RPSBLAST alignment of GI: 254780536 and protein with PDBid: 3im8

>3im8_A Malonyl acyl carrier protein transacylase; fatty acid synthesis, malonyl-COA, acyl carrier protein TRAN (MCAT), FABD, acyltransferase; 2.10A {Streptococcus pneumoniae} Length = 307
 Score =  276 bits (706), Expect = 6e-75
 Identities = 109/313 (34%), Positives = 166/313 (53%), Gaps = 7/313 (2%)

Query: 1   MS-TVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATC 59
           M+ T   F GQG+Q +GMGRD YD +P  +   +     L  +L  L+    +++L  T 
Sbjct: 1   MTKTAFLFAGQGAQYLGMGRDFYDQYPIVKETIDRASQVLGYDLRYLID-TEEDKLNQTR 59

Query: 60  NAQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRAR 119
             QPA+ A S+A  R++++ G         VAG SLGEY+AL A+ A    D + LV  R
Sbjct: 60  YTQPAILATSVAIYRLLQEKGY----QPDMVAGLSLGEYSALVASGALDFEDAVALVAKR 115

Query: 120 GKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVK 179
           G  M+EA P   G MVA++     V++  C +AS +G+   AN N   Q+VI+G   AV 
Sbjct: 116 GAYMEEAAPADSGKMVAVLNTPVEVIEEACQKASELGVVTPANYNTPAQIVIAGEVVAVD 175

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            A +     GAKR + L VS PFH+SL+ P S+ +   L  V+  D   P++ N  A+ +
Sbjct: 176 RAVELLQEAGAKRLIPLKVSGPFHTSLLEPASQKLAETLAQVSFSDFTCPLVGNTEAAVM 235

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
              ++I++LL  QV   VR+ E+I      G+ +  E+G GKVL+G  K+ID++     +
Sbjct: 236 QK-EDIAQLLTRQVKEPVRFYESIGVMQEAGISNFIEIGPGKVLSGFVKKIDQTAHLAHV 294

Query: 300 SKVEDIDLALRSI 312
                +   L  +
Sbjct: 295 EDQASLVALLEKL 307