RPSBLAST alignment of GI: 254780536 and protein with PDBid: 2uva

>2uva_G Fatty acid synthase beta subunits; fungal, dehydratase, enoyl reductase, ketoacyl synthase, ketoacyl reductase; HET: FMN; 3.10A {Thermomyces lanuginosus} PDB: 2uvc_G* Length = 2060
 Score = 54.1 bits (130), Expect = 4e-08
 Identities = 43/239 (17%), Positives = 77/239 (32%), Gaps = 50/239 (20%)

Query: 74  RVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVR---------------- 117
           + + +    +    S   GHS G   A   A A +  +     +                
Sbjct: 248 KTLGREPGELLERFSGTTGHSQGIVVAAAIATARTWDEFATAAKRAVELLFWIGLRSQQA 307

Query: 118 ARGKSM-----QEAVPPGLG---SMVAIIGLD----DCVVDSICAQASRVGICEIANDNG 165
               S+     Q++V  G G    M++I  L        +D+            I+  N 
Sbjct: 308 YPRTSLAPSTLQDSVENGEGTPTPMLSIRDLTRSAVQEHIDATNQHLPEDRHIGISLVNS 367

Query: 166 GGQVVISGLQDAV--------KCAADTCL---------NKGAKRAVFLPVSAPFHSSLMT 208
               V++G   ++        K  A T L          K      FLP++APFHS  + 
Sbjct: 368 ARNFVVTGPPISLYGLNLRLRKVKAPTGLDQNRIPFTQRKARFVNRFLPITAPFHSPYLA 427

Query: 209 P-VSKVMKWMLD-SVTKQDPVVPILPNFCASPVSSI--DEISRLLVEQVT-GRVRWRET 262
              + ++  + D  +     V+P+        +  +  ++I   LV  +T   V W   
Sbjct: 428 GAHAHILGDVDDMKIPASSLVIPVYDTKTGQDLRELGDEDIIPELVRMITYDPVNWETA 486