RPSBLAST alignment of GI: 254780536 and MMDB domain: 2cuy_A_1-123_194-305

>2cuy_A (A:1-123,A:194-305) Malonyl COA-[acyl carrier protein] transacylase; transferase, structural genomics, NPPSFA; 2.10A {Thermus thermophilus HB8}Length = 235
 Score =  111 bits (278), Expect = 1e-25
 Identities = 58/125 (46%), Positives = 70/125 (56%), Gaps = 4/125 (3%)

Query: 4   VLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQP 63
              FPGQGS  +GMGR LY++ P A+ V +  +      L  LMW G +E LT T N QP
Sbjct: 3   AALFPGQGSHRVGMGRALYEASPAAKEVLDRAEA-ALPGLLKLMWEGPEEALTLTENQQP 61

Query: 64  ALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSM 123
           AL A   A  R   + G       +  AGHSLGE+TA  AA    L D +RLVR RG+ M
Sbjct: 62  ALLAAGYAAYRAFLEAGGK---PPALAAGHSLGEWTAHVAAGTLELEDALRLVRLRGRYM 118

Query: 124 QEAVP 128
           QEAVP
Sbjct: 119 QEAVP 123