RPS-BLAST 2.2.22 [Sep-27-2009]

Database: pdb70 
           24,244 sequences; 5,693,230 total letters

Searching..................................................done

Query= gi|254780536|ref|YP_003064949.1| acyl-carrier-protein
S-malonyltransferase [Candidatus Liberibacter asiaticus str. psy62]
         (314 letters)



>3im9_A MCAT, MCT, malonyl COA-acyl carrier protein transacylase; fatty
           acid synthesis, malonyl-COA: acyl carrier protein TRAN
           (MCAT), FABD; 1.46A {Staphylococcus aureus}
          Length = 316

 Score =  279 bits (714), Expect = 8e-76
 Identities = 103/305 (33%), Positives = 164/305 (53%), Gaps = 7/305 (2%)

Query: 3   TVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQ 62
             + FPGQG+Q +GM +DL+++  +A  +      TL+ ++ + M+   + +L  T N Q
Sbjct: 12  MAIIFPGQGAQKVGMAQDLFNNNDQATEILTSAAKTLDFDILETMFTDEEGKLGETENTQ 71

Query: 63  PALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKS 122
           PAL   S A +            +  +  GHSLGEY++L AA   S  D +++VR RG+ 
Sbjct: 72  PALLTHSSALLAA------LKNLNPDFTMGHSLGEYSSLVAADVLSFEDAVKIVRKRGQL 125

Query: 123 MQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGI-CEIANDNGGGQVVISGLQDAVKCA 181
           M +A P G+GSM A++GLD   VD IC   S      E AN N  GQ+V+SG +  +   
Sbjct: 126 MAQAFPTGVGSMAAVLGLDFDKVDEICKSLSSDDKIIEPANINCPGQIVVSGHKALIDEL 185

Query: 182 ADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSS 241
            +   + GAKR + L VS PFHSSLM  + +     ++    +D   P++ N  A   + 
Sbjct: 186 VEKGKSLGAKRVMPLAVSGPFHSSLMKVIEEDFSSYINQFEWRDAKFPVVQNVNAQGETD 245

Query: 242 IDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISK 301
            + I   +V+Q+   V++  + +W  + GV    E+G GKVL+GL K+I++ +   SI  
Sbjct: 246 KEVIKSNMVKQLYSPVQFINSTEWLIDQGVDHFIEIGPGKVLSGLIKKINRDVKLTSIQT 305

Query: 302 VEDID 306
           +ED+ 
Sbjct: 306 LEDVK 310


>3im8_A Malonyl acyl carrier protein transacylase; fatty acid synthesis,
           malonyl-COA, acyl carrier protein TRAN (MCAT), FABD,
           acyltransferase; 2.10A {Streptococcus pneumoniae}
          Length = 307

 Score =  276 bits (706), Expect = 6e-75
 Identities = 109/313 (34%), Positives = 166/313 (53%), Gaps = 7/313 (2%)

Query: 1   MS-TVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATC 59
           M+ T   F GQG+Q +GMGRD YD +P  +   +     L  +L  L+    +++L  T 
Sbjct: 1   MTKTAFLFAGQGAQYLGMGRDFYDQYPIVKETIDRASQVLGYDLRYLID-TEEDKLNQTR 59

Query: 60  NAQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRAR 119
             QPA+ A S+A  R++++ G         VAG SLGEY+AL A+ A    D + LV  R
Sbjct: 60  YTQPAILATSVAIYRLLQEKGY----QPDMVAGLSLGEYSALVASGALDFEDAVALVAKR 115

Query: 120 GKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVK 179
           G  M+EA P   G MVA++     V++  C +AS +G+   AN N   Q+VI+G   AV 
Sbjct: 116 GAYMEEAAPADSGKMVAVLNTPVEVIEEACQKASELGVVTPANYNTPAQIVIAGEVVAVD 175

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            A +     GAKR + L VS PFH+SL+ P S+ +   L  V+  D   P++ N  A+ +
Sbjct: 176 RAVELLQEAGAKRLIPLKVSGPFHTSLLEPASQKLAETLAQVSFSDFTCPLVGNTEAAVM 235

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
              ++I++LL  QV   VR+ E+I      G+ +  E+G GKVL+G  K+ID++     +
Sbjct: 236 QK-EDIAQLLTRQVKEPVRFYESIGVMQEAGISNFIEIGPGKVLSGFVKKIDQTAHLAHV 294

