RPS-BLAST 2.2.22 [Sep-27-2009]

Database: mmdb70 
           33,805 sequences; 4,956,049 total letters

Searching..................................................done

Query= gi|254780536|ref|YP_003064949.1| acyl-carrier-protein
S-malonyltransferase [Candidatus Liberibacter asiaticus str. psy62]
         (314 letters)



>2pff_B Fatty acid synthase subunit beta; fatty acid synthase,
           acyl-carrier-protein, beta-ketoacyl reductase,
           beta-ketoacyl synthase, dehydratase; 4.00A
           {Saccharomyces cerevisiae} (B:144-317,B:429-553)
          Length = 299

 Score =  140 bits (354), Expect = 2e-34
 Identities = 46/343 (13%), Positives = 80/343 (23%), Gaps = 98/343 (28%)

Query: 3   TVLTFPGQGSQVIGMGRD---LYDSFPEARLVFEEVDHTLNQN----------------- 42
            V  F GQG+                     + +    TL++                  
Sbjct: 13  LVAIFGGQGNTDDYFEELRDLYQTYHVLVGDLIKFSAETLSELIRTTLDAEKVFTQGLNI 72

Query: 43  ---LSDLMWNGSQEELTATCNAQPALTAVSMAFIRVM-EKNGL---CVKRDISYVAGHSL 95
              L +      ++ L +   + P +  + +A   V  +  G     ++  +    GHS 
Sbjct: 73  LEWLENPSNTPDKDYLLSIPISCPLIGVIQLAHYVVTAKLLGFTPGELRSYLKGATGHSQ 132

Query: 96  GEYTALCAAKAFSLSDTIRLVRARGKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRV 155
           G  TA+  A+  S       VR     +                                
Sbjct: 133 GLVTAVAIAETDSWESFFVSVRKAITVLFFIGVR--CYEAY------------------P 172

Query: 156 GICEIANDNGGGQVVISGLQDAVKCAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMK 215
               +             L  A             K  V   VS       +        
Sbjct: 173 NTSHL-------------LVPASD--------LINKDLVKNNVSFNAKDIQIPVYD---- 207

Query: 216 WMLDSVTKQDPVVPILPNFCASPVSSIDE-ISRLLVEQVT-GRVRWRETIQWFANHGVKS 273
                             F  S +  +   IS  +V+ +    V+W  T Q+        
Sbjct: 208 -----------------TFDGSDLRVLSGSISERIVDCIIRLPVKWETTTQF----KATH 246

Query: 274 VYEVGSGKV--LTGLAKRIDKSLSAVSISKVEDIDLALRSIVG 314
           + + G G    L  L  R       V +     +D+      G
Sbjct: 247 ILDFGPGGASGLGVLTHRNKDGT-GVRVIVAGTLDINPDDDYG 288


>2qc3_A MCT, malonyl COA-acyl carrier protein transacylase;
           malonyl-COA:ACP transacylase, , nucleophilic attack;
           2.30A {Mycobacterium tuberculosis H37RV} PDB: 2qj3_A
           (A:1-128,A:196-303)
          Length = 236

 Score =  127 bits (320), Expect = 2e-30
 Identities = 37/128 (28%), Positives = 53/128 (41%), Gaps = 2/128 (1%)

Query: 3   TVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQ 62
             L  PGQGSQ  GM        P A           + +L+ L    S EE+T T  AQ
Sbjct: 3   IALLAPGQGSQTEGMLSPWLQ-LPGAADQIAAWSKAADLDLARLGTTASTEEITDTAVAQ 61

Query: 63  PALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKS 122
           P + A ++   + + +  + +      VAGHS+GE  A   A   +  D + L   RG  
Sbjct: 62  PLIVAATLLAHQELARRCV-LAGKDVIVAGHSVGEIAAYAIAGVIAADDAVALAATRGAE 120

Query: 123 MQEAVPPG 130
           M +A    
Sbjct: 121 MAKACATE 128



 Score = 97.4 bits (242), Expect = 2e-21
 Identities = 33/136 (24%), Positives = 50/136 (36%), Gaps = 8/136 (5%)

Query: 174 LQDAVKCAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPN 233
             DAV  AA         R   +  +    +  M P          ++   DP   +L N
Sbjct: 107 ADDAVALAA--------TRGAEMAKACATETEFMAPALDGFAAAAANIATADPTATLLSN 158

Query: 234 FCASPVSSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKS 293
               PV+S       LV Q+T  VRW         H V ++ E      L+G+AKR  + 
Sbjct: 159 RDGKPVTSAAAAMDTLVSQLTQPVRWDLCTATLREHTVTAIVEFPPAGTLSGIAKRELRG 218

Query: 294 LSAVSISKVEDIDLAL 309
           + A ++    D+D   
Sbjct: 219 VPARAVKSPADLDELA 234


>2uv8_G Fatty acid synthase subunit beta (FAS1); fatty acid
           biosynthesis, malonyl/palmitoyl transferase,
           phosphopantetheine, transferase; HET: GVL FMN; 3.10A
           {Saccharomyces cerevisiae} PDB: 2vkz_G* 3hmj_G*
           (G:1644-1697,G:1754-1829)
          Length = 130

 Score =  125 bits (315), Expect = 9e-30
 Identities = 48/133 (36%), Positives = 66/133 (49%), Gaps = 10/133 (7%)

Query: 3   TVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQ----NLSDLMWNGSQEELTAT 58
           T   F GQGSQ  GMG DLY +   A+ V+   D+        ++ D++ N     L+AT
Sbjct: 2   TTFVFTGQGSQEQGMGMDLYKTSKAAQDVWNRADNHFKDTYGFSILDIVIN---NPLSAT 58

Query: 59  CNAQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTAL-CAAKAFSLSDTIRLVR 117
              QPALT +  A    ++  G  +    +  AGHSLGEY AL   A   S+   + +V 
Sbjct: 59  QFTQPALTLMEKAAFEDLKSKG--LIPADATFAGHSLGEYAALASLADVMSIESLVEVVF 116

Query: 118 ARGKSMQEAVPPG 130
            RG +MQ AVP  
Sbjct: 117 YRGMTMQVAVPRD 129


>2uva_G Fatty acid synthase beta subunits; fungal, dehydratase,
           enoyl reductase, ketoacyl synthase, ketoacyl reductase;
           HET: FMN; 3.10A {Thermomyces lanuginosus} PDB: 2uvc_G*
           (G:1671-1724,G:1783-1852,G:1989-2020)
          Length = 156

 Score =  123 bits (311), Expect = 2e-29
 Identities = 47/131 (35%), Positives = 64/131 (48%), Gaps = 11/131 (8%)

Query: 3   TVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQ----NLSDLMWNGSQEELTAT 58
           T   F GQGSQ  GMG DLY + P A+ V++  D    +    ++ D++ N      +AT
Sbjct: 2   TAYVFTGQGSQEQGMGMDLYATSPVAKEVWDRADKHFRENYGFSIIDIVKNN----PSAT 57

Query: 59  CNAQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTAL-CAAKAFSLSDTIRLVR 117
              QPALT +  A    M   GL  +      AGHSLGEY+AL   A    +   + +V 
Sbjct: 58  QFTQPALTLMEKASFEDMRSKGLVQRDS--TFAGHSLGEYSALVALADVMPIESLVSVVF 115

Query: 118 ARGKSMQEAVP 128
            RG +MQ A  
Sbjct: 116 YRGLTMQVAST 126


>1nm2_A Malonyl COA:acyl carrier protein malonyltransferase;
           alpha/beta hydrolase-like core; 2.00A {Streptomyces
           coelicolor A3} (A:1-134,A:202-317)
          Length = 250

