RPSBLAST alignment of GI: 254780536 and MMDB domain: 3g87_A_1-124_196-394

>3g87_A (A:1-124,A:196-394) Malonyl COA-acyl carrier protein transacylase; ssgcid, niaid, decode biostructures, dried seaweed, acyltransferase, transferase; 2.30A {Burkholderia pseudomallei 1710B}Length = 323
 Score =  119 bits (300), Expect = 3e-28
 Identities = 42/126 (33%), Positives = 61/126 (48%), Gaps = 6/126 (4%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M     FPGQGSQ  GMG  L+D F +   +  + D  L  ++  L  +  ++EL  T  
Sbjct: 5   MLNTFMFPGQGSQAKGMGGALFDRFAD---LTAQADAVLGYSIRALCVDDPRDELGRTQF 61

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
            QPAL  V+        ++         ++AGHSLGE+ AL AA  F     ++LV  R 
Sbjct: 62  TQPALYVVNALTYYAKCEDSGET---PDFLAGHSLGEFNALLAAGCFDFETGLKLVARRA 118

Query: 121 KSMQEA 126
           + M +A
Sbjct: 119 ELMSQA 124