561|gb|EGB38728.1| malonyl CoA-acyl carrier protein transacylase [Escherichia coli
           E482]
 gi|323947606|gb|EGB43610.1| malonyl CoA-acyl carrier protein transacylase [Escherichia coli
           H120]
 gi|323953222|gb|EGB49088.1| malonyl CoA-acyl carrier protein transacylase [Escherichia coli
           H252]
 gi|323957916|gb|EGB53628.1| malonyl CoA-acyl carrier protein transacylase [Escherichia coli
           H263]
 gi|323962691|gb|EGB58269.1| malonyl CoA-acyl carrier protein transacylase [Escherichia coli
           H489]
 gi|323967033|gb|EGB62459.1| malonyl CoA-acyl carrier protein transacylase [Escherichia coli
           M863]
 gi|323973319|gb|EGB68508.1| malonyl CoA-acyl carrier protein transacylase [Escherichia coli
           TA007]
 gi|323976535|gb|EGB71623.1| malonyl CoA-acyl carrier protein transacylase [Escherichia coli
           TW10509]
 gi|324013289|gb|EGB82508.1| malonyl CoA-acyl carrier protein transacylase [Escherichia coli MS
           60-1]
 gi|324017470|gb|EGB86689.1| malonyl CoA-acyl carrier protein transacylase [Escherichia coli MS
           117-3]
 gi|324117337|gb|EGC11244.1| malonyl CoA-acyl carrier protein transacylase [Escherichia coli
           E1167]
 gi|327253490|gb|EGE65128.1| malonyl CoA-acyl carrier protein transacylase [Escherichia coli
           STEC_7v]
 gi|330910907|gb|EGH39417.1| malonyl CoA-acyl carrier protein transacylase [Escherichia coli
           AA86]
 gi|331038433|gb|EGI10653.1| malonyl CoA-acyl carrier protein transacylase [Escherichia coli
           H736]
 gi|331045101|gb|EGI17228.1| malonyl CoA-acyl carrier protein transacylase [Escherichia coli
           M605]
 gi|331060922|gb|EGI32886.1| malonyl CoA-acyl carrier protein transacylase [Escherichia coli
           TA143]
 gi|331065077|gb|EGI36972.1| malonyl CoA-acyl carrier protein transacylase [Escherichia coli
           TA271]
 gi|331070251|gb|EGI41617.1| malonyl CoA-acyl carrier protein transacylase [Escherichia coli
           TA280]
 gi|331075571|gb|EGI46869.1| malonyl CoA-acyl carrier protein transacylase [Escherichia coli
           H591]
 gi|331080226|gb|EGI51405.1| malonyl CoA-acyl carrier protein transacylase [Escherichia coli
           H299]
 gi|332094489|gb|EGI99538.1| malonyl CoA-acyl carrier protein transacylase [Shigella boydii
           3594-74]
 gi|332102073|gb|EGJ05419.1| malonyl-CoA-[acyl-carrier-protein] transacylase [Shigella sp. D9]
 gi|332342640|gb|AEE55974.1| malonyl CoA-(acyl-carrier-protein) transacylase FabD [Escherichia
           coli UMNK88]
          Length = 309

 Score =  186 bits (472), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 128/311 (41%), Positives = 175/311 (56%), Gaps = 4/311 (1%)

Query: 1   MS-TVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATC 59
           M+     FPGQGSQ +GM  D+  S+P     F E    L  +L  L   G  EEL  T 
Sbjct: 1   MTQFAFVFPGQGSQTVGMLADMAASYPIVEETFAEASAALGYDLWALTQQGPAEELNKTW 60

Query: 60  NAQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRAR 119
             QPAL   S+A  RV ++ G       + +AGHSLGEY+AL  A     +D +RLV  R
Sbjct: 61  QTQPALLTASVALYRVWQQQGGKA---PAMMAGHSLGEYSALVCAGVIDFADAVRLVEMR 117

Query: 120 GKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVK 179
           GK MQEAVP G G+M AIIGLDD  +   C +A+   +    N N  GQVVI+G ++AV+
Sbjct: 118 GKFMQEAVPEGTGAMAAIIGLDDASIAKACEEAAEGQVVSPVNFNSPGQVVIAGHKEAVE 177

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            A   C   GAKRA+ LPVS P H +LM P +  +   L  +T   P VP++ N      
Sbjct: 178 RAGAACKAAGAKRALPLPVSVPSHCALMKPAADKLAVELAKITFNAPTVPVVNNVDVKCE 237

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
           ++ D I   LV Q+   V+W +++++ A  GV+ +YEVG GKVLTGL KRI  +L+A ++
Sbjct: 238 TNGDAIRDALVRQLYNPVQWTKSVEYMAAQGVEHLYEVGPGKVLTGLTKRIVDTLTASAL 297

Query: 300 SKVEDIDLALR 310
           ++   +  AL 
Sbjct: 298 NEPSAMAAALE 308


>gi|311104746|ref|YP_003977599.1| malonyl CoA-acyl carrier protein transacylase [Achromobacter
           xylosoxidans A8]
 gi|310759435|gb|ADP14884.1| malonyl CoA-acyl carrier protein transacylase [Achromobacter
           xylosoxidans A8]
          Length = 311

 Score =  186 bits (472), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 126/314 (40%), Positives = 166/314 (52%), Gaps = 4/314 (1%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M     FPGQGSQ +GM  D +                L Q+L  L+  G  E+L  T N
Sbjct: 1   MKIAFVFPGQGSQAVGML-DAWSGVAAVTDTVARASQALGQDLGALIAQGPAEQLNLTTN 59

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
            QPA+    +A        G    R    VAGHSLGEY AL AA + +L D +RLVR R 
Sbjct: 60  TQPAMLTAGVAMYAAWCAAGG---RKPDVVAGHSLGEYAALTAAGSLALEDAVRLVRVRA 116

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
            +MQ AVP G G+M AI+GLDD  V + C  A++  + E  N N   QVVI+G + AV+ 
Sbjct: 117 DAMQAAVPVGTGAMAAILGLDDDAVRAACEAAAQGEVVEAVNFNAPAQVVIAGHKAAVER 176

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A +     GAKRA+ LPVSAPFHSSL+ P ++V+   L  VT   P V ++ N   +   
Sbjct: 177 ACELAKAAGAKRALLLPVSAPFHSSLLKPAAEVLAGALAGVTVSAPQVQVINNVDVASPV 236

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
               I   LV Q    VRW ET++     GV  + E G GKVL GL KRID  L+ ++I+
Sbjct: 237 EPGAIRDALVRQAWHPVRWVETLRAMKAQGVTHIIECGPGKVLAGLTKRIDPELTGMAIT 296

Query: 301 KVEDIDLALRSIVG 314
               ++ AL ++ G
Sbjct: 297 DPASLEAALAAVNG 310


>gi|322433878|ref|YP_004216090.1| malonyl CoA-acyl carrier protein transacylase [Acidobacterium sp.
           MP5ACTX9]
 gi|321161605|gb|ADW67310.1| malonyl CoA-acyl carrier protein transacylase [Acidobacterium sp.
           MP5ACTX9]
          Length = 340

 Score =  186 bits (472), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 123/338 (36%), Positives = 178/338 (52%), Gaps = 30/338 (8%)

Query: 4   VLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQP 63
              FPGQGSQ +GMGR+LYD+FP A+ VF+E D  L  +LS L++ G  E L  T + QP
Sbjct: 5   AFLFPGQGSQTVGMGRELYDNFPSAKAVFKEADEVLGFHLSHLIFEGPAETLQLTEHTQP 64

Query: 64  ALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSM 123
           A+  VS+A +RV+ +    ++      AGHSLGEY+A  AA + + +D +R VRARG+ M
Sbjct: 65  AILTVSVAALRVLTE---SLQITPIAAAGHSLGEYSAQVAAGSITFADAVRTVRARGRFM 121

Query: 124 QEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQ-------- 175
           Q+AVPPG GSM AI+GL    V+ +CAQAS         D    +      +        
Sbjct: 122 QQAVPPGAGSMAAILGLSAEQVNDLCAQASEDASAPSPIDTTPSESATPRAEAARSIVSP 181

Query: 176 ---------------DAVKCAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDS 220
                           AV+ A +     GAK+ V L VSAPFH  LM P    +  +L++
Sbjct: 182 ANLNSPEQIVISGATAAVERAVELAKTAGAKKTVILKVSAPFHCGLMQPAQDQLASVLEA 241

Query: 221 VTKQDPVVPILPNFCASPVSSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSG 280
           +   DP  P+  N  A  ++   ++   L+ QVTG VRW E +Q         + E+G G
Sbjct: 242 IDFADPAFPVACNVDARLLTRRADVRDCLIRQVTGSVRWVECLQLLVAQEPTHLIEIGPG 301

Query: 281 KVLTGLAKRID-KSLSA---VSISKVEDIDLALRSIVG 314
           KVLTGL ++I  +++     ++I     +D  L ++ G
Sbjct: 302 KVLTGLTRQILGRNVETPISLNIEDQASLDKTLAALAG 339


>gi|294636829|ref|ZP_06715164.1| malonyl CoA-acyl carrier protein transacylase [Edwardsiella tarda
           ATCC 23685]
 gi|291089972|gb|EFE22533.1| malonyl CoA-acyl carrier protein transacylase [Edwardsiella tarda
           ATCC 23685]
          Length = 304

 Score =  186 bits (472), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 122/307 (39%), Positives = 170/307 (55%), Gaps = 3/307 (0%)

Query: 5   LTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPA 64
           + FPGQGSQ +GM  DL   +P     F E    L  +L  L+  G  E L  T   QPA
Sbjct: 1   MVFPGQGSQSVGMLADLAAHYPLVEQTFAEASEALGYDLWSLVQQGPAEALNKTWQTQPA 60

Query: 65  LTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQ 124
           L   S+A  RV ++N     +  + +AGHSLGEY+AL  A        +RLV  RG+ MQ
Sbjct: 61  LLTASVAIYRVWQQNHG---KQPAMMAGHSLGEYSALVCAGVIDFKQAVRLVELRGQLMQ 117

Query: 125 EAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAADT 184
           +AVP G G+M AIIGLD+  +   CA A++  +    N N  GQVVI+G ++AV+ A   
Sbjct: 118 QAVPEGTGAMYAIIGLDNDAIAQACADAAQGQVVAPVNFNSPGQVVIAGNKEAVERAGAA 177

Query: 185 CLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSIDE 244
           C   GAKRA+ LPVS P H +LM P +  +   L +++   P+ P++ N     VS  D 
Sbjct: 178 CKAAGAKRALPLPVSVPSHCALMKPAADQLAEALKAISFNAPLCPVINNVDVQAVSDADA 237

Query: 245 ISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVED 304
           I   LV Q+   VRW E++Q  +  GV  + E+G GKVLTGL KRI  +++A +++    
Sbjct: 238 IRDALVRQLYNPVRWTESVQQMSAEGVTQLLEIGPGKVLTGLTKRIVDTMTAAAVNDCAS 297

Query: 305 IDLALRS 311
           +  AL  
Sbjct: 298 LSAALEQ 304


>gi|154492864|ref|ZP_02032490.1| hypothetical protein PARMER_02503 [Parabacteroides merdae ATCC
           43184]
 gi|154087169|gb|EDN86214.1| hypothetical protein PARMER_02503 [Parabacteroides merdae ATCC
           43184]
          Length = 293

 Score =  186 bits (472), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 100/296 (33%), Positives = 151/296 (51%), Gaps = 7/296 (2%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M     FPGQG+Q +GMG+DLY++ P A+ +FE+ +  L   ++DLM+ G+ E+L  T  
Sbjct: 1   MK-AYVFPGQGAQFVGMGKDLYENNPLAKEMFEKANEILGFRITDLMFAGTDEDLRQTKV 59

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
            QPA+   S+   + +       +      AGHSLGE++AL AA A S  D + LV  R 
Sbjct: 60  TQPAIFLHSVILAKTL-----GDQFKPDMTAGHSLGEFSALVAAGALSFEDGLVLVSKRA 114

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
            +MQ+A      +M A++ L D  V+     +    +   AN N  GQ+VISG    +  
Sbjct: 115 MAMQKACEATPSTMAAVLALPDEKVE-EICASIEGEVVVCANYNCPGQLVISGSVPGIDA 173

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A +  L  GAKRA+ L V   FHS LM P    +   +++     P  P+  N      +
Sbjct: 174 ACEKMLAAGAKRALKLKVGGAFHSPLMEPARAELAAAIEATPIHKPSCPVYQNVSTKGET 233

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSA 296
             + I   L+ Q+T  VRW +++Q     G     E+G G VL GL K+I+K ++ 
Sbjct: 234 CPETIKTNLIAQLTAPVRWTQSVQNMIADGADHFIELGPGAVLQGLVKKINKEVTT 289


>gi|303238536|ref|ZP_07325070.1| malonyl CoA-acyl carrier protein transacylase [Acetivibrio
           cellulolyticus CD2]
 gi|302593934|gb|EFL63648.1| malonyl CoA-acyl carrier protein transacylase [Acetivibrio
           cellulolyticus CD2]
          Length = 418

 Score =  186 bits (472), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 115/313 (36%), Positives = 167/313 (53%), Gaps = 4/313 (1%)

Query: 1   MS-TVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATC 59
           M    L FPGQGSQ IGMG+ LY+++  AR VF+E +  L  +L +L +NG   ELT T 
Sbjct: 1   MKRIALLFPGQGSQYIGMGKKLYENYATAREVFDEANEALGFDLKELCFNGDINELTKTE 60

Query: 60  NAQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRAR 119
           N QPA+   S+A  RV  +       +  ++AGHSLGE++AL  + A S  D IR+VR R
Sbjct: 61  NTQPAILTASVAAFRVYMEKYAI---EPVFLAGHSLGEFSALTCSGAISFRDAIRIVRNR 117

Query: 120 GKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVK 179
           G+ MQEAVP G+G+M AI G+D   ++  C + S      + +++     ++     +  
Sbjct: 118 GRFMQEAVPQGIGAMAAISGVDKSALEDTCRKVSDENHLVVLSNHNSTDQIVISGHASSV 177

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            AA   L K   R V L VSAPFHS LM P +  +K  L+S +  +    ++ N  A P 
Sbjct: 178 NAASEILKKSGARVVPLKVSAPFHSPLMQPAADRLKEELNSYSYNELKWDVISNATALPY 237

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
              D+I   L  Q+   VRW E++++  + G+    E+G   VL  L KR    + A+S 
Sbjct: 238 RGQDKIIENLTLQIVSPVRWHESMKFLESKGIDMAIELGPQTVLKNLMKRNVPGIPALSF 297

Query: 300 SKVEDIDLALRSI 312
              EDI    R +
Sbjct: 298 DNEEDIPALERKL 310


>gi|58584659|ref|YP_198232.1| (acyl-carrier-protein) S-malonyltransferase, FabD [Wolbachia
           endosymbiont strain TRS of Brugia malayi]
 gi|58418975|gb|AAW70990.1| (acyl-carrier-protein) S-malonyltransferase, FabD [Wolbachia
           endosymbiont strain TRS of Brugia malayi]
          Length = 326

 Score =  186 bits (472), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 138/308 (44%), Positives = 189/308 (61%), Gaps = 3/308 (0%)

Query: 4   VLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQP 63
           +  FPGQGSQ +GMGRDLY  F  A+ VF+EVD  L + LS L++NG  EELT T NAQP
Sbjct: 2   IFAFPGQGSQFVGMGRDLYSQFSVAKQVFDEVDSILGRKLSHLIFNGPVEELTITENAQP 61

Query: 64  ALTAVSMAFIRVMEKNGLC---VKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
           A+TAVS+A +RVME           D+ YV GHS+GEYTALCAA A +L  T++L++AR 
Sbjct: 62  AITAVSIATLRVMEHVFGKSLLSDHDVKYVCGHSVGEYTALCAAGALTLESTVKLLKARS 121

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           ++M +A     G MVA++G +   V+ I   A    I  IANDNGGGQVV+SG  +A++ 
Sbjct: 122 EAMHKASLKCKGGMVALLGAEISEVEDILESAQIDEIYGIANDNGGGQVVVSGTAEALEI 181

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
                 N   ++ + L VS PFHSSLM P  + +   L+S+    P +P + N  A   S
Sbjct: 182 LPGLFKNSSVRKLIKLQVSGPFHSSLMRPADEKILEFLESIDITHPSIPFVSNVTAKEES 241

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
           + + I  LL +Q+  RV+WRE +   A+ G+    E+G  KVL+ L KRID+S+S  +I 
Sbjct: 242 NPETIKILLAKQIVSRVKWREMVLHMASSGINEFVEIGPNKVLSNLVKRIDQSISTKNIG 301

Query: 301 KVEDIDLA 308
            + DID  
Sbjct: 302 SISDIDSF 309


>gi|121601676|ref|YP_988811.1| malonyl CoA-acyl carrier protein transacylase [Bartonella
           bacilliformis KC583]
 gi|120613853|gb|ABM44454.1| malonyl CoA-acyl carrier protein transacylase [Bartonella
           bacilliformis KC583]
          Length = 314

 Score =  186 bits (472), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 174/312 (55%), Positives = 223/312 (71%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M    TFPGQGSQV+GMG+ L + F EAR+VFEEVD  L + LS +++ G ++ LT T N
Sbjct: 1   MVAAFTFPGQGSQVVGMGKMLTEQFVEARMVFEEVDDALGEKLSHIIFEGPEDLLTLTAN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
           AQPAL AVS+A IRVMEK GL ++  + +VAGHSLGEY+ALCAA  FSL+DT RL+R RG
Sbjct: 61  AQPALMAVSLAIIRVMEKLGLNIESKVKFVAGHSLGEYSALCAANTFSLADTARLLRIRG 120

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
            +MQEAV  G G M A+IGL++  V+ IC    + GIC+IANDNGGGQ+VISG   AV+ 
Sbjct: 121 NAMQEAVAVGEGLMAALIGLNEQEVEEICKAVVKEGICQIANDNGGGQIVISGEAKAVQA 180

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A      KGAKRA+ LPVSAPFHSSLM P +  MK  L  V    PV+P++ N   +P +
Sbjct: 181 AVKIASEKGAKRAILLPVSAPFHSSLMQPAADAMKDALRIVNLAAPVIPLIANVSVAPEN 240

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
             + I  LLV QVTG+VRWRETI+WF  HGV  ++E+GSGKVLTGLA+RI+K +  ++I 
Sbjct: 241 DPERILTLLVHQVTGQVRWRETIEWFGAHGVDMLFEIGSGKVLTGLARRINKDIKGLTIG 300

Query: 301 KVEDIDLALRSI 312
             E+I+ AL+ +
Sbjct: 301 TAEEIEEALKIL 312


>gi|289432957|ref|YP_003462830.1| malonyl CoA-acyl carrier protein transacylase [Dehalococcoides sp.
           GT]
 gi|288946677|gb|ADC74374.1| malonyl CoA-acyl carrier protein transacylase [Dehalococcoides sp.
           GT]
          Length = 310

 Score =  186 bits (472), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 118/308 (38%), Positives = 175/308 (56%), Gaps = 5/308 (1%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
            T   FPGQG+Q +GMGRDLY  F  AR +F+  D  L  +LS L + G +E+L  T ++
Sbjct: 5   KTAYVFPGQGAQFVGMGRDLYSEFHSARELFDLADKALGFSLSKLCFEGPEEDLKDTRHS 64

Query: 62  QPALTAVSMAFIRVMEKNGLC-VKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
           Q A+   S++ +    ++G   +  + S+VAGHSLGEY+AL A+        I L R RG
Sbjct: 65  QSAIVCHSLSALSAFIESGKSKLLPEPSFVAGHSLGEYSALGASGILPYVQAILLARKRG 124

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           + M EA     G+M A+IG+   ++            C IAN N  GQ+VISGL++AV  
Sbjct: 125 ELMAEAAAKTPGAMAAVIGISQEILS----DICLKTDCYIANFNSPGQLVISGLKEAVDQ 180