 Score =  122 bits (306), Expect = 8e-29
 Identities = 38/139 (27%), Positives = 51/139 (36%), Gaps = 6/139 (4%)

Query: 3   TVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQ 62
            VL  PGQG+Q  G   D     P A          +  +L+        +E+  T  AQ
Sbjct: 3   LVLVAPGQGAQTPGFLTDWLA-LPGAADRVAAWSDAIGLDLAHFGTKADADEIRDTSVAQ 61

Query: 63  PALTAVSMAFIRVMEKNGLCVKRDI-----SYVAGHSLGEYTALCAAKAFSLSDTIRLVR 117
           P L A  +     +                  VAGHS+GE TA   A     +  + LVR
Sbjct: 62  PLLVAAGILSAAALGTQTSVADATGPGFTPGAVAGHSVGEITAAVFAGVLDDTAALSLVR 121

Query: 118 ARGKSMQEAVPPGLGSMVA 136
            RG +M EA        +A
Sbjct: 122 RRGLAMAEAAAVTHTRHMA 140



 Score =  104 bits (260), Expect = 2e-23
 Identities = 37/140 (26%), Positives = 60/140 (42%), Gaps = 9/140 (6%)

Query: 174 LQDAVKCAADTCLNKGAKRAVFLPVSAP-FHSSLMTPVSKVMKWMLDSVTKQDPVVPILP 232
              A+            +R + +  +A   H+  M P    +     ++T  DP V  + 
Sbjct: 113 DTAALSLVR--------RRGLAMAEAAAVTHTRHMAPAVDKLAEAAKALTPADPKVTYVS 164

Query: 233 NFCASPVSSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDK 292
           N     V+S  E+   LV QV   VRW   ++ F   GV ++ EV  G  LTGLAKR   
Sbjct: 165 NKDGRAVASGTEVLDRLVGQVANPVRWDLCMETFKELGVTAIIEVCPGGTLTGLAKRALP 224

Query: 293 SLSAVSISKVEDIDLALRSI 312
            +  +++   +D+D A   +
Sbjct: 225 GVKTLALKTPDDLDAARELV 244


>3g87_A Malonyl COA-acyl carrier protein transacylase; ssgcid,
           niaid, decode biostructures, dried seaweed,
           acyltransferase, transferase; 2.30A {Burkholderia
           pseudomallei 1710B} (A:1-124,A:196-394)
          Length = 323

 Score =  119 bits (300), Expect = 3e-28
 Identities = 42/126 (33%), Positives = 61/126 (48%), Gaps = 6/126 (4%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M     FPGQGSQ  GMG  L+D F +   +  + D  L  ++  L  +  ++EL  T  
Sbjct: 5   MLNTFMFPGQGSQAKGMGGALFDRFAD---LTAQADAVLGYSIRALCVDDPRDELGRTQF 61

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
            QPAL  V+        ++         ++AGHSLGE+ AL AA  F     ++LV  R 
Sbjct: 62  TQPALYVVNALTYYAKCEDSGET---PDFLAGHSLGEFNALLAAGCFDFETGLKLVARRA 118

Query: 121 KSMQEA 126
           + M +A
Sbjct: 119 ELMSQA 124



 Score = 71.8 bits (175), Expect = 1e-13
 Identities = 29/108 (26%), Positives = 45/108 (41%), Gaps = 6/108 (5%)

Query: 203 HSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSIDEISRLLVEQVTGRVRWRET 262
           HS  M P  +     L S    DP +P++ N  A P  +   +S  L +Q+   VRW E+
Sbjct: 125 HSKFMRPAQQAFAAHLQSFRLADPAIPVISNVSARPYEN-GRVSEGLAQQIASPVRWCES 183

Query: 263 IQWFANHGVKS-----VYEVGSGKVLTGLAKRIDKSLSAVSISKVEDI 305
           I++      +        E+G G VLT L   I +   A + +     
Sbjct: 184 IRYLLALAAERGEAIEFTELGHGDVLTRLVHTIRRQTPAPAAAATSAR 231


>3ezo_A Malonyl COA-acyl carrier protein transacylase; ssgcid,
           acyl-carrier-protein S-malonyltransferase,
           acyltransferase, transferase; 2.05A {Burkholderia
           pseudomallei 1710B} (A:1-132,A:207-318)
          Length = 244

 Score =  120 bits (301), Expect = 3e-28
 Identities = 52/128 (40%), Positives = 67/128 (52%), Gaps = 4/128 (3%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M     FPGQGSQ +GM     D     R   +E    L Q++  L+ +G  +EL  T N
Sbjct: 9   MKFAFVFPGQGSQSVGMLNAFAD-VAVVRETLDEASDALGQDIGKLIADGPADELNLTTN 67

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
            QP +   + A  R  ++ G       S VAGHSLGEYTAL AA A +  D + LVR R 
Sbjct: 68  TQPVMLTAAYACYRAWQQAGGA---QPSIVAGHSLGEYTALVAAGAIAFRDALPLVRFRA 124

Query: 121 KSMQEAVP 128
           ++MQ AVP
Sbjct: 125 QAMQTAVP 132



 Score =  101 bits (252), Expect = 2e-22
 Identities = 54/190 (28%), Positives = 77/190 (40%), Gaps = 12/190 (6%)

Query: 123 MQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAA 182
                P  L +  A          +  +  +   + E       G   I+  +DA+    
Sbjct: 65  TTNTQPVMLTAAYACYRAWQQAGGAQPSIVAGHSLGEYTALVAAG--AIA-FRDALPLVR 121

Query: 183 DTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSI 242
                    RA  +  + P HSSL+ P S  ++  L  V  + P + ++ N   + VS  
Sbjct: 122 --------FRAQAMQTAVP-HSSLLKPASDKLREYLAGVDVKAPKISVVNNIDVAVVSDP 172

Query: 243 DEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKV 302
             I   LV Q  G VRW E +Q  A  GV  V E G GKVL GL KRID +L   S+   
Sbjct: 173 AAIKDALVRQAAGPVRWVECVQHIAREGVTHVIECGPGKVLAGLTKRIDGNLVGASVFDP 232

Query: 303 EDIDLALRSI 312
             +D AL+  
Sbjct: 233 ASLDEALKLA 242


>2h1y_A Malonyl coenzyme A-acyl carrier protein transacylase; FABD,
           MCAT, transferase; 2.50A {Helicobacter pylori SS1}
           (A:1-139,A:273-321)
          Length = 188

 Score =  119 bits (298), Expect = 6e-28
 Identities = 42/128 (32%), Positives = 65/128 (50%), Gaps = 2/128 (1%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M   L FPGQGSQ IGMG+  Y+    A+ +FE   + L  ++   ++  + E L  +  
Sbjct: 13  MQYALLFPGQGSQCIGMGKSFYEGHTLAKELFERASNALKVDMKKTLFEEN-ELLKESAY 71

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
            QPA+  VS    +++ K      + + +  GHSLGE +A+  + A      ++L   RG
Sbjct: 72  TQPAIYLVSYIAYQLLNKQANGGLKPV-FALGHSLGEVSAVSLSGALDFEKALKLTHQRG 130

Query: 121 KSMQEAVP 128
           K MQEA  
Sbjct: 131 KMMQEACA 138



 Score = 31.6 bits (71), Expect = 0.14
 Identities = 14/45 (31%), Positives = 23/45 (51%), Gaps = 1/45 (2%)

Query: 268 NHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVEDIDLALRSI 312
           N  V   +E+G G VL GL KR+      +S+   + +D A+  +
Sbjct: 141 NDRVDIFFELGCGSVLKGLNKRLSN-KPTISVGDNKGLDEAIEFL 184


