RPSBLAST alignment of GI: 254780536 and protein with PDBid: 3g87

>3g87_A Malonyl COA-acyl carrier protein transacylase; ssgcid, niaid, decode biostructures, dried seaweed, acyltransferase, transferase; 2.30A {Burkholderia pseudomallei 1710B} Length = 394
 Score =  197 bits (502), Expect = 2e-51
 Identities = 87/303 (28%), Positives = 128/303 (42%), Gaps = 17/303 (5%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M     FPGQGSQ  GMG  L+D F +   +  + D  L  ++  L  +  ++EL  T  
Sbjct: 5   MLNTFMFPGQGSQAKGMGGALFDRFAD---LTAQADAVLGYSIRALCVDDPRDELGRTQF 61

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
            QPAL  V+        ++         ++AGHSLGE+ AL AA  F     ++LV  R 
Sbjct: 62  TQPALYVVNALTYYAKCEDSGE---TPDFLAGHSLGEFNALLAAGCFDFETGLKLVARRA 118

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           + M +A    + ++V                        IANDN   Q+VISG    +  
Sbjct: 119 ELMSQARDGAMAAIVNASREQIERTLDEHGL----VDTAIANDNTPSQLVISGPAHEIAR 174

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A     +    R + L  S  FHS  M P  +     L S    DP +P++ N  A P  
Sbjct: 175 AEALFQHDR-VRYLRLNTSGAFHSKFMRPAQQAFAAHLQSFRLADPAIPVISNVSARPYE 233

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKS-----VYEVGSGKVLTGLAKRIDKSLS 295
           +   +S  L +Q+   VRW E+I++      +        E+G G VLT L   I +   
Sbjct: 234 N-GRVSEGLAQQIASPVRWCESIRYLLALAAERGEAIEFTELGHGDVLTRLVHTIRRQTP 292

Query: 296 AVS 298
           A +
Sbjct: 293 APA 295