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A+      GA + V L VS  FH+ LM+P S  +K ML+S+  +   +P++ N  A PVS
Sbjct: 181 ASAQATASGAMKVVTLQVSGGFHTPLMSPASTGLKEMLNSMDFKTARIPLVANTSACPVS 240

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
           +  ++   L  Q+TG V+W+++I+     GV +  E+G GKVL GL KRI++S+S  +I+
Sbjct: 241 TPQDVKAELYCQLTGGVQWQKSIENMIASGVNTFVEIGPGKVLAGLIKRINRSVSIYNIN 300

Query: 301 KVEDIDLA 308
               I   
Sbjct: 301 DAASIQNF 308


>gi|261367526|ref|ZP_05980409.1| malonyl CoA-acyl carrier protein transacylase [Subdoligranulum
           variabile DSM 15176]
 gi|282570308|gb|EFB75843.1| malonyl CoA-acyl carrier protein transacylase [Subdoligranulum
           variabile DSM 15176]
          Length = 314

 Score =  186 bits (472), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 102/315 (32%), Positives = 156/315 (49%), Gaps = 5/315 (1%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M     + GQGSQ  GMG DLY+     R VF+E    L+ +L    +   Q  +  T  
Sbjct: 1   MKLAFLYAGQGSQHAGMGADLYEVSSVFRKVFDEAASVLDFDLKTTCFEDPQGVINQTRY 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
            QP + A +     ++   G+       Y AG SLGEY+AL  A        + LV  RG
Sbjct: 61  TQPCMVAFAAGVTAMLADAGI----RPDYAAGLSLGEYSALECADVLDAKSAVELVAFRG 116

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           ++M +A       M A++ LD   + + C +AS +G+ +I N N  GQ+VI G + AV  
Sbjct: 117 QAMAKASEGLDCGMTAVLMLDRDKLQACCNEASGLGVVQICNYNCPGQLVIGGEKAAVDR 176

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           AA+     GAKR + L VS PFH+ LM P +  +      VT     +P+L N      +
Sbjct: 177 AAELAKEAGAKRCLPLKVSGPFHTILMHPAAVALAERFQDVTFSPMRMPVLFNCLGHEKA 236

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKS-LSAVSI 299
             D I+ LLV QV   V   +TI+  A+ GV +V E+G G  ++G  K+   S ++ +++
Sbjct: 237 PGDSIADLLVRQVQSSVYLEDTIRRLADLGVDTVVEIGPGHTISGFVKKTVGSAITCLNV 296

Query: 300 SKVEDIDLALRSIVG 314
             + D + A+ ++ G
Sbjct: 297 ETMADFEKAVAALRG 311


>gi|110805106|ref|YP_688626.1| acyl carrier protein S-malonyltransferase [Shigella flexneri 5 str.
           8401]
 gi|260867455|ref|YP_003233857.1| malonyl-CoA-[acyl-carrier-protein] transacylase FabD [Escherichia
           coli O111:H- str. 11128]
 gi|110614654|gb|ABF03321.1| malonyl-CoA-[acyl-carrier-protein] transacylase [Shigella flexneri
           5 str. 8401]
 gi|257763811|dbj|BAI35306.1| malonyl-CoA-[acyl-carrier-protein] transacylase FabD [Escherichia
           coli O111:H- str. 11128]
 gi|320179209|gb|EFW54167.1| Malonyl CoA-acyl carrier protein transacylase [Shigella boydii ATCC
           9905]
 gi|323175677|gb|EFZ61271.1| malonyl CoA-acyl carrier protein transacylase [Escherichia coli
           1180]
 gi|332089143|gb|EGI94252.1| malonyl CoA-acyl carrier protein transacylase [Shigella boydii
           5216-82]
 gi|333004902|gb|EGK24422.1| malonyl CoA-acyl carrier protein transacylase [Shigella flexneri
           VA-6]
 gi|333008298|gb|EGK27772.1| malonyl CoA-acyl carrier protein transacylase [Shigella flexneri
           K-272]
 gi|333019787|gb|EGK39059.1| malonyl CoA-acyl carrier protein transacylase [Shigella flexneri
           K-227]
          Length = 309

 Score =  186 bits (472), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 127/311 (40%), Positives = 174/311 (55%), Gaps = 4/311 (1%)

Query: 1   MS-TVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATC 59
           M+     FPGQGSQ +GM  D+  S+P     F E    L  +L  L   G  EEL  T 
Sbjct: 1   MTQFAFVFPGQGSQTVGMLADMAASYPIVEETFAEASAALGYDLWALTQQGPAEELNKTW 60

Query: 60  NAQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRAR 119
             QPAL   S+A  RV ++ G       + +AGHSLGEY+AL  A     +D +RLV  R
Sbjct: 61  QTQPALLTASVALYRVWQQQGGKA---PAMMAGHSLGEYSALVCAGVIDFADAVRLVEMR 117

Query: 120 GKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVK 179
           GK MQEAVP G G+M AIIGLDD  +   C +A+   +    N N  GQVVI+G ++AV+
Sbjct: 118 GKFMQEAVPEGTGAMAAIIGLDDASIAKACEEAAEGQVVSPVNFNSPGQVVIAGHKEAVE 177

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            A   C   GAKRA+ LPVS P H +LM P +  +   L  +T   P V ++ N      
Sbjct: 178 RAGAACKAAGAKRALPLPVSVPSHCALMKPAADKLAVELAKITFNAPTVSVVNNVDVKCE 237

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
           ++ D I   LV Q+   V+W +++++ A  GV+ +YEVG GKVLTGL KRI  +L+A ++
Sbjct: 238 TNGDAIRDALVRQLYNPVQWTKSVEYMAAQGVEHLYEVGPGKVLTGLTKRIVDTLTASAL 297

Query: 300 SKVEDIDLALR 310
           ++   +  AL 
Sbjct: 298 NEPSAMAAALE 308


>gi|239996666|ref|ZP_04717190.1| malonyl CoA-acyl carrier protein transacylase [Alteromonas
           macleodii ATCC 27126]
          Length = 309

 Score =  186 bits (472), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 130/309 (42%), Positives = 182/309 (58%), Gaps = 6/309 (1%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
            T   FPGQGSQ +GM ++L ++ P     F+E    L  +L DL+ N +  +L  T   
Sbjct: 3   KTACVFPGQGSQSVGMLKELAETSPIIEATFKEASDALGYDLWDLVQNDTDGKLNETHIT 62

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPAL A S+A  RV+ + G+    D+ Y+AGHSLGEY+AL    A   +D I+LV ARGK
Sbjct: 63  QPALLAASVAIWRVIREQGI----DVDYLAGHSLGEYSALVCGGAMDFADAIKLVEARGK 118

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIAN--DNGGGQVVISGLQDAVK 179
            MQEAVP G G+M AIIGLDD  +  IC Q +      +A    N  GQVVI+G ++A +
Sbjct: 119 YMQEAVPAGAGAMYAIIGLDDAAIADICQQTAIATGDVVAPVNFNSPGQVVIAGEKNAAE 178

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            AA+ C   GAKRA+ L VS P H  LM P +  ++  L S+   +P + I+ N   +  
Sbjct: 179 QAANACKEAGAKRALPLAVSVPSHCELMRPAADKLEDALSSLNVNEPAINIVNNVDVTIE 238

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
           +  D I   LV Q+   V+W  T+++ A  GV+ V EVG GKVLTGL KRIDKSL ++++
Sbjct: 239 TQGDAIKNALVRQLYCPVQWTRTVEYLAAAGVERVIEVGPGKVLTGLNKRIDKSLESLAV 298

Query: 300 SKVEDIDLA 308
           +  + ++  
Sbjct: 299 NTPDGVEAL 307


>gi|319941440|ref|ZP_08015768.1| malonyl CoA-acyl carrier protein transacylase [Sutterella
           wadsworthensis 3_1_45B]
 gi|319805060|gb|EFW01890.1| malonyl CoA-acyl carrier protein transacylase [Sutterella
           wadsworthensis 3_1_45B]
          Length = 310

 Score =  186 bits (472), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 124/313 (39%), Positives = 166/313 (53%), Gaps = 4/313 (1%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M     FPGQGSQ +GM     D+           +  L ++L  L+  G  E L+ T N
Sbjct: 1   MRIAFVFPGQGSQSVGMLSGFADN-AVVADYMARANAALGEDLVKLIAEGPAEVLSLTVN 59

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
            QPAL A S AF       G    R    +AGHSLGEY+AL +A  F+  D ++LVR R 
Sbjct: 60  TQPALLAASAAFYEAWIAAGG---RRPDVMAGHSLGEYSALTSAGTFAFEDAVKLVRFRA 116

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           ++MQEAVP G+G M A+IGLDD  V   C +AS VG  E  N N  GQVVI+G  D +  
Sbjct: 117 QAMQEAVPVGVGGMAAVIGLDDEAVIEACREASAVGPVEPVNFNSPGQVVIAGRSDGLAK 176

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A +    +G +RA+ L VS PFHSSL+ P  + +   L  V    P VP+  N  A   +
Sbjct: 177 AVELLKARGCRRAIPLAVSGPFHSSLLAPAGERLAKHLAEVKVSAPSVPVYANVTAQLHT 236

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
           + DEI  LL +QV+  V+W + ++     GV  + E G GKVLTGL KRI   +    IS
Sbjct: 237 TPDEIRALLAQQVSSAVQWTKIVKAMEASGVTDIVECGPGKVLTGLVKRIAPEIRLHGIS 296

Query: 301 KVEDIDLALRSIV 313
               ++  L ++ 
Sbjct: 297 SEATLEATLEALA 309


>gi|148549007|ref|YP_001269109.1| malonyl CoA-acyl carrier protein transacylase [Pseudomonas putida
           F1]
 gi|148513065|gb|ABQ79925.1| [Acyl-carrier-protein] S-malonyltransferase [Pseudomonas putida F1]
          Length = 312

 Score =  186 bits (472), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 119/302 (39%), Positives = 174/302 (57%), Gaps = 3/302 (0%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
           S    FPGQGSQ +GM  +L    P     F+E    L  +L  L+ +G +E+L  T   
Sbjct: 4   SLAFVFPGQGSQSLGMLAELGAEKPVIIETFKEASEALGYDLWKLVQDGPEEQLNQTDKT 63

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPA+   S+A  R+  + G       ++V+GHSLGEY+AL AA + SL D +RLV  RG+
Sbjct: 64  QPAILTASIALWRLWLEEGGA---KPAFVSGHSLGEYSALVAAGSISLKDAVRLVERRGQ 120

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCA 181
            MQEAVP G G+M AI+GLDD VV  ICA+A+   +    N N  GQVVI+G + AV  A
Sbjct: 121 LMQEAVPAGHGAMAAILGLDDAVVVEICAEAAEDEVVSAVNFNSPGQVVIAGNKAAVDRA 180

Query: 182 ADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSS 241
            + C  KGAKRA+ L VS P H +LM P ++     ++++  + P +P++ N  A+  + 
Sbjct: 181 MELCKAKGAKRALPLAVSVPSHCALMKPAAERFADSVNAIEWKAPQIPVVQNVTAAVAAD 240

Query: 242 IDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISK 301
           +D +   L+ Q+   VRW E +Q  A +G  ++ E G GKVL GL KR    ++  +++ 
Sbjct: 241 LDALKHDLLAQLYQPVRWVECVQTLAANGAVNLVECGPGKVLAGLNKRCADGVTTYNLNT 300

Query: 302 VE 303
            +
Sbjct: 301 PD 302


>gi|323175245|gb|EFZ60858.1| malonyl CoA-acyl carrier protein transacylase [Escherichia coli
           LT-68]
          Length = 309

 Score =  186 bits (472), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 128/311 (41%), Positives = 176/311 (56%), Gaps = 4/311 (1%)

Query: 1   MS-TVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATC 59
           M+     FPGQGSQ +GM  D+  S+P     F E    L  +L  L   G  EEL  T 
Sbjct: 1   MTQFAFVFPGQGSQTVGMLADMAASYPIVEETFAEASAALGYDLWALTQQGPAEELNKTW 60

Query: 60  NAQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRAR 119
             QPAL   S+A  RV ++ G    +  + +AGHSLGEY+AL  A     +D +RLV  R
Sbjct: 61  QTQPALLTASVALYRVWQQQGG---KTPAMMAGHSLGEYSALVCAGVIDFADAVRLVEMR 117

Query: 120 GKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVK 179
           GK MQEAVP G G+M AIIGLDD  +   C +A+   +    N N  GQVVI+G ++AV+
Sbjct: 118 GKFMQEAVPEGTGAMAAIIGLDDASIAKACEEAAEGQVVSPVNFNSPGQVVIAGHKEAVE 177

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            A   C   GAKRA+ LPVS P H +LM P +  +   L  +T   P VP++ N      
Sbjct: 178 RAGAACKAAGAKRALPLPVSVPSHCALMKPAADKLAVELAKITFNAPTVPVVNNVDVKCE 237

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
           ++ D I   LV Q+   V+W +++++ A  GV+ +YEVG GKVLTGL KRI  +L+A ++
Sbjct: 238 TNGDAIRDALVRQLYNPVQWTKSVEYMAAQGVEHLYEVGPGKVLTGLTKRIVDTLTASAL 297

Query: 300 SKVEDIDLALR 310
           ++   +  AL 
Sbjct: 298 NEPSAMAAALE 308


>gi|209918347|ref|YP_002292431.1| malonyl-CoA-[acyl-carrier-protein] transacylase [Escherichia coli
           SE11]
 gi|209911606|dbj|BAG76680.1| malonyl-CoA-[acyl-carrier-protein] transacylase [Escherichia coli
           SE11]
          Length = 309

 Score =  186 bits (472), Expect = 4e-45,   Method: Composition-based stats.
 Identities = 127/311 (40%), Positives = 174/311 (55%), Gaps = 4/311 (1%)

Query: 1   MS-TVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATC 59
           M+     FPGQGSQ +GM  D+  S+P     F E    L  +L  L   G  EEL  T 
Sbjct: 1   MTQFAFVFPGQGSQTVGMLADMAASYPIVEETFAEASAALGYDLWALTQQGPAEELNKTW 60

Query: 60  NAQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRAR 119
             QPAL   S+A   V ++ G       + +AGHSLGEY+AL  A     +D +RLV  R
Sbjct: 61  QTQPALLTASVALYGVWQQQGGKA---PAMMAGHSLGEYSALVCAGVIDFADAVRLVEMR 117

Query: 120 GKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVK 179
           GK MQEAVP G G+M AIIGLDD  +   C +A+   +    N N  GQVVI+G ++AV+
Sbjct: 118 GKFMQEAVPEGTGAMAAIIGLDDASIAKACEEAAEGQVVSPVNFNSPGQVVIAGHKEAVE 177

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            A   C   GAKRA+ LPVS P H +LM P +  +   L  +T   P VP++ N      
Sbjct: 178 RAGAACKAAGAKRALPLPVSVPSHCALMKPAADKLAVELAKITFNAPTVPVVNNVDVKCE 237

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
           ++ D I   LV Q+   V+W +++++ A  GV+ +YEVG GKVLTGL KRI  +L+A ++
Sbjct: 238 TNGDAIRDALVRQLYNPVQWTKSVEYMAAQGVEHLYEVGPGKVLTGLTKRIVDTLTASAL 297

Query: 300 SKVEDIDLALR 310
           ++   +  AL 
Sbjct: 298 NEPSAMAAALE 308


>gi|284920917|emb|CBG33980.1| malonyl CoA-acyl carrier protein transacylase [Escherichia coli
           042]
          Length = 309

 Score =  186 bits (472), Expect = 4e-45,   Method: Composition-based stats.
 Identities = 127/311 (40%), Positives = 174/311 (55%), Gaps = 4/311 (1%)

Query: 1   MS-TVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATC 59
           M+     FPGQGSQ +GM  D+  S+P     F E    L  +L  L   G  EEL  T 
Sbjct: 1   MTQFAFVFPGQGSQTVGMLADMAASYPIVEETFAEASAALGYDLWALTQQGPAEELNKTW 60

Query: 60  NAQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRAR 119
             QPAL   S+A  RV ++ G       + +AGHSLGEY+AL  A     +D +RLV  R
Sbjct: 61  QTQPALLTASVALYRVWQQQGGKA---PAMMAGHSLGEYSALVCAGVIDFADAVRLVEMR 117

Query: 120 GKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVK 179
           GK MQEAVP G G+M AIIGLDD  +   C +A+   +    N N  GQVVI+G ++AV+
Sbjct: 118 GKFMQEAVPEGTGAMAAIIGLDDASIAKACEEAAEGQVVSPVNFNSPGQVVIAGHKEAVE 177

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            A   C   GAKRA+ LPVS P H +LM P +  +   L  +T     VP++ N      
Sbjct: 178 RAGVACKAAGAKRALPLPVSVPSHCALMKPAADKLAVELAKITFNASTVPVVNNVDVKCE 237

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
           ++ D I   LV Q+   V+W +++++ A  GV+ +YEVG GKVLTGL KRI  +L+A ++
Sbjct: 238 TNGDAIRDALVRQLYNPVQWTKSVEYMAAQGVEHLYEVGPGKVLTGLTKRIVDTLTASAL 297

Query: 300 SKVEDIDLALR 310
           ++   +  AL 
Sbjct: 298 NEPSAMAAALE 308


>gi|77460379|ref|YP_349886.1| [Acyl-carrier-protein] S-malonyltransferase [Pseudomonas
           fluorescens Pf0-1]
 gi|77384382|gb|ABA75895.1| malonyl CoA-acyl carrier protein transacylase [Pseudomonas
           fluorescens Pf0-1]
          Length = 312

 Score =  186 bits (472), Expect = 4e-45,   Method: Composition-based stats.
 Identities = 119/302 (39%), Positives = 172/302 (56%), Gaps = 3/302 (0%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
           S    FPGQGSQ +GM  +L    P     F+E    L  +L  L   G +E L  T   
Sbjct: 4   SLAFVFPGQGSQSLGMLAELGAQHPLILETFKEASDALGYDLWALTQQGPEELLNQTDKT 63

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPA+   S+A  R+    G       ++VAGHSLGEY+AL AA + SL+D ++LV  RG+
Sbjct: 64  QPAILTASVALWRLWLAEGGA---RPAFVAGHSLGEYSALVAAGSLSLADAVKLVERRGQ 120

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCA 181
            MQEAVP G G M AI+GL+D  V + CA+A++  +    N N  GQVVI+G + AV+ A
Sbjct: 121 LMQEAVPAGQGGMAAILGLEDADVLAACAEAAQGEVVSAVNFNSPGQVVIAGAKAAVERA 180

Query: 182 ADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSS 241
            + C  +GAKRA+ LPVS P H  LM P ++     + ++  Q P +P++ N  A   + 
Sbjct: 181 IEGCKARGAKRAMPLPVSVPSHCELMRPAAERFAESIAAIDWQAPQIPVVQNVSAQVPAD 240

Query: 242 IDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISK 301
           ++ + R L+EQ+   VRW E++Q  A  G  ++ E G GKVL GL KR  + +S  +++ 
Sbjct: 241 LETLKRDLLEQLYKPVRWVESVQTLAAKGATNLVECGPGKVLAGLNKRCAEGVSTSNLNT 300

Query: 302 VE 303
            +
Sbjct: 301 PD 302


>gi|300311248|ref|YP_003775340.1| malonyl CoA-[acyl-carrier-protein] transacylase [Herbaspirillum
           seropedicae SmR1]
 gi|300074033|gb|ADJ63432.1| malonyl CoA-[acyl-carrier-protein] transacylase protein
           [Herbaspirillum seropedicae SmR1]
          Length = 310

 Score =  186 bits (471), Expect = 4e-45,   Method: Composition-based stats.
 Identities = 132/314 (42%), Positives = 173/314 (55%), Gaps = 5/314 (1%)

Query: 1   MST-VLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATC 59
           M+T    FPGQGSQ IGM     D+    R    E    L  +L  L+  G +E+L  T 
Sbjct: 1   MTTFAFVFPGQGSQAIGMLNGFADN-DVVRQTVAEASDALQFDLGKLIAEGPKEDLDLTT 59