>3k89_A Malonyl COA-ACP transacylase; bacterial blight, XOO0880,
           FABD, xanthomonas oryzae PV. oryzae KACC10331; 1.60A
           {Xanthomonas oryzae PV} PDB: 3een_A (A:1-129,A:203-314)
          Length = 241

 Score =  118 bits (296), Expect = 1e-27
 Identities = 51/127 (40%), Positives = 63/127 (49%), Gaps = 3/127 (2%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
           +    FPGQGSQ +GM  +L +  P+ R  F E       +L  L   G +E L  T   
Sbjct: 5   TLAFVFPGQGSQSLGMLAELSELHPQIRETFAEASEGAGVDLWALSQGGPEEMLNRTEYT 64

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPAL A  +A  R+        +  +    GHSLGEYTAL AA   SL D   LVR RG+
Sbjct: 65  QPALLAAGVAVWRLWTAQR-GQRPALLA--GHSLGEYTALVAAGVLSLHDGAHLVRLRGQ 121

Query: 122 SMQEAVP 128
            MQ A P
Sbjct: 122 FMQAAAP 128



 Score = 99.4 bits (247), Expect = 5e-22
 Identities = 42/139 (30%), Positives = 64/139 (46%), Gaps = 8/139 (5%)

Query: 174 LQDAVKCAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPN 233
           L D               R  F+  +AP H+ LM   +  +   +  ++   P +P++ N
Sbjct: 109 LHDGAHLVR--------LRGQFMQAAAPAHTPLMRDAANQLGEAMAGLSWHAPQIPVVQN 160

Query: 234 FCASPVSSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKS 293
             A        I + LVEQ+   V+W   +Q  A+ G+  + E G GKVL+GL KRIDKS
Sbjct: 161 VDARVHDGSAAIRQALVEQLYLPVQWTGCVQALASQGITRIAECGPGKVLSGLIKRIDKS 220

Query: 294 LSAVSISKVEDIDLALRSI 312
           L A  ++   D   AL + 
Sbjct: 221 LDARPLATPADYAGALDAW 239


>2qo3_A Eryaii erythromycin polyketide synthase modules 3 and 4;
           ketosynthase, acyltransferase, phosphopantetheine; 2.59A
           {Saccharopolyspora erythraea} (A:531-660,A:730-836)
          Length = 237

 Score =  117 bits (293), Expect = 2e-27
 Identities = 37/132 (28%), Positives = 52/132 (39%), Gaps = 9/132 (6%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNG-----SQEELT 56
           + V  FPGQGSQ  GMG +L  S P         D ++       + +          L 
Sbjct: 3   NVVFLFPGQGSQWAGMGAELLSSSPVFAGKIRACDESMAPMQDWKVSDVLRQAPGAPGLD 62

Query: 57  ATCNAQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLV 116
                QP L AV ++   +    G     + + V GHS GE  A   A A +L D  +LV
Sbjct: 63  RVDVVQPVLFAVMVSLAELWRSYG----VEPAAVVGHSQGEIAAAHVAGALTLEDAAKLV 118

Query: 117 RARGKSMQEAVP 128
             R + M+    
Sbjct: 119 VGRSRLMRSLSG 130



 Score = 78.2 bits (192), Expect = 1e-15
 Identities = 11/95 (11%), Positives = 28/95 (29%)

Query: 204 SSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSIDEISRLLVEQVTGRVRWRETI 263
           S  +  V + +      +  +   V       +  +   +  +R     +   VR+ + +
Sbjct: 131 SPQIERVREELLETTGDIAPRPARVTFHSTVESRSMDGTELDARYWYRNLRETVRFADAV 190

Query: 264 QWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVS 298
              A  G  +  EV    V+    +   +      
Sbjct: 191 TRLAESGYDAFIEVSPHPVVVQAVEEAVEEADGAE 225


>2c2n_A Malonyl COA-acyl carrier protein transacylase;
           mitochondrial, malonyltrasferase, fatty acid synthase
           alternative splicing, lipid synthesis; HET: AE4; 1.55A
           {Homo sapiens} (A:1-152,A:235-339)
          Length = 257

 Score =  114 bits (285), Expect = 2e-26
 Identities = 46/127 (36%), Positives = 69/127 (54%), Gaps = 1/127 (0%)

Query: 3   TVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQ 62
           +VL FPGQGSQV+GMGR L + +P  R ++      L  +L +L  +G QE L  T + Q
Sbjct: 27  SVLLFPGQGSQVVGMGRGLLN-YPRVRELYAAARRVLGYDLLELSLHGPQETLDRTVHCQ 85

Query: 63  PALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKS 122
           PA+   S+A +  +      V  +    AG S+GE+ AL  A A   ++ +  V+ R ++
Sbjct: 86  PAIFVASLAAVEKLHHLQPSVIENCVAAAGFSVGEFAALVFAGAMEFAEGLYAVKIRAEA 145

Query: 123 MQEAVPP 129
           MQEA   
Sbjct: 146 MQEASEA 152



 Score = 81.3 bits (200), Expect = 1e-16
 Identities = 25/127 (19%), Positives = 45/127 (35%), Gaps = 13/127 (10%)

Query: 174 LQDAVKCAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPN 233
             + +             RA  +   A   + LM P  + +   L +V  + P+V +  N
Sbjct: 132 FAEGLYAVK--------IRAEAM-QEASEATRLMEPAVEPLTQALKAVDIKKPLVSVYSN 182

Query: 234 FCASPVSSIDEISRLLVEQVTGRVRWRETIQW----FANHGVKSVYEVGSGKVLTGLAKR 289
                      I +LL +Q+   V+W +T+          G    +EVG G+ L  + K 
Sbjct: 183 VHGHRYRHPGHIHKLLAQQLVSPVKWEQTMHAIYERKKGRGFPQTFEVGPGRQLGAILKS 242

Query: 290 IDKSLSA 296
            +     
Sbjct: 243 CNMQAWK 249


>2hg4_A DEBS, 6-deoxyerythronolide B synthase; ketosynthase,
           acyltransferase, module 5; 2.73A {Saccharopolyspora
           erythraea} (A:550-674,A:746-852)
          Length = 232

 Score =  112 bits (280), Expect = 9e-26
 Identities = 35/128 (27%), Positives = 51/128 (39%), Gaps = 6/128 (4%)

Query: 3   TVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNL--SDLMWNGSQEELTATCN 60
               FPGQG+Q  G  RDL            + +  L  ++  S          L     
Sbjct: 4   VAXVFPGQGAQWQGXARDLLRESQVFADSIRDCERALAPHVDWSLTDLLSGARPLDRVDV 63

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
            QPAL AV ++   +   +G+      + V GHS GE  A   A A +L D  +LV  R 
Sbjct: 64  VQPALFAVXVSLAALWRSHGVEP----AAVVGHSQGEIAAAHVAGALTLEDAAKLVAVRS 119

Query: 121 KSMQEAVP 128
           + ++   P
Sbjct: 120 RVLRRLSP 127



 Score = 78.6 bits (193), Expect = 9e-16
 Identities = 14/97 (14%), Positives = 32/97 (32%)

Query: 204 SSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSIDEISRLLVEQVTGRVRWRETI 263
           S  +  + + +   L  ++     V +       P+ +    +      +  +VR+++  
Sbjct: 126 SPQVESLREELLTELAGISPVSADVALYSTTTGQPIDTATXDTAYWYANLREQVRFQDAT 185

Query: 264 QWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
           +  A  G  +  EV    VLT   +    S       
Sbjct: 186 RQLAEAGFDAFVEVSPHPVLTVGIEATLDSALPADAG 222