Query: 300 SKVEDIDLALRSI 312
                +   L  +
Sbjct: 295 EDQASLVALLEKL 307


>1mla_A Malonyl-coenzyme A acyl carrier protein transacylase;
           acyltransferase; 1.50A {Escherichia coli} SCOP: c.19.1.1
           d.58.23.1 PDB: 2g2o_A 2g1h_A 2g2y_A 2g2z_A* 3h0p_A
           3hjv_A*
          Length = 309

 Score =  262 bits (670), Expect = 8e-71
 Identities = 128/310 (41%), Positives = 175/310 (56%), Gaps = 4/310 (1%)

Query: 1   MSTV-LTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATC 59
           M+     FPGQGSQ +GM  D+  S+P     F E    L  +L  L   G  EEL  T 
Sbjct: 1   MTQFAFVFPGQGSQTVGMLADMAASYPIVEETFAEASAALGYDLWALTQQGPAEELNKTW 60

Query: 60  NAQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRAR 119
             QPAL   S+A  RV ++ G       + +AGHSLGEY+AL  A     +D +RLV  R
Sbjct: 61  QTQPALLTASVALYRVWQQQGGKA---PAMMAGHSLGEYSALVCAGVIDFADAVRLVEMR 117

Query: 120 GKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVK 179
           GK MQEAVP G G+M AIIGLDD  +   C +A+   +    N N  GQVVI+G ++AV+
Sbjct: 118 GKFMQEAVPEGTGAMAAIIGLDDASIAKACEEAAEGQVVSPVNFNSPGQVVIAGHKEAVE 177

Query: 180 CAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV 239
            A   C   GAKRA+ LPVS P H +LM P +  +   L  +T   P VP++ N      
Sbjct: 178 RAGAACKAAGAKRALPLPVSVPSHCALMKPAADKLAVELAKITFNAPTVPVVNNVDVKCE 237

Query: 240 SSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSI 299
           ++ D I   LV Q+   V+W +++++ A  GV+ +YEVG GKVLTGL KRI  +L+A ++
Sbjct: 238 TNGDAIRDALVRQLYNPVQWTKSVEYMAAQGVEHLYEVGPGKVLTGLTKRIVDTLTASAL 297

Query: 300 SKVEDIDLAL 309
           ++   +  AL
Sbjct: 298 NEPSAMAAAL 307


>3ezo_A Malonyl COA-acyl carrier protein transacylase; ssgcid,
           acyl-carrier-protein S-malonyltransferase,
           acyltransferase, transferase; 2.05A {Burkholderia
           pseudomallei 1710B}
          Length = 318

 Score =  259 bits (663), Expect = 4e-70
 Identities = 131/310 (42%), Positives = 171/310 (55%), Gaps = 4/310 (1%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M     FPGQGSQ +GM     D     R   +E    L Q++  L+ +G  +EL  T N
Sbjct: 9   MKFAFVFPGQGSQSVGMLNAFAD-VAVVRETLDEASDALGQDIGKLIADGPADELNLTTN 67

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
            QP +   + A  R  ++         S VAGHSLGEYTAL AA A +  D + LVR R 
Sbjct: 68  TQPVMLTAAYACYRAWQQ---AGGAQPSIVAGHSLGEYTALVAAGAIAFRDALPLVRFRA 124

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           ++MQ AVP G+G M AI+GLDD  V ++CA+AS  G+ E  N N   QVVI+G +  ++ 
Sbjct: 125 QAMQTAVPVGVGGMAAILGLDDDTVRAVCAEASATGVVEAVNFNAPAQVVIAGTKAGIEK 184

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A +    KGAKRA+ LPVSAPFHSSL+ P S  ++  L  V  + P + ++ N   + VS
Sbjct: 185 ACEIAKEKGAKRALPLPVSAPFHSSLLKPASDKLREYLAGVDVKAPKISVVNNIDVAVVS 244

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
               I   LV Q  G VRW E +Q  A  GV  V E G GKVL GL KRID +L   S+ 
Sbjct: 245 DPAAIKDALVRQAAGPVRWVECVQHIAREGVTHVIECGPGKVLAGLTKRIDGNLVGASVF 304