Query: 60  NAQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRAR 119
           N QP +   ++AF R     G       + VAGHSLGEY+AL AA   +  D + LVR R
Sbjct: 60  NTQPVMLTAAVAFYRAWLAAGGKA---PALVAGHSLGEYSALVAAGVIAFKDAVPLVRFR 116

Query: 120 GKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVK 179
            ++MQEAVP G G M AI+GL D  V + CA+A++  + E  N N   QVVI+G + AV+
Sbjct: 117 AQAMQEAVPVGQGGMAAILGLSDEDVRAACAEAAQGDVVEAVNFNAPAQVVIAGHKAAVE 176

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            A D    KGAKRA+ LPVSAPFHSSL+ P S  ++  L +V    P +P++ N   + V
Sbjct: 177 RACDIAKAKGAKRALPLPVSAPFHSSLLKPASDRLQAYLANVAFSAPQIPLINNVDVAVV 236

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
           +    I   LV Q    VRW ET+Q  A  GV  + E G GKVLTGL KRI+  L   +I
Sbjct: 237 NDPAAIKDALVRQAAAPVRWVETVQKMAAEGVTHLVECGPGKVLTGLTKRINGDLVGEAI 296

Query: 300 SKVEDIDLALRSIV 313
              E ++  L S+ 
Sbjct: 297 VDQESLNKVLESLK 310


>gi|126173947|ref|YP_001050096.1| malonyl CoA-acyl carrier protein transacylase [Shewanella baltica
           OS155]
 gi|125997152|gb|ABN61227.1| [Acyl-carrier-protein] S-malonyltransferase [Shewanella baltica
           OS155]
          Length = 308

 Score =  186 bits (471), Expect = 4e-45,   Method: Composition-based stats.
 Identities = 125/307 (40%), Positives = 169/307 (55%), Gaps = 3/307 (0%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
           +    FPGQGSQ +GM  +L +S       F E    L  +L  L+  G  E L  T   
Sbjct: 3   NVAFVFPGQGSQALGMLAELAESHAVVGQTFAEASDVLGYDLWALVQQGPVETLNETDKT 62

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPAL A S+A            K   + +AGHSLGEY+AL  A      D I+LV  RG+
Sbjct: 63  QPALLAASVAI---WRAYVASGKPMPAMLAGHSLGEYSALVCAGVMDFKDAIKLVELRGQ 119

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCA 181
            MQ+AVP G G+M AIIGLD+  + + CA+A++  +    N N  GQVVI+G +DAV+ A
Sbjct: 120 LMQQAVPAGTGAMYAIIGLDNEGIANACAEAAQGDVVSPVNFNSPGQVVIAGQKDAVERA 179

Query: 182 ADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSS 241
           A  C   GAK AV L VS P H +LM P +  +   L+ V    P + ++ N   +  +S
Sbjct: 180 AAACKAAGAKMAVALLVSVPSHCALMKPAADKLAVALNDVQFNPPTITVINNVDVASPTS 239

Query: 242 IDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISK 301
            D+I   LV Q+   VRW ET++  A  G+  + E G GKVLTGLAKRI+KSLSA +++ 
Sbjct: 240 ADDIKDALVRQLYCPVRWSETVELMAQKGITQLVECGPGKVLTGLAKRINKSLSAQAVND 299

Query: 302 VEDIDLA 308
           V  +   
Sbjct: 300 VASLAAL 306


>gi|58040467|ref|YP_192431.1| acyl-carrier-protein S-malonyltransferase [Gluconobacter oxydans
           621H]
 gi|58002881|gb|AAW61775.1| Malonyl-CoA-[acyl-carrier-protein] transacylase [Gluconobacter
           oxydans 621H]
          Length = 333

 Score =  186 bits (471), Expect = 4e-45,   Method: Composition-based stats.
 Identities = 148/314 (47%), Positives = 205/314 (65%), Gaps = 2/314 (0%)

Query: 1   MST-VLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATC 59
           MS     FPGQGSQ +GMG+ L ++F  +R VF+EVD  L  +LS LM++G  +ELT T 
Sbjct: 20  MSVHAFVFPGQGSQSVGMGQALNEAFASSRAVFQEVDEALGDHLSRLMFSGDADELTRTE 79

Query: 60  NAQPALTAVSMAFIRVMEKN-GLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRA 118
           NAQPAL AVS+A +R +E   G  +    + VAGHSLGEY+AL AA    +++  RL+R 
Sbjct: 80  NAQPALFAVSLAAVRALESEGGFKLADKAALVAGHSLGEYSALAAASTLGIAEGARLLRL 139

Query: 119 RGKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAV 178
           RG++MQ AVP G G M A++G+D     SIC +AS+    EIANDNGGGQ+V+SG+  A+
Sbjct: 140 RGQAMQRAVPAGEGGMAALLGVDAAQARSICDEASQGETLEIANDNGGGQIVVSGVMSAI 199

Query: 179 KCAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASP 238
             A       G KRAV LPVSAPFHSSLM P ++ M+  L + T   P +P++ N  A+ 
Sbjct: 200 DRAIVVAKEHGIKRAVKLPVSAPFHSSLMAPAAREMEEALATATLNPPSIPVIANVTAAK 259

Query: 239 VSSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVS 298
           V+    I  LLV+QVTG+VRWRE++Q     GV +++E+G+GKVL GLA+RI   L+  +
Sbjct: 260 VTDPAVIRDLLVKQVTGKVRWRESVQTMVAMGVTNMHELGAGKVLCGLARRIAPELATSN 319

Query: 299 ISKVEDIDLALRSI 312
                +I+  L+++
Sbjct: 320 AGTPAEIEALLKAL 333


>gi|73748960|ref|YP_308199.1| malonyl CoA-acyl carrier protein transacylase [Dehalococcoides sp.
           CBDB1]
 gi|147669727|ref|YP_001214545.1| [Acyl-carrier-protein] S-malonyltransferase [Dehalococcoides sp.
           BAV1]
 gi|73660676|emb|CAI83283.1| malonyl CoA-acyl carrier protein transacylase [Dehalococcoides sp.
           CBDB1]
 gi|146270675|gb|ABQ17667.1| [Acyl-carrier-protein] S-malonyltransferase [Dehalococcoides sp.
           BAV1]
          Length = 310

 Score =  186 bits (471), Expect = 4e-45,   Method: Composition-based stats.
 Identities = 118/308 (38%), Positives = 175/308 (56%), Gaps = 5/308 (1%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
            T   FPGQG+Q +GMGRDLY  F  AR +F+  D  L  +LS L + G +E+L  T ++
Sbjct: 5   KTAYVFPGQGAQFVGMGRDLYSEFHSARELFDLADKALGFSLSKLCFEGPEEDLKDTRHS 64

Query: 62  QPALTAVSMAFIRVMEKNGLC-VKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
           Q A+   S++ +    ++G   +  + S+VAGHSLGEY+AL A+        I L R RG
Sbjct: 65  QSAIVCHSLSALSAFIESGKSKLLPEPSFVAGHSLGEYSALGASGILPYVQAILLARKRG 124

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           + M EA     G+M A+IG+   ++            C IAN N  GQ+VISGL++AV  
Sbjct: 125 ELMAEAAAKTPGAMAAVIGISQEILS----DICLKTGCYIANFNSPGQLVISGLKEAVDQ 180

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A+      GA + V L VS  FH+ LM+P S  +K ML+S+  +   +P++ N  A PVS
Sbjct: 181 ASAQATASGAMKVVTLQVSGGFHTPLMSPASTGLKEMLNSMDFKTARIPLVANTSACPVS 240

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
           +  ++   L  Q+TG V+W+++I+     GV +  E+G GKVL GL KRI++S+S  +I+
Sbjct: 241 TPQDVKAELYCQLTGGVQWQKSIENMIASGVNTFVEIGPGKVLAGLIKRINRSVSIYNIN 300

Query: 301 KVEDIDLA 308
               I   
Sbjct: 301 DAASIQNF 308


>gi|315126337|ref|YP_004068340.1| malonyl-CoA-[acyl-carrier-protein] transacylase [Pseudoalteromonas
           sp. SM9913]
 gi|315014851|gb|ADT68189.1| malonyl-CoA-[acyl-carrier-protein] transacylase [Pseudoalteromonas
           sp. SM9913]
          Length = 308

 Score =  186 bits (471), Expect = 4e-45,   Method: Composition-based stats.
 Identities = 128/307 (41%), Positives = 169/307 (55%), Gaps = 3/307 (0%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
              L FPGQGSQ +GM  +L +S    +  F E    L  +L+DL+ NG +E+L  T   
Sbjct: 4   KIALLFPGQGSQTVGMLNELLESSDIVKATFAEASTALGYDLADLVLNGPEEKLNQTHRT 63

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPAL   S+A  R               +AGHSLGEY+AL  +   SLS+ ++LV  RG 
Sbjct: 64  QPALLTASVAIYRHWLAANPGAD---VVMAGHSLGEYSALVCSDVISLSEAVKLVENRGL 120

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCA 181
            MQEAVP G+GSM AIIGL D  + + C  +++  +    N N  GQVVI+G +DAV  A
Sbjct: 121 YMQEAVPAGVGSMAAIIGLGDDEIKAACEASAQGEVVSPVNYNSPGQVVIAGHKDAVDRA 180

Query: 182 ADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSS 241
           +  C   GAKRA+ L VS P H  LM P ++ +   L ++T   P   ++ N       S
Sbjct: 181 SVACKEAGAKRALPLSVSVPSHCELMKPAAEKLAADLAALTFNSPKCDVINNVDVKAECS 240

Query: 242 IDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISK 301
            D I   LV Q+   VRW ET+Q     GV   YE G GKVLTGLAKRIDK++   S++ 
Sbjct: 241 ADAIKEALVRQLYSPVRWTETVQALVAQGVTQSYEFGPGKVLTGLAKRIDKAMVCGSVND 300

Query: 302 VEDIDLA 308
           +  ID A
Sbjct: 301 LASIDTA 307


>gi|331652144|ref|ZP_08353163.1| malonyl CoA-acyl carrier protein transacylase [Escherichia coli
           M718]
 gi|331050422|gb|EGI22480.1| malonyl CoA-acyl carrier protein transacylase [Escherichia coli
           M718]
          Length = 309

 Score =  186 bits (471), Expect = 4e-45,   Method: Composition-based stats.
 Identities = 128/311 (41%), Positives = 175/311 (56%), Gaps = 4/311 (1%)

Query: 1   MS-TVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATC 59
           M+     FPGQGSQ +GM  D+  S+P     F E    L  +L  L   G  EEL  T 
Sbjct: 1   MTQFAFVFPGQGSQTVGMLADMAASYPIVEETFAEASAALGYDLWALTQQGPAEELNKTW 60

Query: 60  NAQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRAR 119
             QPAL   S+A  RV ++ G       + +AGHSLGEY+AL  A     +D +RLV  R
Sbjct: 61  QTQPALLTASVALYRVWQQQGGKA---PALMAGHSLGEYSALVCAGVIDFADAVRLVEMR 117

Query: 120 GKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVK 179
           GK MQEAVP G G+M AIIGLDD  +   C +A+   +    N N  GQVVI+G ++AV+
Sbjct: 118 GKFMQEAVPEGTGAMAAIIGLDDASIAKACEEAAEGQVVSPVNFNSPGQVVIAGHKEAVE 177

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            A   C   GAKRA+ LPVS P H +LM P +  +   L  +T   P VP++ N      
Sbjct: 178 RAGAACKAAGAKRALPLPVSVPSHCALMKPAADKLAVELAKITFNAPTVPVVNNVDVKCE 237

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
           ++ D I   LV Q+   V+W +++++ A  GV+ +YEVG GKVLTGL KRI  +L+A ++
Sbjct: 238 TNGDAIRDALVRQLYNPVQWTKSVEYMAAQGVEHLYEVGPGKVLTGLTKRIVDTLTASAL 297

Query: 300 SKVEDIDLALR 310
           ++   +  AL 
Sbjct: 298 NEPSAMAAALE 308


>gi|15606225|ref|NP_213603.1| malonyl-CoA:Acyl carrier protein transacylase [Aquifex aeolicus
           VF5]
 gi|2983416|gb|AAC06999.1| malonyl-CoA:Acyl carrier protein transacylase [Aquifex aeolicus
           VF5]
          Length = 326

 Score =  186 bits (471), Expect = 4e-45,   Method: Composition-based stats.
 Identities = 115/314 (36%), Positives = 164/314 (52%), Gaps = 7/314 (2%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNL---SDLMWNGSQEELTAT 58
                FPGQGSQ +GMG + Y  F E   V   V+H+L  +L    D+M+ G +E+L  T
Sbjct: 16  KLAYVFPGQGSQYVGMGYEFYKQFHETADVVHAVEHSLRMSLDDIVDVMFKGPEEKLNKT 75

Query: 59  CNAQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRA 118
              QPAL A+S+   + +E  G        +VAGHSLGEYTAL  A    +    RL   
Sbjct: 76  VYTQPALFAISLGIYKALESMGF---PKPDFVAGHSLGEYTALAVAGGIDVQLGARLTYY 132

Query: 119 RGKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAV 178
           RGK MQEAVP G G+MVAI+ L    V+  C +A  VG+ E AN N   Q VISG + AV
Sbjct: 133 RGKYMQEAVPEGKGAMVAILKLPPEKVEEACERAKDVGVVEPANYNSSTQTVISGEKPAV 192

Query: 179 KCAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASP 238
           + A      +   RA+ L VS P H SLM P +   +  L     Q+  +P++ N+ A  
Sbjct: 193 EKA-AQIAKEMGGRAIPLKVSVPSHCSLMKPAADAFRLKLAQAPIQNIKIPLVQNYTAKA 251

Query: 239 VSSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVS 298
            +   EI   L  Q+   V+W +++ W    GV +  E+G   VL+ L ++   ++   +
Sbjct: 252 HTMAHEIRNNLYHQIFSPVKWYQSVIWMHEQGVDTFVEIGPKNVLSKLIQQTLPNVRVFN 311

Query: 299 ISKVEDIDLALRSI 312
           + K ED +  L++I
Sbjct: 312 VEKPEDAESVLKAI 325


>gi|114047959|ref|YP_738509.1| [Acyl-carrier-protein] S-malonyltransferase [Shewanella sp. MR-7]
 gi|113889401|gb|ABI43452.1| [Acyl-carrier-protein] S-malonyltransferase [Shewanella sp. MR-7]
          Length = 308

 Score =  186 bits (471), Expect = 4e-45,   Method: Composition-based stats.
 Identities = 122/307 (39%), Positives = 170/307 (55%), Gaps = 3/307 (0%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
           +    FPGQGSQ +GM  +L  + P     F E    L  +L  L+ +G  E L  T   
Sbjct: 3   NVAFVFPGQGSQALGMLAELAGAQPIVGQTFAEASEVLGYDLWALVQDGPVETLNETDKT 62

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPAL A S+A            K   + +AGHSLGEY+AL  A      D I+LV  RG+
Sbjct: 63  QPALLAASVAI---WRAYVASGKAMPAMLAGHSLGEYSALVCAGVIDFKDAIKLVELRGQ 119

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCA 181
            MQ+AVP G G+M AIIGLD+  + + C +A++  +    N N  GQVVI+G ++AV+ A
Sbjct: 120 LMQQAVPAGTGAMYAIIGLDNDGIANACIEAAQGEVVSPVNFNSPGQVVIAGQKEAVERA 179

Query: 182 ADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSS 241
           A  C   GAK AV LPVS P H +LM P +  +   L+ V    P + ++ N   +  ++
Sbjct: 180 AAACKAAGAKMAVALPVSVPSHCALMKPAADKLAIALNDVQFNAPSITVINNVDVASPTA 239

Query: 242 IDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISK 301
           + +I   LV Q+   VRW ET++  A  G+  + E G GKVLTGLAKRI+KSLSA +++ 
Sbjct: 240 VADIKDALVRQLYCPVRWSETVELMAEKGITQLVECGPGKVLTGLAKRINKSLSAQAVND 299

Query: 302 VEDIDLA 308
           V  +   
Sbjct: 300 VASLAAL 306


>gi|91793646|ref|YP_563297.1| malonyl CoA-acyl carrier protein transacylase [Shewanella
           denitrificans OS217]
 gi|91715648|gb|ABE55574.1| [Acyl-carrier-protein] S-malonyltransferase [Shewanella
           denitrificans OS217]
          Length = 308

 Score =  186 bits (471), Expect = 4e-45,   Method: Composition-based stats.
 Identities = 124/305 (40%), Positives = 165/305 (54%), Gaps = 3/305 (0%)

Query: 4   VLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQP 63
              FPGQGSQV+GM  DL    P     F E    L  +L  L+  G  E L  T   QP
Sbjct: 5   AFVFPGQGSQVVGMLADLAQVQPIVTSTFTEASEALGYDLWALIQAGPAETLNETDKTQP 64

Query: 64  ALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSM 123
           AL A S+A  R     G       S +AGHSLGEY+AL  A      D ++LV  RG+ M
Sbjct: 65  ALLAASVAIWRAFIATGK---PQPSVLAGHSLGEYSALVCAGVIDFKDAVKLVELRGQLM 121

Query: 124 QEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAAD 183
           Q+AVP G G+M AIIGL+D  +   C  A++  +    N N  GQVVI+G +DAV+ AA 
Sbjct: 122 QQAVPAGTGAMYAIIGLEDEAIAKACIDAAQGAVVSPVNFNSPGQVVIAGEKDAVERAAA 181

Query: 184 TCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSID 243
            C   GAK  V LPVS P H +LM P +  +   L S+T  +P + ++ N   +  +  D
Sbjct: 182 ACKAAGAKMTVALPVSVPSHCALMKPAADKLAEALQSITFNEPAIKVINNVDVAMPTQGD 241

Query: 244 EISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVE 303
           +I   LV Q+   VRW ET++  A+ G+  + E G GKVLTGL KRI+KS+SA +++   
Sbjct: 242 DIKDALVRQLYCPVRWSETVELMASQGIDQLVECGPGKVLTGLTKRINKSVSAQAVNDAA 301

Query: 304 DIDLA 308
                
Sbjct: 302 SFAAL 306


>gi|23098978|ref|NP_692444.1| malonyl CoA-acyl carrier protein transacylase [Oceanobacillus
           iheyensis HTE831]
 gi|22777206|dbj|BAC13479.1| malonyl CoA-acyl carrier protein transacylase [Oceanobacillus
           iheyensis HTE831]
          Length = 312

 Score =  186 bits (471), Expect = 4e-45,   Method: Composition-based stats.
 Identities = 118/309 (38%), Positives = 180/309 (58%), Gaps = 5/309 (1%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
                FPGQGSQ +GMG++LYD+ P  + ++ E +  L++++ +LM+ G ++ELT T N 
Sbjct: 3   KVAFMFPGQGSQTVGMGKELYDAHPMIQELYSEANQILDKDIQELMFEGPEKELTQTENT 62

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPAL   S+A  +++E+ G+      +   GHSLGEY+AL A+ AF+  D + LV+ RG+
Sbjct: 63  QPALLLSSVAVQKLLEERGVT----PAMTVGHSLGEYSALVASGAFTWQDALTLVQIRGR 118

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCA 181
            M+ A P G G+M A++GLD   ++S  ++  +  + +IAN N  GQVVISG    V+ A
Sbjct: 119 LMEAAFPKGQGTMAAVLGLDATTIESTLSEI-KDQVVDIANLNCPGQVVISGSVKGVEQA 177

Query: 182 ADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSS 241
                +KGAKR + L VS PFHS LM   +      LD V   D   P+  N  AS  S 
Sbjct: 178 TILLKDKGAKRVLPLNVSGPFHSKLMKAANDEFATYLDDVEISDAKPPVYANVSASATSD 237