>1mla_A Malonyl-coenzyme A acyl carrier protein transacylase;
           acyltransferase; 1.50A {Escherichia coli}
           (A:1-126,A:269-309)
          Length = 167

 Score =  111 bits (279), Expect = 1e-25
 Identities = 55/126 (43%), Positives = 66/126 (52%), Gaps = 3/126 (2%)

Query: 3   TVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQ 62
               FPGQGSQ +GM  D+  S+P     F E    L  +L  L   G  EEL  T   Q
Sbjct: 4   FAFVFPGQGSQTVGMLADMAASYPIVEETFAEASAALGYDLWALTQQGPAEELNKTWQTQ 63

Query: 63  PALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKS 122
           PAL   S+A  RV ++ G         +AGHSLGEY+AL  A     +D +RLV  RGK 
Sbjct: 64  PALLTASVALYRVWQQQGGKAPA---MMAGHSLGEYSALVCAGVIDFADAVRLVEMRGKF 120

Query: 123 MQEAVP 128
           MQEAVP
Sbjct: 121 MQEAVP 126



 Score = 54.3 bits (130), Expect = 2e-08
 Identities = 19/40 (47%), Positives = 28/40 (70%)

Query: 270 GVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVEDIDLAL 309
            V+ +YEVG GKVLTGL KRI  +L+A ++++   +  AL
Sbjct: 126 PVEHLYEVGPGKVLTGLTKRIVDTLTASALNEPSAMAAAL 165


>2cuy_A Malonyl COA-[acyl carrier protein] transacylase;
           transferase, structural genomics, NPPSFA; 2.10A {Thermus
           thermophilus HB8} (A:1-123,A:194-305)
          Length = 235

 Score =  111 bits (278), Expect = 1e-25
 Identities = 58/125 (46%), Positives = 70/125 (56%), Gaps = 4/125 (3%)

Query: 4   VLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQP 63
              FPGQGS  +GMGR LY++ P A+ V +  +      L  LMW G +E LT T N QP
Sbjct: 3   AALFPGQGSHRVGMGRALYEASPAAKEVLDRAEA-ALPGLLKLMWEGPEEALTLTENQQP 61

Query: 64  ALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSM 123
           AL A   A  R   + G       +  AGHSLGE+TA  AA    L D +RLVR RG+ M
Sbjct: 62  ALLAAGYAAYRAFLEAGGK---PPALAAGHSLGEWTAHVAAGTLELEDALRLVRLRGRYM 118

Query: 124 QEAVP 128
           QEAVP
Sbjct: 119 QEAVP 123



 Score = 97.5 bits (242), Expect = 2e-21
 Identities = 46/139 (33%), Positives = 64/139 (46%), Gaps = 9/139 (6%)

Query: 174 LQDAVKCAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPN 233
           L+DA++            R  ++   A  HSSLM P  K +   L  V  + P  P+  N
Sbjct: 104 LEDALRLVR--------LRGRYM-QEAVPHSSLMAPARKRLAEDLAQVPLRRPRFPVYSN 154

Query: 234 FCASPVSSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKS 293
             A P    + I  LL+EQ+T  VRW E ++     GVK   E GSG+VL GL  R  K 
Sbjct: 155 VTARPEEDPERIRALLLEQITAPVRWVEILRDMEARGVKRFLEFGSGEVLKGLVLRTLKE 214

Query: 294 LSAVSISKVEDIDLALRSI 312
             A+S+   + +  AL   
Sbjct: 215 AEALSVQDPDSLRKALEVE 233


>2uva_G Fatty acid synthase beta subunits; fungal, dehydratase,
           enoyl reductase, ketoacyl synthase, ketoacyl reductase;
           HET: FMN; 3.10A {Thermomyces lanuginosus} PDB: 2uvc_G*
           (G:135-311,G:423-557)
          Length = 312

 Score =  108 bits (271), Expect = 9e-25
 Identities = 21/162 (12%), Positives = 41/162 (25%), Gaps = 28/162 (17%)

Query: 2   STVLTFPGQGSQV--IGMGRDLYDSFPE-ARLVFEEVDHTLNQNL--------------- 43
                F GQG+        R++Y ++P     +   +   L                   
Sbjct: 16  KIYSIFGGQGNIEEYFDELREIYTTYPSFVEDLITSIAELLQSLAREWDAVKQYPKGLDI 75

Query: 44  ----SDLMWNGSQEELTATCNAQPALTAVSMAFIRVMEKN----GLCVKRDISYVAGHSL 95
                +       + L +   + P +  V +A   +  K        +    S   GHS 
Sbjct: 76  LQWLHNPESQPDTDYLVSAPVSFPLIGLVQLAHYMITCKTLGREPGELLERFSGTTGHSQ 135

Query: 96  GEYTALCAAKAFSLSDTIRLVRARGKSMQEAVPPGLGSMVAI 137
           G   A   A A +  +     +   + +              
Sbjct: 136 GIVVAAAIATARTWDEFATAAKRAVELLFWIGLR--SQQAYP 175


>2uv8_G Fatty acid synthase subunit beta (FAS1); fatty acid
           biosynthesis, malonyl/palmitoyl transferase,
           phosphopantetheine, transferase; HET: GVL FMN; 3.10A
           {Saccharomyces cerevisiae} PDB: 2vkz_G* 3hmj_G*
           (G:135-313,G:492-559)
          Length = 247

 Score =  107 bits (267), Expect = 2e-24
 Identities = 35/200 (17%), Positives = 61/200 (30%), Gaps = 30/200 (15%)

Query: 2   STVLTFPGQGSQVIGMG--RDLYDSFPE-ARLVFEEVDHTLNQNL--------------- 43
             V  F GQG+        RDLY ++      + +    TL++ +               
Sbjct: 17  QLVAIFGGQGNTDDYFEELRDLYQTYHVLVGDLIKFSAETLSELIRTTLDAEKVFTQGLN 76

Query: 44  -----SDLMWNGSQEELTATCNAQPALTAVSMAFIRVMEKNGLCVKRDI----SYVAGHS 94
                 +      ++ L +   + P +  + +A   V  K       ++        GHS
Sbjct: 77  ILEWLENPSNTPDKDYLLSIPISCPLIGVIQLAHYVVTAKLLGFTPGELRSYLKGATGHS 136

Query: 95  LGEYTALCAAKAFSLSDTIRLVRARGKSMQEAVPPGLGSMVAIIGLDDC-VVDSICAQAS 153
            G  TA+  A+  S       VR     +                     ++D     AS
Sbjct: 137 QGLVTAVAIAETDSWESFFVSVRKAITVLFFI--GVRCYEAYPNTFKATHILDFGPGGAS 194

Query: 154 RVGICEIANDNGGGQVVISG 173
            +G+    N +G G  VI  
Sbjct: 195 GLGVLTHRNKDGTGVRVIVA 214


>2vz8_A Fatty acid synthase; transferase, phosphopantetheine,
           multienzyme, megasynthase, fatty acid synthesis; 3.2A
           {Sus scrofa} PDB: 2vz9_A* (A:488-615,A:751-788)
          Length = 166

 Score =  105 bits (263), Expect = 7e-24
 Identities = 29/126 (23%), Positives = 51/126 (40%), Gaps = 6/126 (4%)

Query: 3   TVLTFPGQGSQVIGMGRDLYDSFPEARLV--FEEVDHTLNQNLSDLMWNGSQEELTATCN 60
                 G G+Q  GMG  L         +   ++    L   +SDL+ +  +  L    +
Sbjct: 5   VWFICSGMGAQWQGMGLSLMRLDRFRDSILRSDQALKPLGLRVSDLLLSTDEAVLDDIVS 64