Query: 301 KVEDIDLALR 310
               +D AL+
Sbjct: 305 DPASLDEALK 314


>2qo3_A Eryaii erythromycin polyketide synthase modules 3 and 4;
           ketosynthase, acyltransferase, phosphopantetheine; 2.59A
           {Saccharopolyspora erythraea}
          Length = 915

 Score =  252 bits (645), Expect = 6e-68
 Identities = 68/300 (22%), Positives = 115/300 (38%), Gaps = 15/300 (5%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQN----LSDLMWNGSQE-ELT 56
           + V  FPGQGSQ  GMG +L  S P         D ++       +SD++        L 
Sbjct: 533 NVVFLFPGQGSQWAGMGAELLSSSPVFAGKIRACDESMAPMQDWKVSDVLRQAPGAPGLD 592

Query: 57  ATCNAQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLV 116
                QP L AV ++   +    G+    + + V GHS GE  A   A A +L D  +LV
Sbjct: 593 RVDVVQPVLFAVMVSLAELWRSYGV----EPAAVVGHSQGEIAAAHVAGALTLEDAAKLV 648

Query: 117 RARGKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQD 176
             R + M+     G   M A+   +  V + +     R+    +A  NG   VV+SG   
Sbjct: 649 VGRSRLMRSLSGEG--GMAAVALGEAAVRERLRPWQDRL---SVAAVNGPRSVVVSGEPG 703

Query: 177 AVKCAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCA 236
           A++  ++ C  +G  R   + V    HS  +  V + +      +  +   V       +
Sbjct: 704 ALRAFSEDCAAEGI-RVRDIDVDYASHSPQIERVREELLETTGDIAPRPARVTFHSTVES 762

Query: 237 SPVSSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSA 296
             +   +  +R     +   VR+ + +   A  G  +  EV    V+    +   +    
Sbjct: 763 RSMDGTELDARYWYRNLRETVRFADAVTRLAESGYDAFIEVSPHPVVVQAVEEAVEEADG 822


>3k89_A Malonyl COA-ACP transacylase; bacterial blight, XOO0880, FABD,
           xanthomonas oryzae PV. oryzae KACC10331; 1.60A
           {Xanthomonas oryzae PV} PDB: 3een_A
          Length = 314

 Score =  238 bits (607), Expect = 1e-63
 Identities = 117/308 (37%), Positives = 162/308 (52%), Gaps = 3/308 (0%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
           +    FPGQGSQ +GM  +L +  P+ R  F E       +L  L   G +E L  T   
Sbjct: 5   TLAFVFPGQGSQSLGMLAELSELHPQIRETFAEASEGAGVDLWALSQGGPEEMLNRTEYT 64

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPAL A  +A  R+         +  + +AGHSLGEYTAL AA   SL D   LVR RG+
Sbjct: 65  QPALLAAGVAVWRLWTA---QRGQRPALLAGHSLGEYTALVAAGVLSLHDGAHLVRLRGQ 121

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCA 181
            MQ A P G+G+M A++G +D VV  +CA+A+   +   AN N  GQ+VI G   AV  A
Sbjct: 122 FMQAAAPAGVGAMAAVLGAEDAVVLEVCAEAAGSQVVVPANFNSPGQIVIGGDAAAVDRA 181

Query: 182 ADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSS 241
                 +G ++AV L VS P H+ LM   +  +   +  ++   P +P++ N  A     
Sbjct: 182 LALLAERGVRKAVKLAVSVPSHTPLMRDAANQLGEAMAGLSWHAPQIPVVQNVDARVHDG 241

Query: 242 IDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISK 301
              I + LVEQ+   V+W   +Q  A+ G+  + E G GKVL+GL KRIDKSL A  ++ 
Sbjct: 242 SAAIRQALVEQLYLPVQWTGCVQALASQGITRIAECGPGKVLSGLIKRIDKSLDARPLAT 301

Query: 302 VEDIDLAL 309
             D   AL
Sbjct: 302 PADYAGAL 309


>2hg4_A DEBS, 6-deoxyerythronolide B synthase; ketosynthase,
           acyltransferase, module 5; 2.73A {Saccharopolyspora
           erythraea}
          Length = 917

 Score =  233 bits (594), Expect = 6e-62
 Identities = 66/290 (22%), Positives = 110/290 (37%), Gaps = 12/290 (4%)