Query: 242 IDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISK 301
             E+  LL++Q+   VR+ E+I      GV +  E+G+GKVL+GL K+I++ +   +I  
Sbjct: 238 SGELKELLLKQLYSPVRFEESINHMIESGVDAFVEIGTGKVLSGLVKKINRRMPTFAIQD 297

Query: 302 VEDIDLALR 310
              +D  + 
Sbjct: 298 QASLDKFME 306


>gi|228474117|ref|ZP_04058858.1| malonyl CoA-acyl carrier protein transacylase [Capnocytophaga
           gingivalis ATCC 33624]
 gi|228274631|gb|EEK13472.1| malonyl CoA-acyl carrier protein transacylase [Capnocytophaga
           gingivalis ATCC 33624]
          Length = 292

 Score =  186 bits (471), Expect = 4e-45,   Method: Composition-based stats.
 Identities = 115/298 (38%), Positives = 172/298 (57%), Gaps = 7/298 (2%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M     FPGQGSQ +GMG+DLY+S P A+ +F+E +H L   ++D+M+ G +E L  T  
Sbjct: 1   MKKAYIFPGQGSQFVGMGKDLYESSPLAKSLFDEANHILGFAITDIMFAGDEEALKQTRV 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
            QPA+   S+   +V+ +           VAGHSLGE++AL A+   +    +RLV  R 
Sbjct: 61  TQPAIFLHSVIQRQVLGEAFT-----PDMVAGHSLGEFSALVASGVLTFEQGLRLVAKRA 115

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           ++MQ+A     G+M AI+GLDD VV+ +C     V     AN N  GQ+VISG  +AV+ 
Sbjct: 116 EAMQKACELERGTMAAILGLDDAVVEQVCKDTEGVVTP--ANYNCPGQLVISGAYEAVEQ 173

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A +T    GAKRA+ LPV   FHS+LM P  + +   +  +T Q P+ PI  N   + ++
Sbjct: 174 ACETLKAAGAKRALILPVGGAFHSALMKPAEEELAKAIGEITFQKPLCPIYQNVTTTAMT 233

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVS 298
             + I + L+ Q+T  V+W +++Q     G  +  E+  GKVL GL K+I+K + A+S
Sbjct: 234 DPETIKKNLIAQLTAPVKWTQSVQQMIQDGATTFVELAPGKVLQGLIKKINKEVEAIS 291


>gi|54308387|ref|YP_129407.1| acyl carrier protein S-malonyltransferase [Photobacterium profundum
           SS9]
 gi|46912815|emb|CAG19605.1| putative malonyl Coa-acyl carrier protein transacylase
           [Photobacterium profundum SS9]
          Length = 307

 Score =  186 bits (471), Expect = 4e-45,   Method: Composition-based stats.
 Identities = 123/307 (40%), Positives = 176/307 (57%), Gaps = 3/307 (0%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
              + FPGQGSQ +GM  +L + F   +  F E    L  +L  L+ NG  E+L  T   
Sbjct: 3   KFAIIFPGQGSQAVGMLAELAEHFDVVKHTFAEASEVLGYDLWTLVQNGPAEDLNQTDRT 62

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPAL   S+A  RV ++ G       + +AGHSLGEY+AL  A      + I+LV  RG+
Sbjct: 63  QPALLTASVAIWRVWQEQG---GEQPTVLAGHSLGEYSALVCAGVIDFKEAIKLVELRGQ 119

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCA 181
            MQEAVP G+G+M AIIGLD+  +   C  A++  I    N N  GQVVI+G +DAV+ A
Sbjct: 120 LMQEAVPAGVGAMSAIIGLDNDSIAKACEAAAQDQIVSPVNFNSPGQVVIAGNKDAVERA 179

Query: 182 ADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSS 241
              C   GAKRA+ LPVS P H +LM P +  +   L+++    P +P++ N      S 
Sbjct: 180 NVLCKEAGAKRALPLPVSVPSHCALMKPAADKLAVALEAIEFNTPSIPVINNADVQTESD 239

Query: 242 IDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISK 301
              I   LV+Q+ G VRW E+++  AN G++ + E+G GKVLTGL KRI+++LS+  ++ 
Sbjct: 240 PAAIKLALVKQLYGPVRWTESVERMANEGIEQLLEMGPGKVLTGLTKRINRALSSAVVND 299

Query: 302 VEDIDLA 308
              ++ A
Sbjct: 300 SVSLEAA 306


>gi|296444332|ref|ZP_06886297.1| malonyl CoA-acyl carrier protein transacylase [Methylosinus
           trichosporium OB3b]
 gi|296257979|gb|EFH05041.1| malonyl CoA-acyl carrier protein transacylase [Methylosinus
           trichosporium OB3b]
          Length = 313

 Score =  186 bits (471), Expect = 4e-45,   Method: Composition-based stats.
 Identities = 159/308 (51%), Positives = 208/308 (67%), Gaps = 1/308 (0%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M+    FPGQGSQ IGMG+ L ++F EAR VF EVD  L  +LS +M+ G + ELT T N
Sbjct: 1   MARAFVFPGQGSQAIGMGKALGEAFAEARAVFAEVDDALGASLSRVMFEGPEAELTLTAN 60

Query: 61  AQPALTAVSMAFIRVMEKN-GLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRAR 119
           AQPAL AVS+A IRV+E   GL + RD ++VAGHSLGEY+AL AA A SL+DT RL+R R
Sbjct: 61  AQPALMAVSLAAIRVLEAQAGLDLSRDAAFVAGHSLGEYSALAAAGALSLADTARLLRLR 120

Query: 120 GKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVK 179
           G++MQ AVP G G+M A++G++      I A+A +  +C++ANDNGGGQ+V+SG + AV+
Sbjct: 121 GEAMQAAVPVGAGAMAALLGVEMAAAREIAAEAEQGSVCQVANDNGGGQIVVSGAKAAVE 180

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            A +    +G KRAV LPVSAPFH +LM P ++ M+  L + T   P V ++ N  ASPV
Sbjct: 181 RAIEIAKGRGVKRAVALPVSAPFHCALMQPAAEAMRAALATTTIHAPRVAVVANVTASPV 240

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
              +EI RLLVEQVTG VRWRE + + A  G     E G+GKVLTGL KRI    + +S+
Sbjct: 241 MQPEEIRRLLVEQVTGTVRWRECVAYMAEQGTGKFVECGAGKVLTGLLKRIAPQAAGISV 300

Query: 300 SKVEDIDL 307
               D+D 
Sbjct: 301 GAPADLDA 308


>gi|53803725|ref|YP_114434.1| malonyl CoA-acyl carrier protein transacylase [Methylococcus
           capsulatus str. Bath]
 gi|53757486|gb|AAU91777.1| malonyl CoA-acyl carrier protein transacylase [Methylococcus
           capsulatus str. Bath]
          Length = 318

 Score =  186 bits (471), Expect = 4e-45,   Method: Composition-based stats.
 Identities = 128/314 (40%), Positives = 169/314 (53%), Gaps = 6/314 (1%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
           S    FPGQGSQ IGM  DL    P     F E    L  +L  L+  G +EEL  T N 
Sbjct: 7   SLAFLFPGQGSQSIGMLADLAAVHPVVGETFAEASEVLGFDLWCLVQEGPEEELNQTVNT 66

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPA+ A  +A  R+         R  +++AGHSLGEY+AL AA A   +D ++LV  RG+
Sbjct: 67  QPAMLAAGVATWRIWCS---LTDRRPAWMAGHSLGEYSALVAAGALGFADAVKLVAQRGR 123

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQA-SRVGICEIANDNGGGQVVISGLQDAVKC 180
            MQEAVPPG GSM AI+GL+D  V + C +A +R  +   AN N  GQVVI+G   AV+ 
Sbjct: 124 LMQEAVPPGAGSMAAILGLEDPQVVAACKEASTRDSVVTPANFNAPGQVVIAGASQAVER 183

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A       GAKRAV LPVS P H +LM P S+    +L   + + P   I          
Sbjct: 184 AIVAAKALGAKRAVLLPVSVPSHCALMAPASEKFAALLSETSFESPRDRIGVIHNVDVAM 243

Query: 241 SIDEISRLLV--EQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVS 298
                    V  +Q++  VRW ETI++ ++ GV+   E G GKVL GL KRI  S + ++
Sbjct: 244 HPSPEVIRAVLAQQISQPVRWSETIRFLSDQGVRRFVECGPGKVLAGLNKRIVSSEATLA 303

Query: 299 ISKVEDIDLALRSI 312
           I   + ++ AL SI
Sbjct: 304 IVDQDSLNTALESI 317


>gi|328957610|ref|YP_004374996.1| malonyl CoA:acyl carrier protein transacylase [Carnobacterium sp.
           17-4]
 gi|328673934|gb|AEB29980.1| malonyl CoA:acyl carrier protein transacylase [Carnobacterium sp.
           17-4]
          Length = 336

 Score =  186 bits (471), Expect = 4e-45,   Method: Composition-based stats.
 Identities = 108/313 (34%), Positives = 179/313 (57%), Gaps = 5/313 (1%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M     + GQG+Q  GMG+DLY+ +   R VF++   +LN ++++L +    + L  T  
Sbjct: 23  MKIAFVYSGQGAQYFGMGQDLYEKYSVVREVFDQAGQSLNLDMAELCFK-ENDLLNQTTY 81

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
            QPA+  VS+A   ++++ G+        VAG SLGEY+A   A   S  D ++LV+ RG
Sbjct: 82  TQPAILTVSLAIDALLKEKGI----HPEVVAGLSLGEYSAFVKANVLSFEDAVKLVKKRG 137

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           + M +AVP G G+M A++G D   +   C +AS +GI   AN N  GQ+ I+GL+ AV+ 
Sbjct: 138 QYMTDAVPLGKGAMSAVMGSDRQTIIDACDEASVLGIVSPANYNMPGQIAIAGLKAAVEK 197

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A +  L +GAKR V L VS PFH+ L+ P S  ++  L SV+  D  +P++ N  A    
Sbjct: 198 AGELLLERGAKRVVPLQVSGPFHTQLLEPASIQLEEALKSVSIHDSELPVISNTIAKVFE 257

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
             ++I  ++V+QV   V W ++++   + GV +  EVG GK L+   K+IDK+++ +++ 
Sbjct: 258 DKEQIRTMMVKQVMSPVYWEDSVRTMIDLGVDTFIEVGPGKTLSSFIKKIDKTVTILNVE 317

Query: 301 KVEDIDLALRSIV 313
             + ++  +  + 
Sbjct: 318 NEKTLEKTVNKLA 330


>gi|313499933|gb|ADR61299.1| Malonyl CoA-acyl carrier protein transacylase [Pseudomonas putida
           BIRD-1]
          Length = 312

 Score =  186 bits (471), Expect = 4e-45,   Method: Composition-based stats.
 Identities = 117/302 (38%), Positives = 174/302 (57%), Gaps = 3/302 (0%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
           S    FPGQGSQ +GM  +L    P     F+E    L  +L  L+ +G +E+L  T   
Sbjct: 4   SLAFVFPGQGSQSLGMLAELGAEKPVIIETFKEASEALGYDLWKLVQDGPEEQLNQTDKT 63

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPA+   S+A  R+  + G       ++V+GHSLGEY+AL AA + SL + +RLV  RG+
Sbjct: 64  QPAILTASIALWRLWLEEGGA---KPAFVSGHSLGEYSALVAAGSISLKEAVRLVERRGQ 120

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCA 181
            MQEAVP G G+M AI+GLDD VV  +CA+A+   +    N N  GQVVI+G + AV  A
Sbjct: 121 LMQEAVPAGHGAMAAILGLDDAVVVELCAEAAEDEVVSAVNFNSPGQVVIAGNKAAVDRA 180

Query: 182 ADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSS 241
            + C  KGAKRA+ L VS P H +LM P ++     ++++  + P +P++ N  A+  + 
Sbjct: 181 MELCKAKGAKRALPLAVSVPSHCALMKPAAERFADSVNAIEWKAPQIPVVQNVTAAVAAD 240

Query: 242 IDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISK 301
           +D +   L+ Q+   VRW E +Q  A +G  ++ E G GKVL GL KR    ++  +++ 
Sbjct: 241 LDALKHDLLAQLYQPVRWVECVQTLAANGAVNLVECGPGKVLAGLNKRCADGVTTYNLNT 300

Query: 302 VE 303
            +
Sbjct: 301 PD 302


>gi|319408309|emb|CBI81962.1| malonyl CoA-acyl carrier protein transacylase [Bartonella
           schoenbuchensis R1]
          Length = 314

 Score =  186 bits (471), Expect = 4e-45,   Method: Composition-based stats.
 Identities = 173/312 (55%), Positives = 227/312 (72%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M    TFPGQGSQV+GMG+ L + F EAR+VFEEVD  L + LS +++ G ++ L  T N
Sbjct: 1   MVAAFTFPGQGSQVVGMGKVLAEQFVEARMVFEEVDDALGEKLSHIIFEGPEDVLALTAN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
           AQPAL AVS+A IRVMEK GL ++  + +VAGHSLGEY+ALCA +  SL+DT RL+R RG
Sbjct: 61  AQPALMAVSLAIIRVMEKLGLDIESKVKFVAGHSLGEYSALCAVRTLSLADTARLLRIRG 120

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
            +MQ AV  G G M A+IGLD+  V+ IC+     G+C+IANDNGGGQ+VISG   AV+ 
Sbjct: 121 NAMQRAVAVGEGLMAALIGLDEQDVEEICSAVLGEGLCQIANDNGGGQIVISGEAKAVEA 180

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A    L KGAKRA+ LPVSAPFHS+LM P + VMK  L +V K  P++P++ N   +P S
Sbjct: 181 AMKAALEKGAKRALLLPVSAPFHSALMQPAADVMKDALLAVNKVAPIIPVVANISVAPES 240

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
             + I  LLVEQVTGRVRWRET++WF ++GV +++EVGSGKVLTGLA+RI+K +  ++I 
Sbjct: 241 DPERIFMLLVEQVTGRVRWRETVEWFGSNGVDTLFEVGSGKVLTGLARRINKDIKGLTIG 300

Query: 301 KVEDIDLALRSI 312
             E+I+ AL+ +
Sbjct: 301 TAEEIESALQVL 312


>gi|307294388|ref|ZP_07574232.1| malonyl CoA-acyl carrier protein transacylase [Sphingobium
           chlorophenolicum L-1]
 gi|306880539|gb|EFN11756.1| malonyl CoA-acyl carrier protein transacylase [Sphingobium
           chlorophenolicum L-1]
          Length = 311

 Score =  186 bits (471), Expect = 5e-45,   Method: Composition-based stats.
 Identities = 132/310 (42%), Positives = 190/310 (61%), Gaps = 2/310 (0%)

Query: 4   VLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQP 63
              FPGQGSQ +GMG+ L D+ P A+ +F+EVD  L+Q+L  +M  G + +LT T NAQP
Sbjct: 3   AFLFPGQGSQSVGMGKALADASPAAKELFQEVDDALSQHLFRIMVEGPESDLTLTENAQP 62

Query: 64  ALTAVS-MAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKS 122
           A+ A +      +  + G  +     +VAGHSLGEY+ALCAA+AF +  T +L++ RG++
Sbjct: 63  AIMANALATLRVMQREGGFSLAEKGDFVAGHSLGEYSALCAAEAFDIGTTAKLLKLRGRA 122

Query: 123 MQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAA 182
           MQ AVP G G+M A++G D     ++   A+   +C +ANDN   QVVISG + A++ A 
Sbjct: 123 MQAAVPVGEGAMAALLGADIEKAQALADAAAEGEVCTVANDNDPTQVVISGHRGAIERAV 182

Query: 183 DTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSI 242
               + G KR V LPVSAPFH  LM P ++ M+  L       P++P+  N  AS ++  
Sbjct: 183 ALVKDHGIKRGVLLPVSAPFHCPLMQPAAEAMEEALGKAAINTPLLPVYANVLASAIADP 242

Query: 243 DEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKV 302
           +EI R LVEQVTGRVRWRE++    + GV    E+G GKVL  + KRI    +  SI  +
Sbjct: 243 EEIKRRLVEQVTGRVRWRESVAAMWDAGVTEFVELG-GKVLGPMVKRIAPDATVRSIVTM 301

Query: 303 EDIDLALRSI 312
           +D++ AL ++
Sbjct: 302 DDVEAALGAL 311


>gi|110598666|ref|ZP_01386931.1| malonyl CoA-acyl carrier protein transacylase [Chlorobium
           ferrooxidans DSM 13031]
 gi|110339719|gb|EAT58229.1| malonyl CoA-acyl carrier protein transacylase [Chlorobium
           ferrooxidans DSM 13031]
          Length = 302

 Score =  186 bits (471), Expect = 5e-45,   Method: Composition-based stats.
 Identities = 126/309 (40%), Positives = 178/309 (57%), Gaps = 7/309 (2%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M     FPGQGSQ  GMG+D+++++P AR + E+ D  L  +++D+M++GS+E+L  T  
Sbjct: 1   MK-AFVFPGQGSQYCGMGKDIFETYPAARTLMEKADAILGFSITDIMFSGSEEDLRQTKY 59

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
            QPA+   S+A   ++       ++DI   AGHSLGEY+ALC A A S  D IR+V  RG
Sbjct: 60  TQPAIFLHSVAVATLI------GRKDIVMTAGHSLGEYSALCIAGALSFEDAIRIVAKRG 113

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           + MQ A     G+M AIIG+ D  +  + A+AS  GI + AN N  GQ+VISG   AVK 
Sbjct: 114 ELMQNAGQQNPGTMAAIIGMPDAALPELLAEASSEGIVQAANYNSPGQIVISGDLAAVKK 173

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A     +KGA+ A  L VS  FHS LM P  + +   L+ +  +D  +P+  N  A  V+
Sbjct: 174 AVALAPSKGARMAKELVVSGAFHSPLMKPAEEELARALELIDIKDAEIPVCMNAVAHAVT 233

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
              EI + L+ Q+T  V W ++I+     G+ +  EVG  KVL GL KRIDKS++   I 
Sbjct: 234 GAAEIRKNLILQLTSSVLWSQSIEAMVKSGITAFVEVGPQKVLQGLIKRIDKSVTTTGID 293

Query: 301 KVEDIDLAL 309
              DI   L
Sbjct: 294 TAADIQAVL 302


>gi|222055702|ref|YP_002538064.1| malonyl CoA-acyl carrier protein transacylase [Geobacter sp.
           FRC-32]
 gi|221564991|gb|ACM20963.1| malonyl CoA-acyl carrier protein transacylase [Geobacter sp.
           FRC-32]
          Length = 311

 Score =  186 bits (471), Expect = 5e-45,   Method: Composition-based stats.
 Identities = 133/310 (42%), Positives = 186/310 (60%), Gaps = 3/310 (0%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
                FPGQGSQ  GMG+DL D+F +A LVFEE D  LN  LS L ++G +E+L  T N 
Sbjct: 3   KKAFIFPGQGSQFAGMGKDLADNFKKAALVFEEADDALNFKLSRLCFDGPEEDLRLTANT 62

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPA+   S+A +RV+E+          ++AGHSLGEY+AL AA A   +D +R VRARG 
Sbjct: 63  QPAILTASIAALRVLEE---ETSLKADFMAGHSLGEYSALVAAGAIKFADAVRTVRARGT 119

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCA 181
            MQEAVP G+GSM AI+G++  V+  IC++A++  +   AN N  GQ+VI+G   AV  A
Sbjct: 120 FMQEAVPVGVGSMAAILGVEPEVLAEICSEAAQGEVVAPANFNSPGQIVIAGNSGAVNRA 179

Query: 182 ADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSS 241
            +    KG ++A+ LPVSAPFH +LM P  + +  +L+ V      VP++ N  AS  S 
Sbjct: 180 IEIAKGKGFRKAMLLPVSAPFHCALMIPAGERLAGVLEPVVVSPLTVPVVTNVEASANSD 239

