RPSBLAST alignment of GI: 254780536 and MMDB domain: 2hg4_A_550-674_746-852

>2hg4_A (A:550-674,A:746-852) DEBS, 6-deoxyerythronolide B synthase; ketosynthase, acyltransferase, module 5; 2.73A {Saccharopolyspora erythraea}Length = 232
 Score =  112 bits (280), Expect = 9e-26
 Identities = 35/128 (27%), Positives = 51/128 (39%), Gaps = 6/128 (4%)

Query: 3   TVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNL--SDLMWNGSQEELTATCN 60
               FPGQG+Q  G  RDL            + +  L  ++  S          L     
Sbjct: 4   VAXVFPGQGAQWQGXARDLLRESQVFADSIRDCERALAPHVDWSLTDLLSGARPLDRVDV 63

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
            QPAL AV ++   +   +G+      + V GHS GE  A   A A +L D  +LV  R 
Sbjct: 64  VQPALFAVXVSLAALWRSHGVEP----AAVVGHSQGEIAAAHVAGALTLEDAAKLVAVRS 119

Query: 121 KSMQEAVP 128
           + ++   P
Sbjct: 120 RVLRRLSP 127