Query: 3   TVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNL--SDLMWNGSQEELTATCN 60
             + FPGQG+Q  GM RDL            + +  L  ++  S          L     
Sbjct: 553 VAMVFPGQGAQWQGMARDLLRESQVFADSIRDCERALAPHVDWSLTDLLSGARPLDRVDV 612

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
            QPAL AV ++   +   +G+        V GHS GE  A   A A +L D  +LV  R 
Sbjct: 613 VQPALFAVMVSLAALWRSHGVEPA----AVVGHSQGEIAAAHVAGALTLEDAAKLVAVRS 668

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           + ++     G G M +     +   + I   A   G   IA+ NG   VV++G    +  
Sbjct: 669 RVLRRL--GGQGGMASFGLGTEQAAERIGRFA---GALSIASVNGPRSVVVAGESGPLDE 723

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
               C  +   +A  +PV    HS  +  + + +   L  ++     V +       P+ 
Sbjct: 724 LIAECEAEA-HKARRIPVDYASHSPQVESLREELLTELAGISPVSADVALYSTTTGQPID 782

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRI 290
           +    +      +  +VR+++  +  A  G  +  EV    VLT   +  
Sbjct: 783 TATMDTAYWYANLREQVRFQDATRQLAEAGFDAFVEVSPHPVLTVGIEAT 832


>1nm2_A Malonyl COA:acyl carrier protein malonyltransferase; alpha/beta
           hydrolase-like core; 2.00A {Streptomyces coelicolor A3}
           SCOP: c.19.1.1 d.58.23.1 PDB: 2cdh_4 2cf2_B
          Length = 317

 Score =  227 bits (580), Expect = 2e-60
 Identities = 90/314 (28%), Positives = 133/314 (42%), Gaps = 11/314 (3%)

Query: 4   VLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQP 63
           VL  PGQG+Q  G   D     P A          +  +L+        +E+  T  AQP
Sbjct: 4   VLVAPGQGAQTPGFLTDWLA-LPGAADRVAAWSDAIGLDLAHFGTKADADEIRDTSVAQP 62

Query: 64  ALTAVSMAFIRVMEKNGLCVKRDI-----SYVAGHSLGEYTALCAAKAFSLSDTIRLVRA 118
            L A  +     +                  VAGHS+GE TA   A     +  + LVR 
Sbjct: 63  LLVAAGILSAAALGTQTSVADATGPGFTPGAVAGHSVGEITAAVFAGVLDDTAALSLVRR 122

Query: 119 RGKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAV 178
           RG +M EA       M A++G D  V  +   +         AN NG GQ+V +G  + +
Sbjct: 123 RGLAMAEAAAVTETGMSALLGGDPEVSVAHLERLG----LTPANVNGAGQIVAAGTMEQL 178

Query: 179 KCAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASP 238
             A +    +G ++ V L V+  FH+  M P    +     ++T  DP V  + N     
Sbjct: 179 -AALNEDKPEGVRKVVPLKVAGAFHTRHMAPAVDKLAEAAKALTPADPKVTYVSNKDGRA 237

Query: 239 VSSIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVS 298
           V+S  E+   LV QV   VRW   ++ F   GV ++ EV  G  LTGLAKR    +  ++
Sbjct: 238 VASGTEVLDRLVGQVANPVRWDLCMETFKELGVTAIIEVCPGGTLTGLAKRALPGVKTLA 297

Query: 299 ISKVEDIDLALRSI 312
           +   +D+D A   +
Sbjct: 298 LKTPDDLDAARELV 311


>2cuy_A Malonyl COA-[acyl carrier protein] transacylase; transferase,
           structural genomics, NPPSFA; 2.10A {Thermus thermophilus
           HB8}
          Length = 305

 Score =  211 bits (537), Expect = 2e-55
 Identities = 133/310 (42%), Positives = 165/310 (53%), Gaps = 9/310 (2%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M   L FPGQGS  +GMGR LY++ P A+ V +  +  L   L  LMW G +E LT T N
Sbjct: 1   MYAAL-FPGQGSHRVGMGRALYEASPAAKEVLDRAEAAL-PGLLKLMWEGPEEALTLTEN 58

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
            QPAL A   A  R   + G          AGHSLGE+TA  AA    L D +RLVR RG
Sbjct: 59  QQPALLAAGYAAYRAFLEAGGKPPA---LAAGHSLGEWTAHVAAGTLELEDALRLVRLRG 115