Query: 242 IDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISK 301
              +  LLV QV+  V+W  ++      GV    E+G GKVL GL KRIDKS++  ++  
Sbjct: 240 AGRVKELLVRQVSAPVKWDASVGAMIAAGVDKFVEIGPGKVLAGLVKRIDKSIATSNVQD 299

Query: 302 VEDIDLALRS 311
            E +   ++ 
Sbjct: 300 QESLRALIQE 309


>gi|289548845|ref|YP_003473833.1| malonyl CoA-acyl carrier protein transacylase [Thermocrinis albus
           DSM 14484]
 gi|289182462|gb|ADC89706.1| malonyl CoA-acyl carrier protein transacylase [Thermocrinis albus
           DSM 14484]
          Length = 311

 Score =  186 bits (471), Expect = 5e-45,   Method: Composition-based stats.
 Identities = 114/312 (36%), Positives = 164/312 (52%), Gaps = 5/312 (1%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
                FPGQGSQ +GMG D Y  F  A  VF   +  L  NL+D+++ G +EEL  T + 
Sbjct: 3   KIAYVFPGQGSQYVGMGYDFYKEFHTAADVFHSAETALRYNLTDIIFKGPEEELGRTIHT 62

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPA+  VS+A  RVM   G         VAGHSLGEYTAL  A    L + +RL   RGK
Sbjct: 63  QPAILTVSVAIYRVMRDMGFPP---PQVVAGHSLGEYTALVVAGGVELFEAVRLAHLRGK 119

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCA 181
            MQEAVPP  G+M AI+ L    V+  C  A   G+ E AN N   Q VI+G + AV+ A
Sbjct: 120 YMQEAVPPDRGAMYAILQLPPEKVEEACRMAGDEGVVEPANYNSPKQTVIAGEKKAVEKA 179

Query: 182 ADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSS 241
           A+    +   + + L VS P H SLM   +   +  L     ++  +P++ N+ A   + 
Sbjct: 180 AE-ICRQMGGKVIPLKVSVPSHCSLMKSAADAFRLKLAQTPIKNISIPLVQNYTAKEHTM 238

Query: 242 IDEISRLLVEQVTGRVRWRETIQWFA-NHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
             EI   L  Q+   VRW +++ +   N GV +  E+G   VL+ L ++    +   ++ 
Sbjct: 239 AHEIRENLYRQMFSPVRWFQSVVYMVQNMGVDTFVEIGPKNVLSKLIQQTVDKVRIFNVE 298

Query: 301 KVEDIDLALRSI 312
           KVED++  L+++
Sbjct: 299 KVEDLEKVLKAV 310


>gi|222032845|emb|CAP75584.1| Malonyl CoA-acyl carrier protein transacylase [Escherichia coli
           LF82]
 gi|312945654|gb|ADR26481.1| malonyl-CoA-[acyl-carrier-protein] transacylase FabD [Escherichia
           coli O83:H1 str. NRG 857C]
 gi|320196425|gb|EFW71048.1| Malonyl CoA-acyl carrier protein transacylase [Escherichia coli
           WV_060327]
          Length = 309

 Score =  186 bits (471), Expect = 5e-45,   Method: Composition-based stats.
 Identities = 128/311 (41%), Positives = 175/311 (56%), Gaps = 4/311 (1%)

Query: 1   MS-TVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATC 59
           M+     FPGQGSQ +GM  D+  S+P     F E    L  +L  L   G  EEL  T 
Sbjct: 1   MTQFAFVFPGQGSQTVGMLADMAASYPIVEETFAEASAALGYDLWALTQQGPAEELNKTW 60

Query: 60  NAQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRAR 119
             QPAL   S+A  RV ++ G       + +AGHSLGEY+AL  A     +D +RLV  R
Sbjct: 61  QTQPALLTASVALYRVWQQQGGKA---PAMMAGHSLGEYSALVCAGVIDFADAVRLVEMR 117

Query: 120 GKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVK 179
           GK MQEAVP G G+M AIIGLDD  +   C +A+   +    N N  GQVVI+G ++AV+
Sbjct: 118 GKFMQEAVPEGTGAMAAIIGLDDASIGKACEEAAEGQVVSPVNFNSPGQVVIAGHKEAVE 177

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            A   C   GAKRA+ LPVS P H +LM P +  +   L  +T   P VP++ N      
Sbjct: 178 RAGAACKAAGAKRALPLPVSVPSHCALMKPAADKLAVELAKITFNAPTVPVVNNVDVKCE 237

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
           ++ D I   LV Q+   V+W +++++ A  GV+ +YEVG GKVLTGL KRI  +L+A ++
Sbjct: 238 TNGDAIRDALVRQLYNPVQWTKSVEYIAAQGVEHLYEVGPGKVLTGLTKRIVDTLTASAL 297

Query: 300 SKVEDIDLALR 310
           ++   +  AL 
Sbjct: 298 NEPSAMAAALE 308


>gi|301023277|ref|ZP_07187074.1| malonyl CoA-acyl carrier protein transacylase [Escherichia coli MS
           69-1]
 gi|300397122|gb|EFJ80660.1| malonyl CoA-acyl carrier protein transacylase [Escherichia coli MS
           69-1]
          Length = 309

 Score =  186 bits (471), Expect = 5e-45,   Method: Composition-based stats.
 Identities = 127/311 (40%), Positives = 174/311 (55%), Gaps = 4/311 (1%)

Query: 1   MS-TVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATC 59
           M+     FPGQGSQ +GM  D+  S+P     F E    L  +L  L   G  EEL  T 
Sbjct: 1   MTQFAFVFPGQGSQTVGMLADMAASYPIVEETFAEASAALGYDLWALTQQGPAEELNKTW 60

Query: 60  NAQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRAR 119
             QPAL   S+A  R  ++ G       + +AGHSLGEY+AL  A     +D +RLV  R
Sbjct: 61  QTQPALLTASVALYRAWQQQGGKA---PALMAGHSLGEYSALVCAGVIDFADAVRLVEMR 117

Query: 120 GKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVK 179
           GK MQEAVP G G+M AIIGLDD  +   C +A+   +    N N  GQVVI+G ++AV+
Sbjct: 118 GKFMQEAVPEGTGAMAAIIGLDDASIAKACEEAAEGQVVSPVNFNSPGQVVIAGHKEAVE 177

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            A   C   GAKRA+ LPVS P H +LM P +  +   L  +T   P VP++ N      
Sbjct: 178 RAGAACKAAGAKRALPLPVSVPSHCALMKPAADKLAVELAKITFNAPTVPVVNNVDVKCE 237

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
           ++ D I   LV Q+   V+W +++++ A  GV+ +YEVG GKVLTGL KRI  +L+A ++
Sbjct: 238 TNGDAIRDALVRQLYNPVQWTKSVEYMAAQGVEHLYEVGPGKVLTGLTKRIVDTLTASAL 297

Query: 300 SKVEDIDLALR 310
           ++   +  AL 
Sbjct: 298 NEPSAMAAALE 308


>gi|323135850|ref|ZP_08070933.1| malonyl CoA-acyl carrier protein transacylase [Methylocystis sp.
           ATCC 49242]
 gi|322398941|gb|EFY01460.1| malonyl CoA-acyl carrier protein transacylase [Methylocystis sp.
           ATCC 49242]
          Length = 315

 Score =  185 bits (470), Expect = 5e-45,   Method: Composition-based stats.
 Identities = 160/310 (51%), Positives = 201/310 (64%), Gaps = 3/310 (0%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           MS    FPGQGSQ +GMG+ L D F  AR VFEEVD  L+Q LS LM+ G + ELT T N
Sbjct: 1   MSKAFIFPGQGSQAVGMGKALADQFAAARGVFEEVDSALSQPLSGLMFEGPEAELTLTAN 60

Query: 61  AQPALTAVSMAFIRVME-KNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRAR 119
           AQPAL AVS+A IRV+E + GL ++RD ++VAGHSLGEY+AL AA A +++DT +L+R R
Sbjct: 61  AQPALMAVSLAAIRVLEAECGLDLRRDAAFVAGHSLGEYSALAAAGALTIADTAKLLRIR 120

Query: 120 GKSMQEAVPPGL--GSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDA 177
           G +MQ+AVP G    + +    LD     +  A A+R   C++ANDNGGGQVVISG + A
Sbjct: 121 GDAMQKAVPVGEGAMAALLGAELDQAREIAGAAAAARSACCQVANDNGGGQVVISGAKAA 180

Query: 178 VKCAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCAS 237
           V+ A D    KG KRAV LPVSAPFH +LM P +  M   L       P VP++ N  A+
Sbjct: 181 VEKAMDIAKEKGIKRAVLLPVSAPFHCALMQPAADAMAEALAGAKIAAPCVPVVANVTAA 240

Query: 238 PVSSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAV 297
           PVS  + I +LLVEQVTG VRWRE + + A  GV    E GSGKVL GL KRI    + +
Sbjct: 241 PVSDPELIRKLLVEQVTGAVRWRECVAFIAGQGVTKFVECGSGKVLAGLLKRIAPQAAGI 300

Query: 298 SISKVEDIDL 307
           S+    D+D 
Sbjct: 301 SVGAPADLDA 310


>gi|126735960|ref|ZP_01751704.1| acyl-carrier-protein S-malonyltransferase [Roseobacter sp. CCS2]
 gi|126714517|gb|EBA11384.1| acyl-carrier-protein S-malonyltransferase [Roseobacter sp. CCS2]
          Length = 312

 Score =  185 bits (470), Expect = 5e-45,   Method: Composition-based stats.
 Identities = 156/309 (50%), Positives = 212/309 (68%), Gaps = 1/309 (0%)

Query: 4   VLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQP 63
              FPGQG+Q IGMG+ L +++P AR VF+EVD  L ++LS L+W G  EELT T NAQP
Sbjct: 3   AFVFPGQGAQTIGMGQALAEAYPAARAVFDEVDEALGEDLSGLIWGGDIEELTLTANAQP 62

Query: 64  ALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSM 123
           AL A S+A +R +E  G+ V    S+VAGHSLGEY+AL AA+A SL+DT RL+RARGK+M
Sbjct: 63  ALMATSIAAMRALEAEGVSVGA-ASFVAGHSLGEYSALAAAEAISLADTARLLRARGKAM 121

Query: 124 QEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAAD 183
           Q+AVP G+G+M A++GLD   V  + AQA++  +CE ANDN   QVV+SG + AV+ A D
Sbjct: 122 QDAVPVGVGAMAAVLGLDLGAVKEVAAQAAQGEVCEAANDNDPAQVVVSGHKAAVERAVD 181

Query: 184 TCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSID 243
               KGAKRA+ LPVSAPFH SLM P +  M   L +V   DP VP++ N  A  V+   
Sbjct: 182 IAKEKGAKRALLLPVSAPFHCSLMQPAADAMAQALANVAIADPKVPVVANVLAEAVTDGA 241

Query: 244 EISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVE 303
           +I  LL +Q+TG VRWRE++ + A  GV  VYE+G+GK L+G+ KRID+ L++ ++   E
Sbjct: 242 QIKDLLAQQITGAVRWRESVMYMAGQGVTEVYEIGAGKALSGMVKRIDRGLTSAAVGTPE 301

Query: 304 DIDLALRSI 312
           ++     ++
Sbjct: 302 NVVAVAATV 310


>gi|74311653|ref|YP_310072.1| malonyl-CoA-[acyl-carrier-protein] transacylase [Shigella sonnei
           Ss046]
 gi|73855130|gb|AAZ87837.1| malonyl-CoA-[acyl-carrier-protein] transacylase [Shigella sonnei
           Ss046]
          Length = 309

 Score =  185 bits (470), Expect = 5e-45,   Method: Composition-based stats.
 Identities = 127/311 (40%), Positives = 174/311 (55%), Gaps = 4/311 (1%)

Query: 1   MS-TVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATC 59
           M+     FPGQGSQ +GM  D+  S+P     F E    L  +L  L   G  EEL  T 
Sbjct: 1   MTQFAFVFPGQGSQTVGMLADMAASYPIVEETFAEASAALGYDLWALTQQGPAEELNKTW 60

Query: 60  NAQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRAR 119
             QPAL   S+A  RV ++ G       + +AGHSLGEY+AL  A     +D +RLV  R
Sbjct: 61  QTQPALLTASVALYRVWQQQGGKA---PAMMAGHSLGEYSALVCAGVIDFADAVRLVEMR 117

Query: 120 GKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVK 179
           GK MQEAVP G G+M AIIGLDD  +   C +A+   +    N N  GQVVI+G ++AV+
Sbjct: 118 GKLMQEAVPEGTGAMAAIIGLDDASIAKACEEAAAGQVVSPVNFNSPGQVVIAGHKEAVE 177

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            A   C   GAKRA+ LPVS P H +LM P +  +   L  +T   P V ++ N      
Sbjct: 178 RAGAACKAAGAKRALPLPVSVPSHCALMKPAADKLAVELAKITFNAPTVSVVNNVDVKCE 237

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
           ++ D I   LV Q+   V+W +++++ A  GV+ +YEVG GKVLTGL KRI  +L+A ++
Sbjct: 238 TNGDAIRDALVRQLYNPVQWTKSVEYMAAQGVEHLYEVGPGKVLTGLTKRIVDTLTASAL 297

Query: 300 SKVEDIDLALR 310
           ++   +  AL 
Sbjct: 298 NEPSAMAAALE 308


>gi|300723631|ref|YP_003712936.1| malonyl-CoA-[acyl-carrier-protein] transacylase [Xenorhabdus
           nematophila ATCC 19061]
 gi|297630153|emb|CBJ90790.1| malonyl-CoA-[acyl-carrier-protein] transacylase [Xenorhabdus
           nematophila ATCC 19061]
          Length = 309

 Score =  185 bits (470), Expect = 5e-45,   Method: Composition-based stats.
 Identities = 125/311 (40%), Positives = 171/311 (54%), Gaps = 4/311 (1%)

Query: 1   MS-TVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATC 59
           MS   + FPGQGSQ +GM  DL   FP     F E    L  +L  L+  G  EEL  T 
Sbjct: 1   MSDFAMVFPGQGSQSLGMLADLATEFPLVEQTFAEASAVLGYDLWRLVQQGPVEELNKTW 60

Query: 60  NAQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRAR 119
             QPAL A S++  RV ++ G       S +AGHSLGEY+AL  A      + I+LV  R
Sbjct: 61  KTQPALLAASVSIWRVWQEKGGKA---PSMMAGHSLGEYSALVCAGVIEFQEAIKLVELR 117

Query: 120 GKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVK 179
           GK MQ+AVP G G+M AIIGLD+  +   C ++++  I    N N  GQVVI+G ++AV+
Sbjct: 118 GKLMQDAVPEGQGAMYAIIGLDNESIVKACEESAQGQIVSPVNFNSPGQVVIAGEKEAVE 177

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            A   C   GAKR + L VS P H +LM   +  +   L  +    P  P++ N  A   
Sbjct: 178 RAGAACKAAGAKRVLPLAVSVPSHCALMKSAANQLSAALQEIAFNQPQFPVVNNVDAKVE 237

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
            S D I   L+ Q+   VRW E++++ A  G+K + E+G GKVLTGL KRI  +LSA ++
Sbjct: 238 MSADAIRDALIRQLYNPVRWTESVEYIAEQGIKQLLEIGPGKVLTGLTKRIVDTLSATAV 297

Query: 300 SKVEDIDLALR 310
           + V  + + L 
Sbjct: 298 NDVSSLTVTLS 308


>gi|188534155|ref|YP_001907952.1| Malonyl CoA-acyl carrier protein transacylase (MCT) [Erwinia
           tasmaniensis Et1/99]
 gi|188029197|emb|CAO97069.1| Malonyl CoA-acyl carrier protein transacylase (MCT) [Erwinia
           tasmaniensis Et1/99]
          Length = 309

 Score =  185 bits (470), Expect = 5e-45,   Method: Composition-based stats.
 Identities = 129/312 (41%), Positives = 176/312 (56%), Gaps = 4/312 (1%)

Query: 1   MS-TVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATC 59
           M+   + FPGQGSQ +GM  DL  + P     F E    L  +L  L+  G  EEL  T 
Sbjct: 1   MTQFAMVFPGQGSQTLGMLADLAAANPLVEKTFREASDALGYDLWQLVQQGPAEELNKTW 60

Query: 60  NAQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRAR 119
             QPAL A S+A  RV ++ G       S +AGHSLGEY+AL  A   + +D I+LV  R
Sbjct: 61  QTQPALLAASVAIFRVWQEKGGKA---PSMLAGHSLGEYSALVCAGVIAFTDAIKLVELR 117

Query: 120 GKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVK 179
           GK MQEAVP G G+M AIIGLDD  +   C ++++  +    N N  GQVVI+G ++AV+
Sbjct: 118 GKLMQEAVPEGTGAMQAIIGLDDVSIAKACEESAQGQVVSPVNFNSPGQVVIAGNKEAVE 177

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            A   C   GAKRA+ LPVS P H +LM P +  +   L+ +T   P  P++ N      
Sbjct: 178 RAGAACKAAGAKRALPLPVSVPSHCALMKPAADKLAIALEQLTFSAPTFPVVNNVDVKVE 237

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
           S+ + I   LV Q+   VRW E++++ A  GV S+ E G GKVLTGL KRI  +L+A ++
Sbjct: 238 SAPEAIRSALVRQLYSPVRWTESVEFIAQQGVTSLLEAGPGKVLTGLTKRIVDTLTAAAV 297

Query: 300 SKVEDIDLALRS 311
           +    +  AL  
Sbjct: 298 NDQASLSAALEQ 309


>gi|145967351|gb|ABP99032.1| malonyl CoA-acyl carrier protein transacylase [Pseudomonas putida]
          Length = 312

 Score =  185 bits (470), Expect = 5e-45,   Method: Composition-based stats.
 Identities = 118/302 (39%), Positives = 173/302 (57%), Gaps = 3/302 (0%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
           S    FPGQGSQ +GM  +L    P     F+E    L  +L  L+  G +E+L  T   
Sbjct: 4   SLAFVFPGQGSQSLGMLAELGAEKPVIIETFKEASEALGYDLWKLVQEGPEEQLNQTDKT 63

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPA+   S+A  R+  + G       ++V+GHSLGEY+AL AA + +L D +RLV  RG+
Sbjct: 64  QPAILTASIALWRLWLEEGGA---QPAFVSGHSLGEYSALVAAGSITLKDAVRLVERRGQ 120

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCA 181
            MQEAVP G G+M AI+GLDD VV  ICA+A+   +    N N  GQVVI+G + AV  A
Sbjct: 121 LMQEAVPAGHGAMAAILGLDDAVVVEICAEAAEDQVVSAVNFNSPGQVVIAGNKAAVDRA 180

Query: 182 ADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSS 241
            + C  KGAKRA+ L VS P H +LM P ++     ++++  + P +P++ N  A+  + 
Sbjct: 181 MELCKAKGAKRALPLAVSVPSHCALMKPAAERFAEAVNAIEWKAPQIPVVQNVTAAVAAD 240

Query: 242 IDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISK 301
           +D +   L+ Q+   VRW E +Q  A +G  ++ E G GKVL GL KR    ++  +++ 
Sbjct: 241 LDALKHDLLAQLYQPVRWVECVQTLAANGAVNLVECGPGKVLAGLNKRCADGVTTYNLNT 300

Query: 302 VE 303
            +
Sbjct: 301 PD 302


>gi|113970732|ref|YP_734525.1| [Acyl-carrier-protein] S-malonyltransferase [Shewanella sp. MR-4]
 gi|113885416|gb|ABI39468.1| [Acyl-carrier-protein] S-malonyltransferase [Shewanella sp. MR-4]
          Length = 308

 Score =  185 bits (470), Expect = 5e-45,   Method: Composition-based stats.
 Identities = 122/307 (39%), Positives = 170/307 (55%), Gaps = 3/307 (0%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
           +    FPGQGSQ +GM  +L  + P     F E    L  +L  L+ +G  E L  T   
Sbjct: 3   NVAFVFPGQGSQALGMLAELAGAQPIVGQTFAEASEVLGYDLWALVQDGPVETLNETDKT 62

