RPSBLAST alignment of GI: 254780536 and MMDB domain: 2uva_G_135-311_423-557

>2uva_G (G:135-311,G:423-557) Fatty acid synthase beta subunits; fungal, dehydratase, enoyl reductase, ketoacyl synthase, ketoacyl reductase; HET: FMN; 3.10A {Thermomyces lanuginosus} PDB: 2uvc_G*Length = 312
 Score =  108 bits (271), Expect = 9e-25
 Identities = 21/162 (12%), Positives = 41/162 (25%), Gaps = 28/162 (17%)

Query: 2   STVLTFPGQGSQV--IGMGRDLYDSFPE-ARLVFEEVDHTLNQNL--------------- 43
                F GQG+        R++Y ++P     +   +   L                   
Sbjct: 16  KIYSIFGGQGNIEEYFDELREIYTTYPSFVEDLITSIAELLQSLAREWDAVKQYPKGLDI 75

Query: 44  ----SDLMWNGSQEELTATCNAQPALTAVSMAFIRVMEKN----GLCVKRDISYVAGHSL 95
                +       + L +   + P +  V +A   +  K        +    S   GHS 
Sbjct: 76  LQWLHNPESQPDTDYLVSAPVSFPLIGLVQLAHYMITCKTLGREPGELLERFSGTTGHSQ 135

Query: 96  GEYTALCAAKAFSLSDTIRLVRARGKSMQEAVPPGLGSMVAI 137
           G   A   A A +  +     +   + +              
Sbjct: 136 GIVVAAAIATARTWDEFATAAKRAVELLFWIGLR--SQQAYP 175