RPSBLAST alignment of GI: 254780536 and MMDB domain: 2pff_B_334-428

>2pff_B (B:334-428) Fatty acid synthase subunit beta; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl reductase, beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae}Length = 95
 Score = 74.2 bits (182), Expect = 2e-14
 Identities = 16/83 (19%), Positives = 25/83 (30%), Gaps = 6/83 (7%)

Query: 132 GSMVAIIGLDDCVVDSICAQASRV----GICEIANDNGGGQVVISGLQDAVKCAADTCLN 187
             M++I  L    V     + +         EI+  NG   +V+SG   ++     T   
Sbjct: 3   SPMLSISNLTQEQVQDYVNKTNSHLPAGKQVEISLVNGAKNLVVSGPPQSLYGLNLTLRK 62

Query: 188 KGAKRAVFLPVSAPFHSSLMTPV 210
             A     L  S    S      
Sbjct: 63  AKAPSG--LDQSRIPFSERKLKF 83