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPAL A S+A            K   + +AGHSLGEY+AL  A      D I+LV  RG+
Sbjct: 63  QPALLAASVAI---WRAYVASGKAMPAMLAGHSLGEYSALVCAGVIDFKDAIKLVELRGQ 119

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCA 181
            MQ+AVP G G+M AIIGLD+  + + C +A++  +    N N  GQVVI+G ++AV+ A
Sbjct: 120 LMQQAVPAGTGAMYAIIGLDNDGIANACIEAAQGEVVSPVNFNSPGQVVIAGQKEAVERA 179

Query: 182 ADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSS 241
           A  C   GAK AV LPVS P H +LM P +  +   L+ V    P + ++ N   +  ++
Sbjct: 180 AAACKAAGAKMAVALPVSVPSHCALMKPAADKLALALNDVQFNAPSITVINNVDVASPTA 239

Query: 242 IDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISK 301
           + +I   LV Q+   VRW ET++  A  G+  + E G GKVLTGLAKRI+KSLSA +++ 
Sbjct: 240 VADIKDALVRQLYCPVRWSETVELMAEKGITQLVECGPGKVLTGLAKRINKSLSAQAVND 299

Query: 302 VEDIDLA 308
           V  +   
Sbjct: 300 VASLAAL 306


>gi|94311365|ref|YP_584575.1| [Acyl-carrier-protein] S-malonyltransferase [Cupriavidus
           metallidurans CH34]
 gi|93355217|gb|ABF09306.1| malonyl-CoA-(acyl-carrier-protein) transacylase [Cupriavidus
           metallidurans CH34]
          Length = 311

 Score =  185 bits (470), Expect = 5e-45,   Method: Composition-based stats.
 Identities = 119/315 (37%), Positives = 162/315 (51%), Gaps = 6/315 (1%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M     FPGQGSQ +GM     D+ P  R   EE    L Q++  L+  G  EEL  T N
Sbjct: 1   MKFAFVFPGQGSQSVGMLNAFADN-PVVRATLEEASTALGQDIGKLIAEGPAEELNLTTN 59

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
            QP +   ++A  R     G       + VAGHSLGEY+AL AA     ++ + LVR R 
Sbjct: 60  TQPVMLTAAVAVYRAWLDAGG---PAPALVAGHSLGEYSALVAAGVIPFAEAVPLVRFRA 116

Query: 121 KSMQEAVPPGL--GSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAV 178
           ++MQEAVP G    + +  +  DD       A A+  G+ E  N N   QVVI+G + AV
Sbjct: 117 QAMQEAVPVGEGGMAAILGLSDDDVRAACAEAAAAGAGVVEAVNFNAPSQVVIAGNKGAV 176

Query: 179 KCAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASP 238
           + A +    KGAKRA+ LPVSAPFHSSL+ P S  ++  +  ++   P +P++ N   + 
Sbjct: 177 EKACEIAKAKGAKRALPLPVSAPFHSSLLKPASDRLRERMAGLSFSAPAIPLVNNVDVAI 236

Query: 239 VSSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVS 298
           +S   +I   LV Q    VRW E +Q  A  GV  V E G GKVL G+ KRID +L   +
Sbjct: 237 ISDPAQIKDALVRQAAAPVRWVECVQKIAAEGVTHVIECGPGKVLAGMTKRIDGNLVGGA 296

Query: 299 ISKVEDIDLALRSIV 313
           I     +   L  + 
Sbjct: 297 IFDPASLQETLALLK 311


>gi|332141137|ref|YP_004426875.1| malonyl CoA-acyl carrier protein transacylase [Alteromonas
           macleodii str. 'Deep ecotype']
 gi|327551159|gb|AEA97877.1| malonyl CoA-acyl carrier protein transacylase [Alteromonas
           macleodii str. 'Deep ecotype']
          Length = 309

 Score =  185 bits (470), Expect = 5e-45,   Method: Composition-based stats.
 Identities = 129/309 (41%), Positives = 179/309 (57%), Gaps = 6/309 (1%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
            T   FPGQGSQ +GM ++L ++ P     F+E    L  +L DL+ N +  +L  T   
Sbjct: 3   KTACVFPGQGSQSVGMLKELAETSPIIEATFKEASDVLGYDLWDLVQNDTDGKLNETHIT 62

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPAL A S+A  RV+ + G+    D+ Y+AGHSLGEY+AL    A   +D I+LV ARGK
Sbjct: 63  QPALLAASVAIWRVIREQGI----DVDYLAGHSLGEYSALVCGGAMDFADAIKLVEARGK 118

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIAN--DNGGGQVVISGLQDAVK 179
            MQEAVP G G+M AIIGLDD  +  IC Q +      +A    N  GQVVI+G + A +
Sbjct: 119 YMQEAVPAGAGAMYAIIGLDDATIADICQQTAIATGDVVAPVNFNSPGQVVIAGEKHAAE 178

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            AA  C + GAKRA+ L VS P H  LM P +  ++  L S+   +P + I+ N   +  
Sbjct: 179 QAASACKDAGAKRALPLAVSVPSHCELMRPAADKLEDALSSLNVNEPAINIVNNVDVTIE 238

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
           +  D I   LV Q+   V+W  T+++ A  GV+ V EVG GKVLTGL KRI K L A+++
Sbjct: 239 TQGDAIKNALVRQLYCPVQWTRTVEYLAAAGVERVIEVGPGKVLTGLNKRISKGLEALAV 298

Query: 300 SKVEDIDLA 308
           +  + ++  
Sbjct: 299 NTPDGVEAL 307


>gi|325294490|ref|YP_004281004.1| malonyl CoA-acyl carrier protein transacylase [Desulfurobacterium
           thermolithotrophum DSM 11699]
 gi|325064938|gb|ADY72945.1| malonyl CoA-acyl carrier protein transacylase [Desulfurobacterium
           thermolithotrophum DSM 11699]
          Length = 307

 Score =  185 bits (470), Expect = 6e-45,   Method: Composition-based stats.
 Identities = 127/310 (40%), Positives = 184/310 (59%), Gaps = 3/310 (0%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M+    FPGQGSQ  GMG++L+D+FPEAR VFEE       +++ L +   +E+LT T N
Sbjct: 1   MAVAFIFPGQGSQYSGMGKELFDAFPEAREVFEEASEGAKVDIAKLCFEAPEEKLTLTYN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
           AQPA+  +SMA ++V+EK G     +   VAGHSLGE++A  AAK  S+ D   LVR RG
Sbjct: 61  AQPAIFTLSMAILKVLEKAGF--NEEPVLVAGHSLGEFSAAGAAKVISIHDGALLVRKRG 118

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           + MQEAVP G+G M A+IGL    ++    +  + G  ++AN N   Q VISG   A++ 
Sbjct: 119 EFMQEAVPAGVGGMTAVIGLTSKKIE-EVLKNVKSGFIQVANYNSPEQTVISGEIKALEE 177

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A +     GAK+ V L VSAPFHS LM P ++ +K +++ +  ++  VPIL N     + 
Sbjct: 178 AEEKLKEAGAKKVVRLAVSAPFHSELMKPAAEKLKELMEEIEFKEAEVPILNNADVRIIK 237

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
           + +EI      Q+   VRW E +      GV + YE+G   VL GL +RID+SL  +++ 
Sbjct: 238 TPEEIRDSFYRQMFSPVRWVEDVLKMKEMGVDTFYEIGPKNVLKGLIRRIDRSLKVINVE 297

Query: 301 KVEDIDLALR 310
           K +D++  L 
Sbjct: 298 KPKDLEKFLS 307


>gi|170768143|ref|ZP_02902596.1| malonyl CoA-acyl carrier protein transacylase [Escherichia albertii
           TW07627]
 gi|170122909|gb|EDS91840.1| malonyl CoA-acyl carrier protein transacylase [Escherichia albertii
           TW07627]
          Length = 309

 Score =  185 bits (470), Expect = 6e-45,   Method: Composition-based stats.
 Identities = 127/311 (40%), Positives = 175/311 (56%), Gaps = 4/311 (1%)

Query: 1   MS-TVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATC 59
           M+     FPGQGSQ +GM  D+  S+P     F E    L  +L  L   G  EEL  T 
Sbjct: 1   MTQFAFVFPGQGSQTVGMLADMAASYPIVEKTFAEASAALGYDLWALTQQGPAEELNKTW 60

Query: 60  NAQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRAR 119
             QPAL   S+A  RV ++ G       + +AGHSLGEY+AL  A     +D +RLV  R
Sbjct: 61  QTQPALLTASVALYRVWQQQGGKA---PAMMAGHSLGEYSALVCAGVIDFADAVRLVEMR 117

Query: 120 GKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVK 179
           GK MQEAVP G G+M AIIGLDD  +   C +A+   +    N N  GQVVI+G ++AV+
Sbjct: 118 GKFMQEAVPEGTGAMAAIIGLDDASIAKACEEAAEGQVVSPVNFNSPGQVVIAGHKEAVE 177

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            A   C   GAKRA+ LPVS P H +LM P +  +   L  +T   P +P++ N      
Sbjct: 178 RAGAACKAAGAKRALPLPVSVPSHCALMKPAADKLAVELAKITFNAPTIPVVNNVDVKCE 237

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
           ++ D I   LV Q+   V+W +++++ A  GV+ +YEVG GKVLTGL KRI  +L+A ++
Sbjct: 238 TNGDAIRDALVRQLYNPVQWTKSVEYMAAQGVEHLYEVGPGKVLTGLTKRIVDTLTASAL 297

Query: 300 SKVEDIDLALR 310
           ++   +  AL 
Sbjct: 298 NEPSAMAAALE 308


>gi|156741474|ref|YP_001431603.1| malonyl CoA-acyl carrier protein transacylase [Roseiflexus
           castenholzii DSM 13941]
 gi|156232802|gb|ABU57585.1| malonyl CoA-acyl carrier protein transacylase [Roseiflexus
           castenholzii DSM 13941]
          Length = 324

 Score =  185 bits (470), Expect = 6e-45,   Method: Composition-based stats.
 Identities = 119/307 (38%), Positives = 172/307 (56%), Gaps = 4/307 (1%)

Query: 1   MS--TVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTAT 58
           M     L FPGQGSQ +GMG++L ++ P AR VFE+ D  L   LS L + G QEEL  T
Sbjct: 1   MKKRIALVFPGQGSQYVGMGKELCEASPAARRVFEKADQVLGFELSRLCFEGPQEELDDT 60

Query: 59  CNAQPALTAVSMAFIRVMEKNGLCVKR--DISYVAGHSLGEYTALCAAKAFSLSDTIRLV 116
            NAQPA+  VS+A +  +++           S VAGHSLGE+TAL AA      D ++LV
Sbjct: 61  INAQPAILTVSVACLEALKERFGPFGYLGAPSLVAGHSLGEFTALVAAGVLDFEDALKLV 120

Query: 117 RARGKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQD 176
           R RG+ M+E+     G M A++GLDD  ++ +  +A   G+  +AN N  GQ VISG   
Sbjct: 121 RERGRLMKESGEQRPGGMAAVVGLDDKTLEEVVEEAQAEGVVSVANANSPGQTVISGEHR 180

Query: 177 AVKCAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCA 236
           A++ A +    +GAK    L VS   HS LM   S     +LD    + P VP++ N   
Sbjct: 181 ALQRAMELAKARGAKLVQRLQVSIAAHSPLMQSASTRFDELLDRFQLRPPQVPLIANISG 240

Query: 237 SPVSSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSA 296
             +++++E+   L +Q+T  V+W  ++Q   +HGV ++ EVG  +VL+GL KRI      
Sbjct: 241 RALTTVEELRNELSQQLTRPVQWTRSVQEMVSHGVDTIVEVGPRQVLSGLIKRITPHAKP 300

Query: 297 VSISKVE 303
           V ++  E
Sbjct: 301 VPLTDAE 307


>gi|24112498|ref|NP_707008.1| acyl carrier protein S-malonyltransferase [Shigella flexneri 2a
           str. 301]
 gi|30062626|ref|NP_836797.1| acyl carrier protein S-malonyltransferase [Shigella flexneri 2a
           str. 2457T]
 gi|82544442|ref|YP_408389.1| malonyl-CoA-[acyl-carrier-protein] transacylase [Shigella boydii
           Sb227]
 gi|24051385|gb|AAN42715.1| malonyl-CoA-[acyl-carrier-protein] transacylase [Shigella flexneri
           2a str. 301]
 gi|30040872|gb|AAP16603.1| malonyl-CoA-[acyl-carrier-protein] transacylase [Shigella flexneri
           2a str. 2457T]
 gi|81245853|gb|ABB66561.1| malonyl-CoA-[acyl-carrier-protein] transacylase [Shigella boydii
           Sb227]
 gi|281600508|gb|ADA73492.1| Malonyl-CoA-[acyl-carrier-protein] transacylase [Shigella flexneri
           2002017]
 gi|313650455|gb|EFS14862.1| malonyl CoA-acyl carrier protein transacylase [Shigella flexneri 2a
           str. 2457T]
 gi|332759478|gb|EGJ89786.1| malonyl CoA-acyl carrier protein transacylase [Shigella flexneri
           2747-71]
 gi|333019384|gb|EGK38667.1| malonyl CoA-acyl carrier protein transacylase [Shigella flexneri
           K-304]
          Length = 309

 Score =  185 bits (470), Expect = 6e-45,   Method: Composition-based stats.
 Identities = 128/311 (41%), Positives = 175/311 (56%), Gaps = 4/311 (1%)

Query: 1   MS-TVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATC 59
           M+     FPGQGSQ +GM  D+  S+P     F E    L  +L  L   GS EEL  T 
Sbjct: 1   MTQFAFVFPGQGSQTVGMLADMAASYPIVEETFAEASAALGYDLWALTQQGSAEELNKTW 60

Query: 60  NAQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRAR 119
             QPAL   S+A  RV ++ G       + +AGHSLGEY+AL  A     +D +RLV  R
Sbjct: 61  QTQPALLTASVALYRVWQQQGGKA---PAMMAGHSLGEYSALVCAGVIDFADAVRLVEMR 117

Query: 120 GKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVK 179
           GK MQEAVP G G+M AIIGLDD  +   C +A+   +    N N  GQVVI+G ++AV+
Sbjct: 118 GKFMQEAVPEGTGAMAAIIGLDDAPIAKACEEAAEGQVVSPVNFNSPGQVVIAGHKEAVE 177

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            A   C   GAKRA+ LPVS P H +LM P +  +   L  +T   P V ++ N      
Sbjct: 178 RAGAACKAAGAKRALPLPVSVPSHCALMKPAADKLAVELAKITFNAPTVSVVNNVDVKCE 237

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
           ++ D I   LV Q+   V+W +++++ A  GV+ +YEVG GKVLTGL KRI  +L+A ++
Sbjct: 238 TNGDAIRDALVRQLYNPVQWTKSVEYMAAQGVEHLYEVGPGKVLTGLTKRIVDTLTASAL 297

Query: 300 SKVEDIDLALR 310
           ++   +  AL 
Sbjct: 298 NEPSAMAAALE 308


>gi|322513606|ref|ZP_08066704.1| malonyl-CoA-[acyl-carrier-protein] transacylase [Actinobacillus
           ureae ATCC 25976]
 gi|322120566|gb|EFX92466.1| malonyl-CoA-[acyl-carrier-protein] transacylase [Actinobacillus
           ureae ATCC 25976]
          Length = 311

 Score =  185 bits (470), Expect = 6e-45,   Method: Composition-based stats.
 Identities = 123/311 (39%), Positives = 171/311 (54%), Gaps = 5/311 (1%)

Query: 1   MS-TVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATC 59
           MS   + FPGQGSQ +GM  DL  ++P     F++    L  +L DL+ NG+ E+L  T 
Sbjct: 1   MSNFAMVFPGQGSQAVGMLVDLATTYPIVEETFKQASDVLGYDLWDLVQNGTAEDLGQTQ 60

Query: 60  NAQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRAR 119
             QPAL A S+A  RV ++     +   S +AGHSLGEY+AL  A      D I+LV  R
Sbjct: 61  RTQPALLASSVAIYRVWQQ--KYPELKPSVMAGHSLGEYSALVCAGVLDFQDAIKLVELR 118

Query: 120 GKSMQEAVP--PGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDA 177
           G +MQ+AVP   G    +  +     +     AQA    I    N N  GQVVI+G + A
Sbjct: 119 GNAMQQAVPAGTGAMYAIIGLDNQAIINACEQAQAEVGEIVSAVNFNSPGQVVIAGTKAA 178

Query: 178 VKCAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCAS 237
            + A + C   GAKRA+ L VS P H +LM P +  +   L ++T   PVVP++ N   S
Sbjct: 179 AEKAGELCKAAGAKRALPLAVSVPSHCALMKPAADKLAEALQNITLNVPVVPVINNVDVS 238

Query: 238 PVSSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAV 297
             +  + I   LV Q+   VRW ET++  AN GV ++YE+G GKVLTGLA RI K L+A 
Sbjct: 239 VETDAEAIRNALVRQLYSPVRWTETVEKMANEGVTTLYEIGPGKVLTGLAGRIVKELNAK 298

Query: 298 SISKVEDIDLA 308
           +++ V  ++  
Sbjct: 299 AVNDVASLEAV 309


>gi|220922740|ref|YP_002498042.1| malonyl CoA-acyl carrier protein transacylase [Methylobacterium
           nodulans ORS 2060]
 gi|219947347|gb|ACL57739.1| malonyl CoA-acyl carrier protein transacylase [Methylobacterium
           nodulans ORS 2060]
          Length = 311

 Score =  185 bits (470), Expect = 6e-45,   Method: Composition-based stats.
 Identities = 157/309 (50%), Positives = 203/309 (65%), Gaps = 1/309 (0%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           MS    FPGQGSQ +GMG  L  +   AR VF EVD  L+QNLS LM+ G  +ELT T N
Sbjct: 1   MSRAFIFPGQGSQAVGMGAGLSQNHAAAREVFAEVDEALSQNLSRLMFEGPADELTLTAN 60

Query: 61  AQPALTAVSMAFIRVME-KNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRAR 119
           AQPAL A S+A +RV+E + GL + RD+++VAGHSLGEY+AL AA A +L+DT RL+R R
Sbjct: 61  AQPALMAASLAVLRVLEAERGLELARDVAFVAGHSLGEYSALAAAGALNLADTARLLRLR 120

Query: 120 GKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVK 179
           G++MQ AVP G G+M A++GL+    + I  +A +  +C++ANDNG GQVV+SG + AV+
Sbjct: 121 GEAMQRAVPVGTGAMAALLGLEVEAAEEIAGEAEQGEVCDVANDNGAGQVVVSGHRSAVE 180

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            A      +GAKRAV L VSAPFH +LM+P ++ M+  LD VT     VP++ N  ASP+
Sbjct: 181 RAVALAQTRGAKRAVMLNVSAPFHCALMSPAAETMRAALDQVTLVAAKVPVMANILASPI 240

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
                I   LV QVTG VRWRE +   A  GV + YE+G+GKVL+GL KRI    SA  I
Sbjct: 241 REPAAIRDALVRQVTGTVRWRECVAAMAGAGVDAFYEIGTGKVLSGLVKRIAPGASATPI 300

Query: 300 SKVEDIDLA 308
               DI   
Sbjct: 301 GTPADIAAF 309


>gi|295096213|emb|CBK85303.1| [Acyl-carrier-protein] S-malonyltransferase [Enterobacter cloacae
           subsp. cloacae NCTC 9394]
          Length = 309

 Score =  185 bits (469), Expect = 6e-45,   Method: Composition-based stats.
 Identities = 126/312 (40%), Positives = 178/312 (57%), Gaps = 4/312 (1%)

Query: 1   MS-TVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATC 59
           M+     FPGQGSQ +GM  ++  ++P     F E    L  +L  L   G  EEL  T 
Sbjct: 1   MTQFAFVFPGQGSQTVGMLSEMAANYPVIEETFREASDALGYDLWALTQQGPAEELNKTW 60