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           + MQEAVP G G+M A++ L    +         V   EIAN N   Q VISG + AV+ 
Sbjct: 116 RYMQEAVPVGEGAMAAVLKLPLEEIQKALEGLEGV---EIANLNAPEQTVISGRRQAVEE 172

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           AA+    + A R VFLPVSAPFHSSLM P  K +   L  V  + P  P+  N  A P  
Sbjct: 173 AAERLKERRA-RVVFLPVSAPFHSSLMAPARKRLAEDLAQVPLRRPRFPVYSNVTARPEE 231

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
             + I  LL+EQ+T  VRW E ++     GVK   E GSG+VL GL  R  K   A+S+ 
Sbjct: 232 DPERIRALLLEQITAPVRWVEILRDMEARGVKRFLEFGSGEVLKGLVLRTLKEAEALSVQ 291

Query: 301 KVEDIDLALR 310
             + +  AL 
Sbjct: 292 DPDSLRKALE 301


>3g87_A Malonyl COA-acyl carrier protein transacylase; ssgcid, niaid,
           decode biostructures, dried seaweed, acyltransferase,
           transferase; 2.30A {Burkholderia pseudomallei 1710B}
          Length = 394

 Score =  197 bits (502), Expect = 2e-51
 Identities = 87/303 (28%), Positives = 128/303 (42%), Gaps = 17/303 (5%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M     FPGQGSQ  GMG  L+D F +   +  + D  L  ++  L  +  ++EL  T  
Sbjct: 5   MLNTFMFPGQGSQAKGMGGALFDRFAD---LTAQADAVLGYSIRALCVDDPRDELGRTQF 61

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
            QPAL  V+        ++         ++AGHSLGE+ AL AA  F     ++LV  R 
Sbjct: 62  TQPALYVVNALTYYAKCEDSGE---TPDFLAGHSLGEFNALLAAGCFDFETGLKLVARRA 118

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           + M +A    + ++V                        IANDN   Q+VISG    +  
Sbjct: 119 ELMSQARDGAMAAIVNASREQIERTLDEHGL----VDTAIANDNTPSQLVISGPAHEIAR 174

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
           A     +    R + L  S  FHS  M P  +     L S    DP +P++ N  A P  
Sbjct: 175 AEALFQHDR-VRYLRLNTSGAFHSKFMRPAQQAFAAHLQSFRLADPAIPVISNVSARPYE 233

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKS-----VYEVGSGKVLTGLAKRIDKSLS 295
           +   +S  L +Q+   VRW E+I++      +        E+G G VLT L   I +   
Sbjct: 234 N-GRVSEGLAQQIASPVRWCESIRYLLALAAERGEAIEFTELGHGDVLTRLVHTIRRQTP 292

Query: 296 AVS 298
           A +
Sbjct: 293 APA 295


>3hhd_A Fatty acid synthase; transferase, multienzyme, megasynthase, fatty
           acid synthesis, acetylation, cytoplasm, fatty acid
           biosynthesis, hydrolase; 2.15A {Homo sapiens} PDB:
           2jfk_A* 2jfd_A
          Length = 965

 Score =  194 bits (495), Expect = 2e-50
 Identities = 65/302 (21%), Positives = 104/302 (34%), Gaps = 21/302 (6%)

Query: 4   VLTFPGQGSQVIGMGRDLYDS--FPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
                G G+Q  GMG  L     F ++ L  +E        +S L+ +  +       ++
Sbjct: 495 WFICSGMGTQWRGMGLSLMRLDRFRDSILRSDEAVKPFGLKVSQLLLSTDESTFDDIVHS 554

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
             +LTA+ +  I ++   G         + GHSLGE     A    S  + +     RG+
Sbjct: 555 FVSLTAIQIGLIDLLSCMG----LRPDGIVGHSLGEVACGYADGCLSQEEAVLAAYWRGQ 610

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCA 181
            ++EA     G+M A+ GL        C           A  N    V ISG Q  V   
Sbjct: 611 CIKEA-HLPPGAMAAV-GLSWEECKQRCPPG-----VVPACHNSKDTVTISGPQAPVFEF 663

Query: 182 ADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQ----DPVVPILPNFCAS 237
            +    +G            FHS  M  ++  +   L  V ++               A 
Sbjct: 664 VEQLRKEGVFAKEVRTGGMAFHSYFMEAIAPPLLQELKKVIREPKPRSARWLSTSIPEAQ 723