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
           +  +LT++ +A I ++   GL        + GHSLGE     A    +  + +     RG
Sbjct: 65  SFVSLTSIQIALIDLLTSLGLQPD----GIIGHSLGEVACGYADGCLTQEEAVLSSYWRG 120

Query: 121 KSMQEA 126
             ++EA
Sbjct: 121 YCIKEA 126


>1mla_A Malonyl-coenzyme A acyl carrier protein transacylase;
           acyltransferase; 1.50A {Escherichia coli} (A:127-268)
          Length = 142

 Score =  104 bits (261), Expect = 1e-23
 Identities = 53/141 (37%), Positives = 78/141 (55%)

Query: 130 GLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAADTCLNKG 189
           G G+M AIIGLDD  +   C +A+   +    N N  GQVVI+G ++AV+ A   C   G
Sbjct: 2   GTGAMAAIIGLDDASIAKACEEAAEGQVVSPVNFNSPGQVVIAGHKEAVERAGAACKAAG 61

Query: 190 AKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSIDEISRLL 249
           AKRA+ LPVS P H +LM P +  +   L  +T   P VP++ N      ++ D I   L
Sbjct: 62  AKRALPLPVSVPSHCALMKPAADKLAVELAKITFNAPTVPVVNNVDVKCETNGDAIRDAL 121

Query: 250 VEQVTGRVRWRETIQWFANHG 270
           V Q+   V+W +++++ A  G
Sbjct: 122 VRQLYNPVQWTKSVEYMAAQG 142


>3hhd_A Fatty acid synthase; transferase, multienzyme, megasynthase,
           fatty acid synthesis, acetylation, cytoplasm, fatty acid
           biosynthesis, hydrolase; 2.15A {Homo sapiens} PDB:
           2jfk_A* 2jfd_A (A:490-616,A:753-789)
          Length = 164

 Score =  101 bits (252), Expect = 1e-22
 Identities = 28/127 (22%), Positives = 47/127 (37%), Gaps = 6/127 (4%)

Query: 3   TVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNL--SDLMWNGSQEELTATCN 60
                 G G+Q  GMG  L         +    +      L  S L+ +  +       +
Sbjct: 5   LWFICSGMGTQWRGMGLSLMRLDRFRDSILRSDEAVKPFGLKVSQLLLSTDESTFDDIVH 64

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
           +  +LTA+ +  I ++   GL        + GHSLGE     A    S  + +     RG
Sbjct: 65  SFVSLTAIQIGLIDLLSCMGLRPD----GIVGHSLGEVACGYADGCLSQEEAVLAAYWRG 120

Query: 121 KSMQEAV 127
           + ++EA 
Sbjct: 121 QCIKEAH 127


>2uv8_G Fatty acid synthase subunit beta (FAS1); fatty acid
           biosynthesis, malonyl/palmitoyl transferase,
           phosphopantetheine, transferase; HET: GVL FMN; 3.10A
           {Saccharomyces cerevisiae} PDB: 2vkz_G* 3hmj_G*
           (G:330-491)
          Length = 162

 Score = 92.2 bits (228), Expect = 8e-20
 Identities = 34/160 (21%), Positives = 57/160 (35%), Gaps = 27/160 (16%)

Query: 132 GSMVAIIGLDDCVVDSICAQASRV----GICEIANDNGGGQVVISGLQDAVKCAADTCLN 187
             M++I  L    V     + +         EI+  NG   +V+SG   ++     T   
Sbjct: 3   SPMLSISNLTQEQVQDYVNKTNSHLPAGKQVEISLVNGAKNLVVSGPPQSLYGLNLTLRK 62

Query: 188 KGAK-----------------RAVFLPVSAPFHSSLMTPVSKVMKWMLDSVT----KQDP 226
             A                     FLPV++PFHS L+ P S ++   L         +D 
Sbjct: 63  AKAPSGLDQSRIPFSERKLKFSNRFLPVASPFHSHLLVPASDLINKDLVKNNVSFNAKDI 122

Query: 227 VVPILPNFCASPVSSIDEI--SRLLVEQVTGRVRWRETIQ 264
            +P+   F  S +  +      R++   +   V+W  T Q
Sbjct: 123 QIPVYDTFDGSDLRVLSGSISERIVDCIIRLPVKWETTTQ 162


>2pff_B Fatty acid synthase subunit beta; fatty acid synthase,
           acyl-carrier-protein, beta-ketoacyl reductase,
           beta-ketoacyl synthase, dehydratase; 4.00A
           {Saccharomyces cerevisiae} (B:1616-1771)
          Length = 156

 Score = 87.6 bits (216), Expect = 2e-18
 Identities = 26/104 (25%), Positives = 50/104 (48%), Gaps = 4/104 (3%)

Query: 1   MSTVLTFPGQGSQVIGMGRDL--YDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTAT 58
           ++  + F G+  + I        +++  + +L  E++   +N++ +   +   +  L+AT
Sbjct: 55  VNLTIHFGGEKGKRIRENYSAMIFETIVDGKLKTEKIFKEINEHSTSYTFRSEKGLLSAT 114

Query: 59  CNAQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALC 102
              QPALT +  A    ++  G  +    +  AGHSLGEY AL 
Sbjct: 115 QFTQPALTLMEKAAFEDLKSKG--LIPADATFAGHSLGEYAALA 156


>2h1y_A Malonyl coenzyme A-acyl carrier protein transacylase; FABD,
           MCAT, transferase; 2.50A {Helicobacter pylori SS1}
           (A:140-210,A:261-272)
          Length = 83

 Score = 77.6 bits (191), Expect = 2e-15
 Identities = 27/73 (36%), Positives = 42/73 (57%), Gaps = 3/73 (4%)

Query: 132 GSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAADTCLNKGAK 191
            SM+ ++G+ +  + S+C +   V     AN NGG QVV++G++D +K    T    GAK
Sbjct: 3   ASMMVVLGVSEESLLSLCQRTKNV---WCANFNGGMQVVLAGVKDDLKALEPTLKEMGAK 59

Query: 192 RAVFLPVSAPFHS 204
           R VFL +S   H+
Sbjct: 60  RVVFLEMSVASHT 72


>2uva_G Fatty acid synthase beta subunits; fungal, dehydratase,
           enoyl reductase, ketoacyl synthase, ketoacyl reductase;
           HET: FMN; 3.10A {Thermomyces lanuginosus} PDB: 2uvc_G*
           (G:1863-1988)
          Length = 126

 Score = 77.0 bits (189), Expect = 3e-15
 Identities = 18/127 (14%), Positives = 38/127 (29%), Gaps = 8/127 (6%)

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRV--GICEIANDNG-GGQVVISGLQDAV 178
           +M  AV     S ++     +  +  +    + V   + EI N N    Q V +G   A+
Sbjct: 2   AMC-AVN---PSRISP-TFTEQALQYVVENIAEVTGWLLEIVNYNVANMQYVAAGDLRAL 56

Query: 179 KCAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASP 238
              A+       ++     +        +      +       T+  P    L    A+ 
Sbjct: 57  DTLANVLNILKMQKIDIQALMQSMSLEDVRAHLVEIIQECRKQTEAKPQPVQLERGFATI 116

Query: 239 VSSIDEI 245
                ++
Sbjct: 117 PLRGIDV 123


>2uv8_G Fatty acid synthase subunit beta (FAS1); fatty acid
           biosynthesis, malonyl/palmitoyl transferase,
           phosphopantetheine, transferase; HET: GVL FMN; 3.10A
           {Saccharomyces cerevisiae} PDB: 2vkz_G* 3hmj_G*
           (G:1830-1960)
          Length = 131

 Score = 77.0 bits (189), Expect = 3e-15
 Identities = 16/131 (12%), Positives = 35/131 (26%), Gaps = 10/131 (7%)