Query: 60  NAQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRAR 119
             QPAL A S+A  RV ++ G       + +AGHSLGEY+AL  A   + +D +RLV  R
Sbjct: 61  QTQPALLAASVALWRVWQQQGGKA---PTLMAGHSLGEYSALVCAGVIAFADAVRLVELR 117

Query: 120 GKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVK 179
           GK MQEAVP G G M AIIGLDD  +   C +++   +    N N  GQVVI+G ++AV+
Sbjct: 118 GKFMQEAVPEGTGGMSAIIGLDDASIAKACEESAEGQVVSPVNFNSPGQVVIAGHKEAVE 177

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            A   C   GAKRA+ LPVS P H +LM P +  +   L+ +T   P + ++ N      
Sbjct: 178 RAGAACKAAGAKRALPLPVSVPSHCALMKPAADKLAVELEKMTFNAPTISVVNNVDVQCE 237

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
           ++ + I   LV Q+   V+W +T+++ A+ GV+ +YEVG GKVLTGL KRI  +L+A +I
Sbjct: 238 TAPEAIRNALVRQLYSPVQWTKTVEFMASQGVEHLYEVGPGKVLTGLTKRIVDTLTASAI 297

Query: 300 SKVEDIDLALRS 311
           ++ E +  AL  
Sbjct: 298 NEPEAMKAALSQ 309


>gi|313901962|ref|ZP_07835378.1| (Acyl-carrier-protein) S-malonyltransferase [Thermaerobacter
           subterraneus DSM 13965]
 gi|313467751|gb|EFR63249.1| (Acyl-carrier-protein) S-malonyltransferase [Thermaerobacter
           subterraneus DSM 13965]
          Length = 317

 Score =  185 bits (469), Expect = 7e-45,   Method: Composition-based stats.
 Identities = 135/313 (43%), Positives = 189/313 (60%), Gaps = 7/313 (2%)

Query: 1   MS-TVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATC 59
           MS T + FPGQG+Q +GMG+DLY+ FPEAR VF E       +++ L + G +++L  T 
Sbjct: 1   MSGTAVVFPGQGAQYVGMGKDLYEQFPEAREVFAEASAAAGFDVARLCFEGPEDQLQLTE 60

Query: 60  NAQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRAR 119
             QPAL AV +A  RV+   G     + +  AG SLGEY AL AA    L+D  R+VR R
Sbjct: 61  FQQPALLAVGVACWRVLAARG----LEPAMAAGLSLGEYGALVAAGVLELADAARVVRLR 116

Query: 120 GKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASR--VGICEIANDNGGGQVVISGLQDA 177
           GK MQEAVPPG G+M A++GL+   V++IC Q      G+ E AN N  GQ+V++G + A
Sbjct: 117 GKFMQEAVPPGEGAMAALLGLEAGTVENICRQVMDAGAGVVEPANYNCPGQIVVAGQRAA 176

Query: 178 VKCAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCAS 237
           V+ A +     GA+RAV LPVSAPFH  LM P ++ +  +L  V  +   +P++ N  A 
Sbjct: 177 VEAAVERARAAGARRAVLLPVSAPFHCRLMEPAARRLAGVLAEVPFRPARIPVVANVTAE 236

Query: 238 PVSSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAV 297
           PV+  + I  LLV+QV   VRW ++++     G+  + E+G GK LTG A+RIDK L AV
Sbjct: 237 PVTDPERIRELLVQQVDHPVRWEQSVRRMQREGITRLVEMGPGKTLTGFARRIDKHLEAV 296

Query: 298 SISKVEDIDLALR 310
           +    E+I   + 
Sbjct: 297 AAGTAEEILALVA 309


>gi|288802263|ref|ZP_06407703.1| malonyl CoA-acyl carrier protein transacylase [Prevotella
           melaninogenica D18]
 gi|288335230|gb|EFC73665.1| malonyl CoA-acyl carrier protein transacylase [Prevotella
           melaninogenica D18]
          Length = 294

 Score =  185 bits (469), Expect = 7e-45,   Method: Composition-based stats.
 Identities = 97/300 (32%), Positives = 148/300 (49%), Gaps = 7/300 (2%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M     FPGQGSQ +GMG+DLYD+ P A+ +F++ D  L   ++++M+ G+ E+L  T  
Sbjct: 1   MK-AFVFPGQGSQFVGMGKDLYDNNPLAKELFDKADEILGFKITEIMFAGTDEQLKETKV 59

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIR-LVRAR 119
            QPA+   S+     +       +     VAGHSLGE++AL AA A S  D ++ +    
Sbjct: 60  TQPAVFLHSVISALCL-----GDEFKPDMVAGHSLGEFSALVAAGALSFEDGLKLVAARA 114

Query: 120 GKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVK 179
               +            I   D+ V +   + +    +C  AN N  GQ+VISG  + V 
Sbjct: 115 NAMQKACELNPGTMAAIIGLPDEKVEEICASVSQEGKVCVAANFNCPGQLVISGSTEGVN 174

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            A +     GAKRA+ L V   FHS LM P    ++  +++ T   P  P+  N  A P 
Sbjct: 175 EACELMKAAGAKRALPLKVGGAFHSPLMQPAKDELQAAIEATTFNAPKCPVYQNVDALPH 234

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
           +   +I + L+ Q+T  VRW ++ Q     G     E G G  L G+  RIDK+++A  +
Sbjct: 235 TDPADIQKNLIAQLTSSVRWTKSAQNMIADGATEFVECGPGTALQGMLGRIDKTVNAHGV 294


>gi|260427621|ref|ZP_05781600.1| malonyl CoA-acyl carrier protein transacylase [Citreicella sp.
           SE45]
 gi|260422113|gb|EEX15364.1| malonyl CoA-acyl carrier protein transacylase [Citreicella sp.
           SE45]
          Length = 314

 Score =  185 bits (469), Expect = 7e-45,   Method: Composition-based stats.
 Identities = 151/314 (48%), Positives = 199/314 (63%), Gaps = 2/314 (0%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           MS    FPGQG+Q IGMG+ L ++FP AR +++EVD  L + LS L+W G  + LT T N
Sbjct: 1   MSRAFIFPGQGAQAIGMGKALAEAFPAARAIYDEVDEALGEKLSALIWEGDADTLTLTEN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
           AQPAL A SMA +R +E  G+ V  D S+VAGHSLGEY+AL AA A S++D  RL+R RG
Sbjct: 61  AQPALMATSMAALRALEAEGVSVT-DASFVAGHSLGEYSALTAAGALSVADAARLLRTRG 119

Query: 121 KSMQEAVPPGLGSMVAIIGLD-DCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVK 179
           ++MQ AVP G+G+M A++GLD           AS   +C  ANDN  GQVVISG + AV 
Sbjct: 120 RAMQNAVPVGVGAMAALLGLDLVRAKAVAAEAASDGEVCAAANDNDPGQVVISGHKAAVA 179

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            A +     GAKRAV LPVSAPFH +LM P ++ M   L  V+   P VP++ N     V
Sbjct: 180 RAVELAKALGAKRAVMLPVSAPFHCALMAPAAEAMAEALAEVSISAPKVPLVANVSVEAV 239

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
           +  D I  LLVEQVTG VRWRE++++   +GV   +E+G+GK L+G+ +RID+S S  +I
Sbjct: 240 TDPDTIRALLVEQVTGAVRWRESVEYMIGNGVSEFWEIGAGKALSGMVRRIDRSASVAAI 299

Query: 300 SKVEDIDLALRSIV 313
              ED+        
Sbjct: 300 GTPEDVAKVTEQAA 313


>gi|165977437|ref|YP_001653030.1| malonyl CoA-acyl carrier protein transacylase [Actinobacillus
           pleuropneumoniae serovar 3 str. JL03]
 gi|190151349|ref|YP_001969874.1| malonyl CoA-acyl carrier protein transacylase (MCT) [Actinobacillus
           pleuropneumoniae serovar 7 str. AP76]
 gi|307251266|ref|ZP_07533187.1| Malonyl CoA-acyl carrier protein transacylase [Actinobacillus
           pleuropneumoniae serovar 4 str. M62]
 gi|307264704|ref|ZP_07546284.1| Malonyl CoA-acyl carrier protein transacylase [Actinobacillus
           pleuropneumoniae serovar 13 str. N273]
 gi|165877538|gb|ABY70586.1| malonyl CoA-acyl carrier protein transacylase [Actinobacillus
           pleuropneumoniae serovar 3 str. JL03]
 gi|189916480|gb|ACE62732.1| Malonyl CoA-acyl carrier protein transacylase (MCT) [Actinobacillus
           pleuropneumoniae serovar 7 str. AP76]
 gi|306856782|gb|EFM88917.1| Malonyl CoA-acyl carrier protein transacylase [Actinobacillus
           pleuropneumoniae serovar 4 str. M62]
 gi|306870016|gb|EFN01780.1| Malonyl CoA-acyl carrier protein transacylase [Actinobacillus
           pleuropneumoniae serovar 13 str. N273]
          Length = 311

 Score =  185 bits (469), Expect = 7e-45,   Method: Composition-based stats.
 Identities = 122/311 (39%), Positives = 170/311 (54%), Gaps = 5/311 (1%)

Query: 1   MS-TVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATC 59
           MS   + FPGQGSQ +GM  DL  ++P     F++    L  +L DL+ NGS E+L  T 
Sbjct: 1   MSNFAMVFPGQGSQAVGMLADLATAYPIVEETFKQASDVLGYDLWDLVQNGSAEDLGQTQ 60

Query: 60  NAQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRAR 119
             QPAL A S+A  RV ++     +   S +AGHSLGEY+AL  A      D I+LV  R
Sbjct: 61  RTQPALLASSVAIYRVWQQ--KYPELKPSVMAGHSLGEYSALVCAGVLDFQDAIKLVELR 118

Query: 120 GKSMQEAVP--PGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDA 177
           G +MQ+AVP   G    +  +  +  +     AQA    I    N N  GQVVI+G + A
Sbjct: 119 GNAMQQAVPAGTGAMYAIIGLDNEAIINACEQAQAEVGEIVSAVNFNSPGQVVIAGTKAA 178

Query: 178 VKCAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCAS 237
            + A + C   GAKRA+ L VS P H +LM P +  +   L ++T   PVVP++ N   S
Sbjct: 179 AEKAGELCKAAGAKRALPLAVSVPSHCALMKPAADKLAEALQNITLNVPVVPVINNVDVS 238

Query: 238 PVSSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAV 297
             +  + I   LV Q+   VRW ET++  AN GV ++YE+G GKVLTGL  RI K L A 
Sbjct: 239 VETDAEAICNALVHQLYSPVRWTETVEKMANEGVTTLYEIGPGKVLTGLTSRIVKELKAQ 298

Query: 298 SISKVEDIDLA 308
           +++ +  ++  
Sbjct: 299 AVNDLVSLEAV 309


>gi|323345549|ref|ZP_08085772.1| malonyl-CoA-[acyl-carrier-protein] transacylase [Prevotella oralis
           ATCC 33269]
 gi|323093663|gb|EFZ36241.1| malonyl-CoA-[acyl-carrier-protein] transacylase [Prevotella oralis
           ATCC 33269]
          Length = 297

 Score =  185 bits (469), Expect = 7e-45,   Method: Composition-based stats.
 Identities = 111/301 (36%), Positives = 159/301 (52%), Gaps = 7/301 (2%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M     FPGQGSQ +GMG+DLY++   A+ +F++ D  L   ++D+M+ G+ +EL  T  
Sbjct: 1   MK-AFVFPGQGSQFVGMGKDLYENNSLAKELFDKADEILGFKITDIMFAGTDDELRQTKV 59

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
            QP     ++    V+    +  +   + VAGHSLGE++AL AA A S  D +RLV AR 
Sbjct: 60  TQP-----AVFLHSVISALCMGDEFAPAMVAGHSLGEFSALVAAGALSFEDGLRLVHARA 114

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQV-VISGLQDAVK 179
            +MQ+A     G+M AIIGL D  V+ +CA+ S  G   I  +       VISG  +AV 
Sbjct: 115 LAMQKACEVSEGTMAAIIGLPDEKVEEVCAEVSAEGNVVIPANYNCPGQLVISGNVNAVN 174

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            A +     GAKRA+ L VS  FHS LM P  + ++  ++  T   P  P+  N    P 
Sbjct: 175 AACEKLKAAGAKRALPLKVSGAFHSPLMQPAKEELQVAIEQTTINAPKCPVYQNVDGKPH 234

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
           +   EI   L+ Q+T  VRW  ++Q     G     E G GK L G+  RID +++A  I
Sbjct: 235 TDAAEIKSNLIAQLTSPVRWTSSVQNMIADGANDFTECGPGKALQGMISRIDNTVTAHGI 294

Query: 300 S 300
            
Sbjct: 295 E 295


>gi|261880410|ref|ZP_06006837.1| malonyl CoA-acyl carrier protein transacylase [Prevotella bergensis
           DSM 17361]
 gi|270332879|gb|EFA43665.1| malonyl CoA-acyl carrier protein transacylase [Prevotella bergensis
           DSM 17361]
          Length = 295

 Score =  185 bits (469), Expect = 7e-45,   Method: Composition-based stats.
 Identities = 94/301 (31%), Positives = 146/301 (48%), Gaps = 7/301 (2%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M     FPGQGSQ +GMG++LYD+ P A+ +F++ D  L   ++D+M+ G+ ++L  T  
Sbjct: 1   MK-AFVFPGQGSQYVGMGKELYDNNPLAKKLFDKADEILGFKITDIMFAGTDDQLKETRV 59

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIR-LVRAR 119
            QP     ++    V+    +     ++ +AGHSLGE++AL  A A S  D +R +    
Sbjct: 60  TQP-----AVFLHSVISALCMGDHSHVAMMAGHSLGEFSALVVAGALSFEDGLRLVAARA 114

Query: 120 GKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVK 179
               +            I   D+ V +   + ++   +   AN N  GQ+VISG ++ + 
Sbjct: 115 NAMQEACEANPGTMAAIIGLPDEKVEEVCSSISNEGKVVVAANYNCPGQLVISGDKEGIS 174

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            A +     GAKRA+ L V   FHS LM      ++  ++  T   P  P+  N    P 
Sbjct: 175 EACEKLKAAGAKRALPLKVGGAFHSPLMQMAKDKLQKAIEETTFATPKCPVYQNVDGKPH 234

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
           +  +EI R L+ Q+T  VRW  ++Q     G     E G GK L G+  RI K +SA  I
Sbjct: 235 TDAEEIKRNLIAQLTSSVRWTSSVQNMIADGADDFTECGPGKALQGMIARISKEVSAHGI 294

Query: 300 S 300
            
Sbjct: 295 D 295


>gi|254363102|ref|ZP_04979156.1| hypothetical protein
 gi|261493060|ref|ZP_05989600.1| acyl carrier protein S-malonyltransferase [Mannheimia haemolytica
           serotype A2 str. BOVINE]
 gi|261496348|ref|ZP_05992743.1| acyl carrier protein S-malonyltransferase [Mannheimia haemolytica
           serotype A2 str. OVINE]
 gi|153094989|gb|EDN75552.1| [acyl-carrier-protein] S-malonyltransferase [Mannheimia haemolytica
           PHL213]
 gi|261307992|gb|EEY09300.1| acyl carrier protein S-malonyltransferase [Mannheimia haemolytica
           serotype A2 str. OVINE]
 gi|261311280|gb|EEY12443.1| acyl carrier protein S-malonyltransferase [Mannheimia haemolytica
           serotype A2 str. BOVINE]
          Length = 311

 Score =  185 bits (469), Expect = 8e-45,   Method: Composition-based stats.
 Identities = 115/309 (37%), Positives = 167/309 (54%), Gaps = 4/309 (1%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
              + FPGQGSQ +GM  DL   +P     F++    L  +L DL+ NG+ EEL  T   
Sbjct: 3   KFAMVFPGQGSQAVGMLADLAPQYPIVEETFKQASDVLGYDLWDLVQNGTAEELGQTHRT 62

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPAL A S+A  R+ ++     ++  + +AGHSLGEY+AL  A      D I+LV  RG+
Sbjct: 63  QPALLASSVALFRIWQQ--KFPEQKPAVMAGHSLGEYSALVCAGVLDFQDAIKLVELRGR 120

Query: 122 SMQEAVP--PGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVK 179
           +MQEAVP   G    +  +  +  +     A +    I    N N  GQVVI+G + A +
Sbjct: 121 AMQEAVPAGSGAMFAIIGLDNESIIKACEQAASETGEIVSAVNFNSPGQVVIAGTKAAAE 180

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            A + C   GAKRA+ L VS P H +LM P ++ +   L ++    P+VP++ N   +  
Sbjct: 181 KAGELCKAAGAKRALPLAVSVPSHCALMKPAAEKLAEALQNIELNQPLVPVINNVDVAVE 240

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
           +  D I   LV Q+   VRW ET++  A  G+ ++YE+G  KVLTGLA RI K LSA ++
Sbjct: 241 TDADTIRNALVRQLYSPVRWTETVEKMAQDGITTLYEIGPNKVLTGLAGRIVKELSAKAV 300

Query: 300 SKVEDIDLA 308
           + V   +  
Sbjct: 301 NDVASFEAV 309


>gi|325270508|ref|ZP_08137108.1| malonyl-CoA-[acyl-carrier-protein] transacylase [Prevotella
           multiformis DSM 16608]
 gi|325857439|ref|ZP_08172494.1| [acyl-carrier-protein] S-malonyltransferase [Prevotella denticola
           CRIS 18C-A]
 gi|327314143|ref|YP_004329580.1| [acyl-carrier-protein] S-malonyltransferase [Prevotella denticola
           F0289]
 gi|324987084|gb|EGC19067.1| malonyl-CoA-[acyl-carrier-protein] transacylase [Prevotella
           multiformis DSM 16608]
 gi|325483149|gb|EGC86129.1| [acyl-carrier-protein] S-malonyltransferase [Prevotella denticola
           CRIS 18C-A]
 gi|326946151|gb|AEA22036.1| [acyl-carrier-protein] S-malonyltransferase [Prevotella denticola
           F0289]
          Length = 295

 Score =  185 bits (469), Expect = 8e-45,   Method: Composition-based stats.
 Identities = 96/301 (31%), Positives = 147/301 (48%), Gaps = 7/301 (2%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M     FPGQGSQ +GMG++LY+S P A+ +F++ D  L   ++ +M+ G+ E+L  T  
Sbjct: 1   MK-AFVFPGQGSQFVGMGKELYESNPLAKELFDKADEILGFKITGIMFAGTDEQLKETKV 59

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIR-LVRAR 119
            QPA+   S+     +             VAGHSLGE++AL AA A S  D ++ +    
Sbjct: 60  TQPAVFLHSVISALCL-----GDAFKPDMVAGHSLGEFSALVAAGALSFEDGLKLVAARA 114

Query: 120 GKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVK 179
               +            I   D+ V +     +    +C  AN N  GQ+VISG ++ ++
Sbjct: 115 NAMQKACEKNPGTMAAIIGLPDEKVEEVCATVSKEGKVCVAANFNCPGQLVISGSKEGIE 174

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            A +     GAKRA+ L V   FHS LM P    ++  +++     P  P+  N  A P 
Sbjct: 175 EACELLKAAGAKRALPLKVGGAFHSPLMQPAKDELQAAIEATEFNTPKCPVYQNVDALPH 234

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
           +   EI + L+ Q+T  VRW ++ Q     G     E G GK L G+  RID++++A  I
Sbjct: 235 TDPAEIRKNLIAQLTSSVRWTKSAQNMIADGADEFIECGPGKALQGMLARIDRNVNAHGI 294

Query: 300 S 300
            
Sbjct: 295 D 295


>gi|302346652|ref|YP_003814950.1| [acyl-carrier-protein] S-malonyltransferase [Prevotella
           melaninogenica ATCC 25845]
 gi|302150926|gb|ADK97187.1| [acyl-carrier-protein] S-malonyltransferase [Prevotella
           melaninogenica ATCC 25845]
          Length = 294

