RPSBLAST alignment of GI: 254780536 and MMDB domain: 3ezo_A_133-206

>3ezo_A (A:133-206) Malonyl COA-acyl carrier protein transacylase; ssgcid, acyl-carrier-protein S-malonyltransferase, acyltransferase, transferase; 2.05A {Burkholderia pseudomallei 1710B}Length = 74
 Score = 76.0 bits (187), Expect = 6e-15
 Identities = 37/73 (50%), Positives = 49/73 (67%)

Query: 130 GLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAADTCLNKG 189
           G+G M AI+GLDD  V ++CA+AS  G+ E  N N   QVVI+G +  ++ A +    KG
Sbjct: 2   GVGGMAAILGLDDDTVRAVCAEASATGVVEAVNFNAPAQVVIAGTKAGIEKACEIAKEKG 61

Query: 190 AKRAVFLPVSAPF 202
           AKRA+ LPVSAPF
Sbjct: 62  AKRALPLPVSAPF 74