RPSBLAST alignment of GI: 254780536 and protein with PDBid: 3ezo

>3ezo_A Malonyl COA-acyl carrier protein transacylase; ssgcid, acyl-carrier-protein S-malonyltransferase, acyltransferase, transferase; 2.05A {Burkholderia pseudomallei 1710B} Length = 318
 Score =  259 bits (663), Expect = 4e-70
 Identities = 131/310 (42%), Positives = 171/310 (55%), Gaps = 4/310 (1%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M     FPGQGSQ +GM     D     R   +E    L Q++  L+ +G  +EL  T N
Sbjct: 9   MKFAFVFPGQGSQSVGMLNAFAD-VAVVRETLDEASDALGQDIGKLIADGPADELNLTTN 67

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
            QP +   + A  R  ++         S VAGHSLGEYTAL AA A +  D + LVR R 
Sbjct: 68  TQPVMLTAAYACYRAWQQ---AGGAQPSIVAGHSLGEYTALVAAGAIAFRDALPLVRFRA 124

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           ++MQ AVP G+G M AI+GLDD  V ++CA+AS  G+ E  N N   QVVI+G +  ++ 
Sbjct: 125 QAMQTAVPVGVGGMAAILGLDDDTVRAVCAEASATGVVEAVNFNAPAQVVIAGTKAGIEK 184

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A +    KGAKRA+ LPVSAPFHSSL+ P S  ++  L  V  + P + ++ N   + VS
Sbjct: 185 ACEIAKEKGAKRALPLPVSAPFHSSLLKPASDKLREYLAGVDVKAPKISVVNNIDVAVVS 244

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
               I   LV Q  G VRW E +Q  A  GV  V E G GKVL GL KRID +L   S+ 
Sbjct: 245 DPAAIKDALVRQAAGPVRWVECVQHIAREGVTHVIECGPGKVLAGLTKRIDGNLVGASVF 304

Query: 301 KVEDIDLALR 310
               +D AL+
Sbjct: 305 DPASLDEALK 314