Query: 118 ARGKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRV--GICEIANDNG-GGQVVISGL 174
            R      A+ PG              +  +  +  +    + EI N N    Q V +G 
Sbjct: 2   GRSNYGMIAINPG----RVAASFSQEALQYVVERVGKRTGWLVEIVNYNVENQQYVAAGD 57

Query: 175 QDAVKCAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNF 234
             A+    +       ++   + +        +      +  ++D  +K+  V P     
Sbjct: 58  LRALDTVTNVLNFIKLQKIDIIELQKSLSLEEVEG---HLFEIIDEASKKSAVKPRPLKL 114

Query: 235 CASPVSSIDEI 245
                      
Sbjct: 115 ERGFACIPLVG 125


>2uva_G Fatty acid synthase beta subunits; fungal, dehydratase,
           enoyl reductase, ketoacyl synthase, ketoacyl reductase;
           HET: FMN; 3.10A {Thermomyces lanuginosus} PDB: 2uvc_G*
           (G:328-422)
          Length = 95

 Score = 76.4 bits (188), Expect = 4e-15
 Identities = 10/83 (12%), Positives = 21/83 (25%), Gaps = 6/83 (7%)

Query: 132 GSMVAIIGLDDCVVDSICAQASRV----GICEIANDNGGGQVVISGLQDAVKCAADTCLN 187
             M++I  L    V       ++         I+  N     V++G   ++         
Sbjct: 3   TPMLSIRDLTRSAVQEHIDATNQHLPEDRHIGISLVNSARNFVVTGPPISLYGLNLRLRK 62

Query: 188 KGAKRAVFLPVSAPFHSSLMTPV 210
             A     L  +    +      
Sbjct: 63  VKAPTG--LDQNRIPFTQRKARF 83


>3ezo_A Malonyl COA-acyl carrier protein transacylase; ssgcid,
           acyl-carrier-protein S-malonyltransferase,
           acyltransferase, transferase; 2.05A {Burkholderia
           pseudomallei 1710B} (A:133-206)
          Length = 74

 Score = 76.0 bits (187), Expect = 6e-15
 Identities = 37/73 (50%), Positives = 49/73 (67%)

Query: 130 GLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAADTCLNKG 189
           G+G M AI+GLDD  V ++CA+AS  G+ E  N N   QVVI+G +  ++ A +    KG
Sbjct: 2   GVGGMAAILGLDDDTVRAVCAEASATGVVEAVNFNAPAQVVIAGTKAGIEKACEIAKEKG 61

Query: 190 AKRAVFLPVSAPF 202
           AKRA+ LPVSAPF
Sbjct: 62  AKRALPLPVSAPF 74


>2pff_B Fatty acid synthase subunit beta; fatty acid synthase,
           acyl-carrier-protein, beta-ketoacyl reductase,
           beta-ketoacyl synthase, dehydratase; 4.00A
           {Saccharomyces cerevisiae} (B:1801-1915)
          Length = 115

 Score = 75.7 bits (186), Expect = 7e-15
 Identities = 12/98 (12%), Positives = 23/98 (23%), Gaps = 12/98 (12%)

Query: 117 RARGKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRV--GICEIANDNG-GGQVVISG 173
             R      A+ PG              +  +  +  +    + EI N N    Q V +G
Sbjct: 2   LGRSNYGMIAINPG----RVAASFSQEALQYVVERVGKRTGWLVEIVNYNVENQQYVAAG 57

Query: 174 LQDAVKCAADTCLNKGAKRAVFLPVSAPFHSSLMTPVS 211
              A+                   +        ++   
Sbjct: 58  DLRALDTVT-----NVLNFIKLQKIDIIELQKSLSLEE 90


>2pff_B Fatty acid synthase subunit beta; fatty acid synthase,
           acyl-carrier-protein, beta-ketoacyl reductase,
           beta-ketoacyl synthase, dehydratase; 4.00A
           {Saccharomyces cerevisiae} (B:334-428)
          Length = 95

 Score = 74.2 bits (182), Expect = 2e-14
 Identities = 16/83 (19%), Positives = 25/83 (30%), Gaps = 6/83 (7%)

Query: 132 GSMVAIIGLDDCVVDSICAQASRV----GICEIANDNGGGQVVISGLQDAVKCAADTCLN 187
             M++I  L    V     + +         EI+  NG   +V+SG   ++     T   
Sbjct: 3   SPMLSISNLTQEQVQDYVNKTNSHLPAGKQVEISLVNGAKNLVVSGPPQSLYGLNLTLRK 62

Query: 188 KGAKRAVFLPVSAPFHSSLMTPV 210
             A     L  S    S      
Sbjct: 63  AKAPSG--LDQSRIPFSERKLKF 83


>3k89_A Malonyl COA-ACP transacylase; bacterial blight, XOO0880,
           FABD, xanthomonas oryzae PV. oryzae KACC10331; 1.60A
           {Xanthomonas oryzae PV} PDB: 3een_A (A:130-202)
          Length = 73

 Score = 74.0 bits (182), Expect = 3e-14
 Identities = 29/72 (40%), Positives = 42/72 (58%)

Query: 130 GLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAADTCLNKG 189
           G+G+M A++G +D VV  +CA+A+   +   AN N  GQ+VI G   AV  A      +G
Sbjct: 1   GVGAMAAVLGAEDAVVLEVCAEAAGSQVVVPANFNSPGQIVIGGDAAAVDRALALLAERG 60

Query: 190 AKRAVFLPVSAP 201
            ++AV L VS P
Sbjct: 61  VRKAVKLAVSVP 72


>2c2n_A Malonyl COA-acyl carrier protein transacylase;
           mitochondrial, malonyltrasferase, fatty acid synthase
           alternative splicing, lipid synthesis; HET: AE4; 1.55A
           {Homo sapiens} (A:153-234)
          Length = 82

 Score = 73.8 bits (181), Expect = 3e-14
 Identities = 20/80 (25%), Positives = 33/80 (41%), Gaps = 8/80 (10%)

Query: 132 GSMVAIIGLDDCVVDSICAQASRV--------GICEIANDNGGGQVVISGLQDAVKCAAD 183
             M++++G      +  C +A            +CE++N       VISG Q+A++    
Sbjct: 3   SGMLSVLGQPQSKFNFACLEAREHCKSLGIENPVCEVSNYLFPDCRVISGHQEALRFLQK 62

Query: 184 TCLNKGAKRAVFLPVSAPFH 203
                  +R   LPVS  FH
Sbjct: 63  NSSKFHFRRTRMLPVSGAFH 82


>2uv8_A Fatty acid synthase subunit alpha (FAS2); fatty acid
           biosynthesis, malonyl/palmitoyl transferase,
           phosphopantetheine, transferase; HET: GVL FMN; 3.10A
           {Saccharomyces cerevisiae} PDB: 2vkz_A* 3hmj_A*
           (A:25-91)
          Length = 67

 Score = 70.1 bits (172), Expect = 4e-13
 Identities = 14/56 (25%), Positives = 22/56 (39%), Gaps = 1/56 (1%)

Query: 257 VRWRETIQW-FANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVEDIDLALRS 311
           VRW ET      +   + V E+G    L G+A+R  K+      + +      L  
Sbjct: 2   VRWIETQDVFLKDFNTERVVEIGPSPTLAGMAQRTLKNKYESYDAALSLHREILCY 57


>2qc3_A MCT, malonyl COA-acyl carrier protein transacylase;
           malonyl-COA:ACP transacylase, , nucleophilic attack;
           2.30A {Mycobacterium tuberculosis H37RV} PDB: 2qj3_A
           (A:129-195)
          Length = 67