 Score =  185 bits (469), Expect = 8e-45,   Method: Composition-based stats.
 Identities = 97/300 (32%), Positives = 148/300 (49%), Gaps = 7/300 (2%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M     FPGQGSQ +GMG+DLYD+ P A+ +F++ D  L   ++++M+ G+ E+L  T  
Sbjct: 1   MK-AFVFPGQGSQFVGMGKDLYDNNPLAKELFDKADEILGFKITEIMFAGTDEQLKETKV 59

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIR-LVRAR 119
            QPA+   S+     +       +     VAGHSLGE++AL AA A S  D ++ +    
Sbjct: 60  TQPAVFLHSVISALCL-----GDEFKPDMVAGHSLGEFSALVAAGALSFEDGLKLVAARA 114

Query: 120 GKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVK 179
               +            I   D+ V +   + +    +C  AN N  GQ+VISG  + + 
Sbjct: 115 NAMQKACEQNPGTMAAIIGLADEKVEEICASVSKEGKVCVAANFNCPGQLVISGSIEGIN 174

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            A +     GAKRA+ L V   FHS LM P    ++  +++ T   P  P+  N  A P 
Sbjct: 175 EACELMKAAGAKRALPLKVGGAFHSPLMQPAKDELQAAIEATTFNAPKCPVYQNVDALPH 234

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
           +   EI + L+ Q+T  VRW ++ Q     G     E G G  L G+  RIDK+++A  +
Sbjct: 235 TDPAEIQKNLIAQLTSSVRWTKSAQNMIADGATEFVECGPGAALQGMLGRIDKTVNAHGV 294


>gi|228992580|ref|ZP_04152507.1| Malonyl CoA-acyl carrier protein transacylase [Bacillus
           pseudomycoides DSM 12442]
 gi|228998628|ref|ZP_04158215.1| Malonyl CoA-acyl carrier protein transacylase [Bacillus mycoides
           Rock3-17]
 gi|228761096|gb|EEM10055.1| Malonyl CoA-acyl carrier protein transacylase [Bacillus mycoides
           Rock3-17]
 gi|228767214|gb|EEM15850.1| Malonyl CoA-acyl carrier protein transacylase [Bacillus
           pseudomycoides DSM 12442]
          Length = 316

 Score =  185 bits (469), Expect = 8e-45,   Method: Composition-based stats.
 Identities = 124/314 (39%), Positives = 181/314 (57%), Gaps = 5/314 (1%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
                FPGQGSQ +GMG+ L  +  E   +F++ D  L ++LS L++ G QE+LT T NA
Sbjct: 3   KLAFLFPGQGSQAVGMGQQLAGNNKEVAKIFQKADEVLQESLSSLIFEGPQEKLTLTTNA 62

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPAL   S+A +  +++  +       YVAGHSLGEY+AL AA A +  D +  VR RG+
Sbjct: 63  QPALLTTSIAILTALKQYDIT----PDYVAGHSLGEYSALVAAGALTFEDAVYAVRKRGE 118

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQAS-RVGICEIANDNGGGQVVISGLQDAVKC 180
            M+EAVP G G+M AI+G D  V+  +  + +      +IAN N   Q+VISG +  V+ 
Sbjct: 119 YMEEAVPSGEGAMAAILGADPDVLKQVTEEVTSEGHAVQIANMNSTKQIVISGTKRGVEL 178

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A+      GAKRA+ L VS PFHSSLM P ++  + +L+ +T QD  +P++ N  A+ V+
Sbjct: 179 ASQKVKENGAKRAIPLRVSGPFHSSLMKPAAEKFQNVLNEITIQDANIPVVANVTANCVN 238

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
             ++I   L+EQ+   V W  +I+     GV +  E+G GKVL GL K I  S    +I 
Sbjct: 239 RSEDIQEKLIEQLYSPVLWYPSIEQMVEQGVDTFIEIGPGKVLAGLMKSIAPSAKVYAIY 298

Query: 301 KVEDIDLALRSIVG 314
             E +   + S+ G
Sbjct: 299 DEETLKDTISSLRG 312


>gi|160888286|ref|ZP_02069289.1| hypothetical protein BACUNI_00696 [Bacteroides uniformis ATCC 8492]
 gi|270296801|ref|ZP_06203000.1| malonyl CoA-acyl carrier protein transacylase [Bacteroides sp. D20]
 gi|317480163|ref|ZP_07939273.1| malonyl CoA-acyl carrier protein transacylase [Bacteroides sp.
           4_1_36]
 gi|156862232|gb|EDO55663.1| hypothetical protein BACUNI_00696 [Bacteroides uniformis ATCC 8492]
 gi|270272788|gb|EFA18651.1| malonyl CoA-acyl carrier protein transacylase [Bacteroides sp. D20]
 gi|316903710|gb|EFV25554.1| malonyl CoA-acyl carrier protein transacylase [Bacteroides sp.
           4_1_36]
          Length = 295

 Score =  185 bits (469), Expect = 8e-45,   Method: Composition-based stats.
 Identities = 97/300 (32%), Positives = 145/300 (48%), Gaps = 7/300 (2%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M     FPGQG+Q +GMG+DLY++   A+ +FE+ +  L   ++D+M+NG+ E+L  T  
Sbjct: 1   MK-AFVFPGQGAQFVGMGKDLYENSALAKELFEKANDILGYRITDIMFNGTDEDLRQTKV 59

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVR-AR 119
            QP     ++    V+    +         AGHSLGE++AL AA A S  D ++LV    
Sbjct: 60  TQP-----AVFLHSVISALCMGDDFKPEMTAGHSLGEFSALVAAGALSFEDGLKLVYARA 114

Query: 120 GKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVK 179
               +            I   D+ V +     ++   +C  AN N  GQ+VISG  + + 
Sbjct: 115 MAMQKACEAQPSTMAAIIALPDEKVEEICAQVSAEGEVCVAANYNCPGQIVISGSIEGIN 174

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            A +     GAKRA+ L V   FHS LM P    ++  +++     P  P+  N  A P 
Sbjct: 175 KACELMKAAGAKRALPLKVGGAFHSPLMNPAKVELEAAINATEIHAPKCPVYQNVDAMPH 234

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
           +   EI + LV Q+T  VRW +T++     G     E G G VL GL K+I    +A  I
Sbjct: 235 TDPVEIKKNLVAQLTASVRWTQTVKNMVADGATDFTECGPGAVLQGLIKKIAPEATAHGI 294


>gi|260854575|ref|YP_003228466.1| malonyl-CoA-[acyl-carrier-protein] transacylase FabD [Escherichia
           coli O26:H11 str. 11368]
 gi|257753224|dbj|BAI24726.1| malonyl-CoA-[acyl-carrier-protein] transacylase FabD [Escherichia
           coli O26:H11 str. 11368]
 gi|323156900|gb|EFZ43034.1| malonyl CoA-acyl carrier protein transacylase [Escherichia coli
           EPECa14]
          Length = 309

 Score =  185 bits (469), Expect = 8e-45,   Method: Composition-based stats.
 Identities = 127/311 (40%), Positives = 175/311 (56%), Gaps = 4/311 (1%)

Query: 1   MS-TVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATC 59
           M+     FPGQGSQ +GM  D+  S+P     F E    L  +L  L   G  EEL  T 
Sbjct: 1   MTQFAFVFPGQGSQTVGMLADMAASYPIVEETFAEASAALGYDLWALTQQGPAEELNKTW 60

Query: 60  NAQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRAR 119
             QPAL   S+A  RV ++ G       + +AGHSLGEY+AL  A   + +D +RLV  R
Sbjct: 61  QTQPALLIASVALYRVWQQQGGKA---PAMMAGHSLGEYSALVCAGVINFADAVRLVEMR 117

Query: 120 GKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVK 179
           GK MQEAVP G G+M AIIGLDD  +   C +A+   +    N N  GQVVI+G ++AV+
Sbjct: 118 GKFMQEAVPEGTGAMAAIIGLDDASIAKACEEAAEGQVVSPVNFNSPGQVVIAGHKEAVE 177

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            A   C   GAKRA+ LPVS P H +LM P +  +   L  +T   P V ++ N      
Sbjct: 178 RAGAACKAAGAKRALPLPVSVPSHCALMKPAADKLAVELAKITFNAPTVSVVNNVDVKCE 237

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
           ++ D I   LV Q+   V+W +++++ A  GV+ +YEVG GKVLTGL KRI  +L+A ++
Sbjct: 238 TNGDAIRDALVRQLYNPVQWTKSVEYMAAQGVEHLYEVGPGKVLTGLTKRIVDTLTASAL 297

Query: 300 SKVEDIDLALR 310
           ++   +  AL 
Sbjct: 298 NEPSAMAAALE 308


>gi|269926749|ref|YP_003323372.1| malonyl CoA-acyl carrier protein transacylase [Thermobaculum
           terrenum ATCC BAA-798]
 gi|269790409|gb|ACZ42550.1| malonyl CoA-acyl carrier protein transacylase [Thermobaculum
           terrenum ATCC BAA-798]
          Length = 309

 Score =  185 bits (469), Expect = 8e-45,   Method: Composition-based stats.
 Identities = 109/311 (35%), Positives = 175/311 (56%), Gaps = 12/311 (3%)

Query: 4   VLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQP 63
              FPGQGSQ +GMG DLY ++PE R +++E D  L  +L  L + G  +ELT T NAQP
Sbjct: 9   AFLFPGQGSQYVGMGLDLYKAYPEVRRIWQEADDILGFSLRSLAFEGPADELTQTENAQP 68

Query: 64  ALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSM 123
           A+   S    R++    L +  + S++AGHSLGEY+AL  A + + +D +RLVR RG+ M
Sbjct: 69  AILVSSYVMYRILSD--LNLIENPSFLAGHSLGEYSALLIAGSLTFADAVRLVRTRGEIM 126

Query: 124 QEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAAD 183
                   G M A+I +D+  +     + ++    ++AN N   Q+VISG  +A+    +
Sbjct: 127 ARYGRITAGKMAAVIAMDEDKLS----EIAKEYGVDVANYNSPDQLVISGPAEAIDKLVE 182

Query: 184 TCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSID 243
              + GA+R + LPVS  FHS LM P +K     +DSV    P VP++ N  A  + +++
Sbjct: 183 ILPSLGARRVIPLPVSGAFHSYLMKPAAKEFAPHIDSVDLSAPQVPVVANSTAELLLTVE 242

Query: 244 EISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVE 303
           ++   L  Q++  V W ++I     +GV+   E+G G+VLTGL ++I +   A++     
Sbjct: 243 DVRSELKRQLSSPVIWHKSITRIWENGVRKFVEIGPGRVLTGLNRKIIREAEAIA----- 297

Query: 304 DIDLALRSIVG 314
             +  ++S++G
Sbjct: 298 -SEDLIKSVLG 307


>gi|254420563|ref|ZP_05034287.1| malonyl CoA-acyl carrier protein transacylase [Brevundimonas sp.
           BAL3]
 gi|196186740|gb|EDX81716.1| malonyl CoA-acyl carrier protein transacylase [Brevundimonas sp.
           BAL3]
          Length = 320

 Score =  185 bits (469), Expect = 8e-45,   Method: Composition-based stats.
 Identities = 149/321 (46%), Positives = 195/321 (60%), Gaps = 9/321 (2%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M+  L FPGQGSQ +GMG  L D+F  AR VF EVD  L Q LS LM  G +++LT T N
Sbjct: 1   MTLALLFPGQGSQAVGMGAQLADAFASAREVFAEVDEALGQKLSVLMREGPEDQLTLTEN 60

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
           AQPAL AVS+A IR ++          +YVAGHSLGEY+AL AA A SLSDT RL++ RG
Sbjct: 61  AQPALMAVSVAAIRALKVEFGFDVATAAYVAGHSLGEYSALAAAGAISLSDTARLLKLRG 120

Query: 121 KSMQEAVPPGL--GSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAV 178
           ++MQ AVP G    + +     D  + ++  A  + +G+C +ANDN  G +VISG + AV
Sbjct: 121 QAMQRAVPVGQGAMASLIGPKTDLALAEAAAAAGAELGVCVVANDNNAGNIVISGEKAAV 180

Query: 179 KCAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASP 238
             A +     GA+    L VSAPFH  LM P +  M   L S T   PVVP++ N  A P
Sbjct: 181 DRAIEKAKELGARAI-PLNVSAPFHCPLMQPAADEMAAALASATILAPVVPVVANVLARP 239

Query: 239 VSSIDEISRLLVEQVTGRVRWRETIQWFA------NHGVKSVYEVGSGKVLTGLAKRIDK 292
            S  + I RLLVEQVTGRVRWRE+++W A        GV    E+GSGKVLTG+AKRI  
Sbjct: 240 ESDPEVIRRLLVEQVTGRVRWRESMEWMATPDSQDGGGVTRFVEIGSGKVLTGMAKRIAP 299

Query: 293 SLSAVSISKVEDIDLALRSIV 313
               + ++  E+++   +++V
Sbjct: 300 DAECLPLNTPEELEAFAKALV 320


>gi|52425928|ref|YP_089065.1| acyl carrier protein S-malonyltransferase [Mannheimia
           succiniciproducens MBEL55E]
 gi|52307980|gb|AAU38480.1| FabD protein [Mannheimia succiniciproducens MBEL55E]
          Length = 312

 Score =  185 bits (469), Expect = 8e-45,   Method: Composition-based stats.
 Identities = 117/312 (37%), Positives = 171/312 (54%), Gaps = 2/312 (0%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
              + FPGQGSQ +GM  +L + FP  +  F++    L  +L  L+  G  EEL  T   
Sbjct: 3   KFAMVFPGQGSQSVGMLAELAEQFPVVQETFKQASEVLGYDLWQLVQQGPAEELNKTWQT 62

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPAL A S+A  R+ ++     +     +AGHSLGEY+AL  A      D I+LV  RGK
Sbjct: 63  QPALLAASVAIYRIWQQ--QYPELKPEVMAGHSLGEYSALVCAGVIDFQDAIKLVELRGK 120

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCA 181
            MQ+AVP G G+M AIIGLD+  + + C  A +  +    N N  GQVVI+G + AV+ A
Sbjct: 121 LMQQAVPEGTGAMYAIIGLDNESIINACKAAEQGEVVSAVNFNSPGQVVIAGSKAAVERA 180

Query: 182 ADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSS 241
           A  C   GAKRA+ L VS P H +LM P +  +   L+S++ + P + ++ N      + 
Sbjct: 181 AAACKEAGAKRALPLAVSVPSHCALMKPAADQLAVSLESISFKAPEIAVINNVDVKAEND 240

Query: 242 IDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISK 301
            + I   LV Q+   VRW E ++  A + ++ + E+G GKVLTGL  RI K LSA  ++ 
Sbjct: 241 AEAIRTALVRQLYSPVRWTEIVERMAKNNIEVLLEMGPGKVLTGLTGRIVKELSAQQVND 300

Query: 302 VEDIDLALRSIV 313
            + ++     + 
Sbjct: 301 AKSLETVKEILA 312


>gi|301051123|ref|ZP_07197955.1| malonyl CoA-acyl carrier protein transacylase [Escherichia coli MS
           185-1]
 gi|300297222|gb|EFJ53607.1| malonyl CoA-acyl carrier protein transacylase [Escherichia coli MS
           185-1]
          Length = 309

 Score =  185 bits (469), Expect = 8e-45,   Method: Composition-based stats.
 Identities = 127/311 (40%), Positives = 174/311 (55%), Gaps = 4/311 (1%)

Query: 1   MS-TVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATC 59
           M+     FPGQGSQ +GM  D+  S+P     F E    L  +L  L   G  EEL  T 
Sbjct: 1   MTQFAFVFPGQGSQTVGMLADMAASYPIVEETFAEASAALGYDLWALTQQGPAEELNKTW 60

Query: 60  NAQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRAR 119
             QPAL   S+A  RV ++ G       + +AGHSLGEY+AL  A     +D +RLV  R
Sbjct: 61  QTQPALLTASVALYRVWQQQGGKA---PAMMAGHSLGEYSALVCAGVIDFADAVRLVEMR 117

Query: 120 GKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVK 179
           GK MQEAVP G G+M AIIGL D  +   C +A+   +    N N  GQVVI+G ++AV+
Sbjct: 118 GKFMQEAVPEGTGAMAAIIGLGDASIAKACEEAAEGQVVSPVNFNSPGQVVIAGHKEAVE 177

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            A   C   GAKRA+ LPVS P H +LM P +  +   L  +T   P VP++ N      
Sbjct: 178 RAGAACKAAGAKRALPLPVSVPSHCALMKPAADKLAVELAKITFNAPTVPVVNNVDVKCE 237

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
           ++ D I   LV Q+   V+W +++++ A  GV+ +YEVG GKVLTGL KRI  +L+A ++
Sbjct: 238 TNGDAIRDALVRQLYNPVQWTKSVEYMAAQGVEHLYEVGPGKVLTGLTKRIVDTLTASAL 297

Query: 300 SKVEDIDLALR 310
           ++   +  AL 
Sbjct: 298 NEPSAMAAALE 308


>gi|254294298|ref|YP_003060321.1| malonyl CoA-acyl carrier protein transacylase [Hirschia baltica
           ATCC 49814]
 gi|254042829|gb|ACT59624.1| malonyl CoA-acyl carrier protein transacylase [Hirschia baltica
           ATCC 49814]
          Length = 319

 Score =  185 bits (469), Expect = 8e-45,   Method: Composition-based stats.
 Identities = 143/312 (45%), Positives = 198/312 (63%), Gaps = 3/312 (0%)

Query: 4   VLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQP 63
              FPGQG+Q +GMG++L ++FP A+ VF+EVD  L +N SDL+WNGS+E+LT T N QP
Sbjct: 5   AFIFPGQGAQSVGMGQELANTFPAAKAVFDEVDSALGENFSDLIWNGSEEQLTMTANTQP 64

Query: 64  ALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSM 123
           AL AVS+A +R +E        D  +VAGHSLGEY+AL A  A  L+D  +L+R RG++M
Sbjct: 65  ALMAVSIAVMRTLENEFNVKPADAKFVAGHSLGEYSALAAVGAIKLADAAKLLRLRGEAM 124

Query: 124 QEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAAD 183
           QEAV PG G+M A++G D    +++     + G C+IANDN  GQ+VISG + A+  A  
Sbjct: 125 QEAVAPGEGAMAALLGADQAQAEAMIEIGRKHGACDIANDNAPGQIVISGSKAAIDAACA 184

Query: 184 TCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSID 243
              + G K+AV L VSAPFH SLM P    M+  L       P+ P++ N  A P    +
Sbjct: 185 AAGDLGIKKAVPLAVSAPFHCSLMQPAQDKMQAALSETKIIAPMAPLVANVTARPTEDPE 244

Query: 244 EISRLLVEQVTGRVRWRETIQWFA-NHG--VKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
            I + LVEQVTGRVRWRE+++W A   G  +    E G+GKVLT + KRI +SL  V+++
Sbjct: 245 AIRKQLVEQVTGRVRWRESVEWMASEDGGALDLTVEAGAGKVLTTMNKRIARSLKGVALN 304

Query: 301 KVEDIDLALRSI 312
              D++   +S+
Sbjct: 305 APADLEAFAKSL 316


>gi|293604003|ref|ZP_06686416.1| malonyl-CoA-[acyl-carrier-protein] transacylase [Achromobacter
           piechaudii ATCC 43553]
 gi|292817607|gb|EFF76675.1| malonyl-CoA-[acyl-carrier-protein] transacylase [Achromobacter
           piechaudii ATCC 43553]
          Length = 311

 Score =  185 bits (469), Expect = 8e-45,   Method: Composition-based stats.
 Identities = 126/314 (40%), Positives = 167/314 (53%), Gaps = 4/314 (1%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M     FPGQGSQ +GM  D +                L Q+L  L+ +G  E+L  T N
Sbjct: 1   MKIAFVFPGQGSQAVGML-DAWSGVAAVTDTVARASEA