RPSBLAST alignment for GI: 254780536 and conserved domain: COG3321

>gnl|CDD|33130 COG3321, COG3321, Polyketide synthase modules and related proteins [Secondary metabolites biosynthesis, transport, and catabolism]. Length = 1061
 Score =  132 bits (334), Expect = 1e-31
 Identities = 95/312 (30%), Positives = 138/312 (44%), Gaps = 13/312 (4%)

Query: 3   TVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQN----LSDLMWNGSQEELTAT 58
           TV  FPGQGSQ  GMGR+LY   P     F+ ++  L++     L ++++      L + 
Sbjct: 527 TVFVFPGQGSQWAGMGRELYALEPVFASAFDALEALLHRLLGFSLPEVIFAPDYPFLESI 586

Query: 59  CNAQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRA 118
             AQPAL AVS+A   +    G  V      V GHSLGE  A  AA   SL D +R+V  
Sbjct: 587 DFAQPALFAVSVALAALWRSWG--VIPG--AVIGHSLGELAAAVAAGVLSLEDALRVVAT 642

Query: 119 RGKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAV 178
           RG+ MQ+    G G+M+A+  L             R  +  +A  N   QVVI+G  +A+
Sbjct: 643 RGRLMQQL--AGEGAMLAVE-LSLLAEVQELLALGRPQVP-LAAVNSPQQVVIAGDPEAI 698

Query: 179 KCAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASP 238
                    +G  RA  L VS  FHS LM P+       L  +  + P +P++ N     
Sbjct: 699 AALIARLQAQG-VRARRLAVSHAFHSPLMDPILDEFAAALADLAPRPPQIPLISNVTGDL 757

Query: 239 VSSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVS 298
                  ++  V+ +   VR+ + I      G ++  EVG G VLT   K+  +      
Sbjct: 758 AGEPGGDAQYWVQHLRQPVRFADAIAAALADGARTFIEVGPGPVLTESIKQTLRDAILSI 817

Query: 299 ISKVEDIDLALR 310
            +   D    L 
Sbjct: 818 ATLRRDAPELLS 829