 Score = 67.1 bits (164), Expect = 3e-12
 Identities = 21/72 (29%), Positives = 30/72 (41%), Gaps = 6/72 (8%)

Query: 132 GSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAADTCLNKGAK 191
             M A++G D+  V S   Q         AN N  GQ+V +G   A++  A+        
Sbjct: 2   TGMSAVLGGDETEVLSRLEQ----LDLVPANRNAAGQIVAAGRLTALEKLAEDP--PAKA 55

Query: 192 RAVFLPVSAPFH 203
           R   L V+  FH
Sbjct: 56  RVRALGVAGAFH 67


>2cuy_A Malonyl COA-[acyl carrier protein] transacylase;
           transferase, structural genomics, NPPSFA; 2.10A {Thermus
           thermophilus HB8} (A:124-193)
          Length = 70

 Score = 65.2 bits (159), Expect = 1e-11
 Identities = 31/73 (42%), Positives = 39/73 (53%), Gaps = 4/73 (5%)

Query: 130 GLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAADTCLNKG 189
           G G+M A++ L    +         V   EIAN N   Q VISG + AV+ AA+    + 
Sbjct: 2   GEGAMAAVLKLPLEEIQKALEGLEGV---EIANLNAPEQTVISGRRQAVEEAAERLKERR 58

Query: 190 AKRAVFLPVSAPF 202
           A R VFLPVSAPF
Sbjct: 59  A-RVVFLPVSAPF 70


>3hhd_A Fatty acid synthase; transferase, multienzyme, megasynthase,
           fatty acid synthesis, acetylation, cytoplasm, fatty acid
           biosynthesis, hydrolase; 2.15A {Homo sapiens} PDB:
           2jfk_A* 2jfd_A (A:617-685,A:744-752)
          Length = 78

 Score = 64.0 bits (156), Expect = 2e-11
 Identities = 16/78 (20%), Positives = 23/78 (29%), Gaps = 7/78 (8%)

Query: 130 GLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAADTCLNKG 189
             G+M A+ GL        C           A  N    V ISG Q  V    +    +G
Sbjct: 2   PPGAMAAV-GLSWEECKQRCP-----PGVVPACHNSKDTVTISGPQAPVFEFVEQLRKEG 55

Query: 190 AKRAVFLPVSAPFHSSLM 207
              A  +         ++
Sbjct: 56  -VFAKEVRTGGMAFHPVL 72


>3g87_A Malonyl COA-acyl carrier protein transacylase; ssgcid,
           niaid, decode biostructures, dried seaweed,
           acyltransferase, transferase; 2.30A {Burkholderia
           pseudomallei 1710B} (A:125-195)
          Length = 71

 Score = 63.6 bits (155), Expect = 3e-11
 Identities = 19/71 (26%), Positives = 28/71 (39%), Gaps = 2/71 (2%)

Query: 132 GSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAADTCLNKGAK 191
           G+M AI+      ++    +        IANDN   Q+VISG    +  A     +    
Sbjct: 3   GAMAAIVNASREQIERTLDEHGL-VDTAIANDNTPSQLVISGPAHEIARAEALFQHDRV- 60

Query: 192 RAVFLPVSAPF 202
           R + L  S  F
Sbjct: 61  RYLRLNTSGAF 71


>2vz8_A Fatty acid synthase; transferase, phosphopantetheine,
           multienzyme, megasynthase, fatty acid synthesis; 3.2A
           {Sus scrofa} PDB: 2vz9_A* (A:616-683,A:742-750)
          Length = 77

 Score = 63.2 bits (154), Expect = 4e-11
 Identities = 14/76 (18%), Positives = 21/76 (27%), Gaps = 7/76 (9%)

Query: 132 GSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAADTCLNKGAK 191
           G+M A+ GL        C           A  N    V ISG Q A+         +   
Sbjct: 3   GAMAAV-GLSWEECKQRCP-----PGIVPACHNSKDTVTISGPQAAMSEFLQQLKRED-V 55

Query: 192 RAVFLPVSAPFHSSLM 207
               +         ++
Sbjct: 56  FVKEVRTGGIAFHPVL 71


>1nm2_A Malonyl COA:acyl carrier protein malonyltransferase;
           alpha/beta hydrolase-like core; 2.00A {Streptomyces
           coelicolor A3} (A:135-201)
          Length = 67

 Score = 62.4 bits (152), Expect = 6e-11
 Identities = 17/71 (23%), Positives = 29/71 (40%), Gaps = 5/71 (7%)

Query: 132 GSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAADTCLNKGAK 191
             M A++G D  V  +   +         AN NG GQ+V +G  + +    +       +
Sbjct: 2   TGMSALLGGDPEVSVAHLERLG----LTPANVNGAGQIVAAGTMEQLAALNEDKPEGV-R 56

Query: 192 RAVFLPVSAPF 202
           + V L V+  F
Sbjct: 57  KVVPLKVAGAF 67


>2qo3_A Eryaii erythromycin polyketide synthase modules 3 and 4;
           ketosynthase, acyltransferase, phosphopantetheine; 2.59A
           {Saccharopolyspora erythraea} (A:661-729)
          Length = 69

 Score = 60.9 bits (148), Expect = 2e-10
 Identities = 18/72 (25%), Positives = 28/72 (38%), Gaps = 4/72 (5%)

Query: 132 GSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAADTCLNKGAK 191
           G M A+  L +  V              +A  NG   VV+SG   A++  ++ C  +G  
Sbjct: 2   GGMAAV-ALGEAAVRERLRPWQ--DRLSVAAVNGPRSVVVSGEPGALRAFSEDCAAEGI- 57

Query: 192 RAVFLPVSAPFH 203
           R   + V    H
Sbjct: 58  RVRDIDVDYASH 69


>2hg4_A DEBS, 6-deoxyerythronolide B synthase; ketosynthase,
           acyltransferase, module 5; 2.73A {Saccharopolyspora
           erythraea} (A:675-745)
          Length = 71

 Score = 60.5 bits (147), Expect = 2e-10
 Identities = 16/72 (22%), Positives = 25/72 (34%), Gaps = 3/72 (4%)

Query: 132 GSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAADTCLNKGAK 191
               A  GL          + +  G   IA+ NG   VV++G    +      C  +   
Sbjct: 3   QGGXASFGLGTEQAAERIGRFA--GALSIASVNGPRSVVVAGESGPLDELIAECEAEA-H 59

Query: 192 RAVFLPVSAPFH 203
           +A  +PV    H
Sbjct: 60  KARRIPVDYASH 71


>2h1y_A Malonyl coenzyme A-acyl carrier protein transacylase; FABD,
           MCAT, transferase; 2.50A {Helicobacter pylori SS1}
           (A:211-260)
          Length = 50

 Score = 48.9 bits (117), Expect = 9e-07
 Identities = 8/48 (16%), Positives = 16/48 (33%)

Query: 205 SLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSIDEISRLLVEQ 252
             + P+    + +L+   K      I+ N       +  +   LL  Q
Sbjct: 2   PFLEPMIFKFQELLEKSLKDKFHFEIISNATNEAYHNKAKAVELLSLQ 49


>2pff_B Fatty acid synthase subunit beta; fatty acid synthase,
           acyl-carrier-protein, beta-ketoacyl reductase,
           beta-ketoacyl synthase, dehydratase; 4.00A
           {Saccharomyces cerevisiae} (B:1772-1800,B:1916-2006)
          Length = 120

 Score = 41.3 bits (97), Expect = 2e-04
 Identities = 10/25 (40%), Positives = 14/25 (56%)

