RPSBLAST alignment of GI: 254780536 and protein with PDBid: 2uv8

>2uv8_G Fatty acid synthase subunit beta (FAS1); fatty acid biosynthesis, malonyl/palmitoyl transferase, phosphopantetheine, transferase; HET: GVL FMN; 3.10A {Saccharomyces cerevisiae} PDB: 2vkz_G* 3hmj_G* Length = 2051
 Score = 92.3 bits (229), Expect = 1e-19
 Identities = 70/367 (19%), Positives = 125/367 (34%), Gaps = 90/367 (24%)

Query: 7   FPGQGSQVIGMG--RDLYDSFPEARLVFEEVDHTLNQNLSDLM----------------- 47
           F GQG+        RDLY ++     +  ++     + LS+L+                 
Sbjct: 160 FGGQGNTDDYFEELRDLYQTYHV---LVGDLIKFSAETLSELIRTTLDAEKVFTQGLNIL 216

Query: 48  -WNGSQEE------LTATCNAQPALTAVSMAFI----RVMEKNGLCVKRDISYVAGHSLG 96
            W  +         L +   + P +  + +A      +++      ++  +    GHS G
Sbjct: 217 EWLENPSNTPDKDYLLSIPISCPLIGVIQLAHYVVTAKLLGFTPGELRSYLKGATGHSQG 276

Query: 97  EYTALCAAKAFSLSDTIRLVR----------------ARGKSM-----QEAVPPGLG--- 132
             TA+  A+  S       VR                    S+     ++++    G   
Sbjct: 277 LVTAVAIAETDSWESFFVSVRKAITVLFFIGVRCYEAYPNTSLPPSILEDSLENNEGVPS 336

Query: 133 SMVAIIGLD----DCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAADTCLNK 188
            M++I  L        V+   +        EI+  NG   +V+SG   ++     T    
Sbjct: 337 PMLSISNLTQEQVQDYVNKTNSHLPAGKQVEISLVNGAKNLVVSGPPQSLYGLNLTLRKA 396

Query: 189 GAK-----------------RAVFLPVSAPFHSSLMTP-VSKVMKWMLD---SVTKQDPV 227
            A                     FLPV++PFHS L+ P    + K ++    S   +D  
Sbjct: 397 KAPSGLDQSRIPFSERKLKFSNRFLPVASPFHSHLLVPASDLINKDLVKNNVSFNAKDIQ 456

Query: 228 VPILPNFCASPVSSID-EISRLLVEQVT-GRVRWRETIQWFANHGVKSVYEVGSGKV--L 283
           +P+   F  S +  +   IS  +V+ +    V+W  T Q+ A H    + + G G    L
Sbjct: 457 IPVYDTFDGSDLRVLSGSISERIVDCIIRLPVKWETTTQFKATH----ILDFGPGGASGL 512

Query: 284 TGLAKRI 290
             L  R 
Sbjct: 513 GVLTHRN 519