RPSBLAST alignment for GI: 254780536 and conserved domain: KOG2926

>gnl|CDD|38137 KOG2926, KOG2926, KOG2926, Malonyl-CoA:ACP transacylase [Lipid transport and metabolism]. Length = 386
 Score =  194 bits (493), Expect = 4e-50
 Identities = 102/302 (33%), Positives = 156/302 (51%), Gaps = 10/302 (3%)

Query: 3   TVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQ 62
           +V+ FPGQG+Q +GMG+ L    P AR +F E  + L  +L  +  NG +E+L  T  AQ
Sbjct: 64  SVILFPGQGAQSVGMGQYLLQ-NPAARRLFAEASNVLGYDLLKICVNGPKEKLDRTVIAQ 122

Query: 63  PALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKS 122
           PA+   S+A +  +   G  +  ++   AG SLGEY AL  A A S S  ++LV+AR ++
Sbjct: 123 PAIDVSSLAALEQLRLLGPSIIENLVVTAGFSLGEYAALVFAGALSFSSALKLVKARAEA 182

Query: 123 MQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVG------ICEIANDNGGGQVVISGLQD 176
           M EA       MV I+GL    V   CA A+++       +CE+AN    GQ V+SGL  
Sbjct: 183 MSEASELVASGMVMILGLPTSKVQKACASANQLSASQEYPVCEVANYLSPGQRVVSGLVK 242

Query: 177 AVKCAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCA 236
           A++   +   +   +R   L VS  FH+ LM P  + +   L +V  ++PV+P++ N   
Sbjct: 243 ALESLEENAKSFKIRRMKRLAVSGAFHTRLMEPAVEPLTKALKAVEIKNPVIPVISNVDG 302

Query: 237 SPVSSIDEISRLLVEQVTGRVRWRETIQWF---ANHGVKSVYEVGSGKVLTGLAKRIDKS 293
            P      I + L +Q+   V+W +T++        G    YEVG G+VL  + KR +  
Sbjct: 303 KPYRDPGHILKQLAKQIVRPVQWEQTLKTIYSKQGVGFPRSYEVGPGRVLVAILKRNNPQ 362

Query: 294 LS 295
             
Sbjct: 363 AD 364