Query: 104 AKAFSLSDTIRLVRARGKSMQEAVP 128
           A   S+   + +V  RG +MQ AVP
Sbjct: 3   ADVMSIESLVEVVFYRGMTMQVAVP 27



 Score = 30.5 bits (69), Expect = 0.28
 Identities = 13/48 (27%), Positives = 17/48 (35%), Gaps = 24/48 (50%)

Query: 43 LSDLMWNGSQEELTATCNAQPALTAVSMAFIRVMEKNGL----CVKRD 86
          L+D+M   S E L            V + F R     G+     V RD
Sbjct: 2  LADVM---SIESL------------VEVVFYR-----GMTMQVAVPRD 29


>1ehy_A Protein (soluble epoxide hydrolase); alpha/beta hydrolase
           fold, epoxide degradation, epichlorohydrin; 2.10A
           {Agrobacterium tumefaciens} (A:1-140,A:224-276)
          Length = 193

 Score = 27.9 bits (61), Expect = 1.6
 Identities = 14/122 (11%), Positives = 35/122 (28%), Gaps = 7/122 (5%)

Query: 25  FPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPALTAVSMAFIRVMEKNGLCVK 84
           +P     + +V   L ++   ++ +      +   +                      + 
Sbjct: 38  WPGFWWEWSKVIGPLAEHYDVIVPDLRGFGDSEKPDLNDLSKYSLDKAADDQAALLDALG 97

Query: 85  RDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQEAVPPGLGSMVAIIGLDDCV 144
            + +YV GH           + +S        R    ++ + + P  G +     LD  +
Sbjct: 98  IEKAYVVGHDFAAIVLHKFIRKYS-------DRVIKAAIFDPIQPDFGPVALWTDLDHTM 150

Query: 145 VD 146
            D
Sbjct: 151 SD 152


>2pzm_A Putative nucleotide sugar epimerase/ dehydratase; rossman
           fold, protein-NAD complex, protein-nucleotide complex;
           HET: NAD UDP; 2.00A {Bordetella bronchiseptica} PDB:
           2pzl_A* 2pzk_A* (A:185-330)
          Length = 146

 Score = 27.9 bits (61), Expect = 1.7
 Identities = 10/73 (13%), Positives = 26/73 (35%), Gaps = 2/73 (2%)

Query: 206 LMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSIDEISRLL--VEQVTGRVRWRETI 263
           +      V+ ++  ++ +  PVV    +   S V    +         +V  +      +
Sbjct: 67  IKEVFDVVLDYVGATLAEPVPVVAPGADDVPSVVLDPSKTETEFGWKAKVDFKDTITGQL 126

Query: 264 QWFANHGVKSVYE 276
            W+  +GV  ++ 
Sbjct: 127 AWYDKYGVTDIFS 139


>2hg4_A DEBS, 6-deoxyerythronolide B synthase; ketosynthase,
           acyltransferase, module 5; 2.73A {Saccharopolyspora
           erythraea} (A:461-549,A:853-881)
          Length = 118

 Score = 27.5 bits (61), Expect = 2.2
 Identities = 10/35 (28%), Positives = 13/35 (37%), Gaps = 1/35 (2%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVD 36
               T  GQ     G+  D + +  EA     EVD
Sbjct: 78  IADRTATGQARTRGGLA-DFHTALGEAYAQGVEVD 111


>3k9g_A PF-32 protein; ssgcid, SBRI, decode biostructures, UW, NIH,
           niaid, borellia burgdorferi, plasmid partition protein,
           iodide, SAD phasing; 2.25A {Borrelia burgdorferi} PDB:
           3k9h_A (A:)
          Length = 267

 Score = 27.0 bits (58), Expect = 3.3
 Identities = 10/115 (8%), Positives = 26/115 (22%), Gaps = 2/115 (1%)

Query: 176 DAVKCAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFC 235
           D       T  N        +        ++ +       + +  +    P+  I+  F 
Sbjct: 151 DTNPSLDVTLKNALLCSDYVIIPMTAEKWAVESLDL--FNFFVRKLNLFLPIFLIITRFK 208

Query: 236 ASPVSSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRI 290
            +             ++  G +  RE +                 K    + +  
Sbjct: 209 KNRTHKTLFEILKTKDRFLGTISEREDLNRRIAENNNFDLNKDYIKEYENILEIF 263


>2h31_A Multifunctional protein ADE2; alpha-beta-alpha, ligase,
           lyase; 2.80A {Homo sapiens} (A:1-89,A:235-260,A:395-425)
          Length = 146

 Score = 26.7 bits (59), Expect = 3.9
 Identities = 5/56 (8%), Positives = 18/56 (32%)

Query: 72  FIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSMQEAV 127
           F R   +      ++++      + +     A +   L + +   + R   +   +
Sbjct: 77  FTRKCGETAFIAPKEVTPEGLQXVKKNFEWVAERVELLLNHLVWSKLRASILNTWI 132


>2puj_A 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrolase; C-C
           bond hydrolase; HET: HPZ; 1.57A {Burkholderia xenovorans
           LB400} PDB: 2pu7_A* 2puh_A* 2og1_A 2pu5_A 2rhw_A*
           2rht_A* 2ri6_A (A:1-143,A:220-286)
          Length = 210

 Score = 26.3 bits (57), Expect = 5.3
 Identities = 21/102 (20%), Positives = 33/102 (32%), Gaps = 10/102 (9%)

Query: 9   GQGSQVI---GMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPAL 65
           G G  VI   G G          R V   VD      L D              +A    
Sbjct: 31  GNGETVIMLHGGGPGAGGWSNYYRNVGPFVDAGYRVILKDSPGFN-------KSDAVVMD 83

Query: 66  TAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAF 107
               +   R ++     +  D +++ G+++G  TAL  A  +
Sbjct: 84  EQRGLVNARAVKGLMDALDIDRAHLVGNAMGGATALNFALEY 125


>2c1l_A Restriction endonuclease; BFII, domain fusion, hydrolase;
          HET: TAR TLA SRT MES; 1.9A {Bacillus firmus}
          (A:185-358)
          Length = 174

 Score = 26.1 bits (57), Expect = 6.4
 Identities = 9/18 (50%), Positives = 12/18 (66%)

Query: 9  GQGSQVIGMGRDLYDSFP 26
          GQG+Q   + +D YD FP
Sbjct: 38 GQGTQYFWLSKDSYDFFP 55


>2ctj_A Vigilin; K homology type I domain, RNA-binding, cell sterol
           metabolism, beta-alpha-alpha-beta-BETA-alpha structure,
           structural genomics, NPPSFA; NMR {Homo sapiens} (A:)
          Length = 95

 Score = 25.6 bits (56), Expect = 9.0
 Identities = 13/46 (28%), Positives = 20/46 (43%)

Query: 136 AIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCA 181
           ++IG    ++ SI  +   V I      +G   VVI G    V+ A
Sbjct: 30  SLIGTKGRLIRSIMEECGGVHIHFPVEGSGSDTVVIRGPSSDVEKA 75


  Database: mmdb70
    Posted date:  Jun 20, 2010  3:12 AM
  Number of letters in database: 4,956,049
  Number of sequences in database:  33,805
  
Lambda     K      H
   0.319    0.133    0.389 

Gapped
Lambda     K      H
   0.267   0.0389    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 33805
Number of Hits to DB: 2,273,849
Number of extensions: 98172
Number of successful extensions: 413
Number of sequences better than 10.0: 1
Number of HSP's gapped: 350
Number of HSP's successfully gapped: 71
Length of query: 314
Length of database: 4,956,049
Length adjustment: 88
Effective length of query: 226
Effective length of database: 1,981,209
Effective search space: 447753234
Effective search space used: 447753234
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 55 (25.9 bits)