Query: 238 PVSSIDEIS--RLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLS 295
             SS+   S     V  +   V ++E +     H V  V E+    +L  + KR  K   
Sbjct: 724 WHSSLARTSSAEYNVNNLVSPVLFQEALWHVPEHAV--VLEIAPHALLQAVLKRGLKPSC 781

Query: 296 AV 297
            +
Sbjct: 782 TI 783


>2c2n_A Malonyl COA-acyl carrier protein transacylase; mitochondrial,
           malonyltrasferase, fatty acid synthase alternative
           splicing, lipid synthesis; HET: AE4; 1.55A {Homo
           sapiens}
          Length = 339

 Score =  184 bits (466), Expect = 3e-47
 Identities = 92/314 (29%), Positives = 146/314 (46%), Gaps = 17/314 (5%)

Query: 2   STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNA 61
            +VL FPGQGSQV+GMGR L + +P  R ++      L  +L +L  +G QE L  T + 
Sbjct: 26  CSVLLFPGQGSQVVGMGRGLLN-YPRVRELYAAARRVLGYDLLELSLHGPQETLDRTVHC 84

Query: 62  QPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGK 121
           QPA+   S+A +  +      V  +    AG S+GE+ AL  A A   ++ +  V+ R +
Sbjct: 85  QPAIFVASLAAVEKLHHLQPSVIENCVAAAGFSVGEFAALVFAGAMEFAEGLYAVKIRAE 144

Query: 122 SMQEAVPPGLGSMVAIIGLDDCVVDSICAQ--------ASRVGICEIANDNGGGQVVISG 173
           +MQEA       M++++G      +  C +             +CE++N       VISG
Sbjct: 145 AMQEASEAVPSGMLSVLGQPQSKFNFACLEAREHCKSLGIENPVCEVSNYLFPDCRVISG 204

Query: 174 LQDAVKCAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPN 233
            Q+A++           +R   LPVS  FH+ LM P  + +   L +V  + P+V +  N
Sbjct: 205 HQEALRFLQKNSSKFHFRRTRMLPVSGAFHTRLMEPAVEPLTQALKAVDIKKPLVSVYSN 264

Query: 234 FCASPVSSIDEISRLLVEQVTGRVRWRETIQW----FANHGVKSVYEVGSGKVLTGLAKR 289
                      I +LL +Q+   V+W +T+          G    +EVG G+ L  + K 
Sbjct: 265 VHGHRYRHPGHIHKLLAQQLVSPVKWEQTMHAIYERKKGRGFPQTFEVGPGRQLGAILKS 324

Query: 290 ID----KSLSAVSI 299
            +    KS SAV +
Sbjct: 325 CNMQAWKSYSAVDV 338


>2qc3_A MCT, malonyl COA-acyl carrier protein transacylase; malonyl-COA:ACP
           transacylase, , nucleophilic attack; 2.30A
           {Mycobacterium tuberculosis H37RV} PDB: 2qj3_A
          Length = 303

 Score =  171 bits (433), Expect = 2e-43
 Identities = 86/303 (28%), Positives = 127/303 (41%), Gaps = 8/303 (2%)

Query: 4   VLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQP 63
            L  PGQGSQ  GM        P A           + +L+ L    S EE+T T  AQP
Sbjct: 4   ALLAPGQGSQTEGMLSPWLQ-LPGAADQIAAWSKAADLDLARLGTTASTEEITDTAVAQP 62

Query: 64  ALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARGKSM 123
            + A ++   + + +  +   +D+  VAGHS+GE  A   A   +  D + L   RG  M
Sbjct: 63  LIVAATLLAHQELARRCVLAGKDV-IVAGHSVGEIAAYAIAGVIAADDAVALAATRGAEM 121

Query: 124 QEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAAD 183
            +A       M A++G D+  V S   Q         AN N  GQ+V +G   A++  A+
Sbjct: 122 AKACATEPTGMSAVLGGDETEVLSRLEQLD----LVPANRNAAGQIVAAGRLTALEKLAE 177

Query: 184 TCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSID 243
                   R   L V+  FH+  M P          ++   DP   +L N    PV+S  
Sbjct: 178 DP--PAKARVRALGVAGAFHTEFMAPALDGFXXXXXNIATADPTATLLSNRDGKPVTSAA 235

Query: 244 EISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVE 303
                LV Q+T  VRW         H V ++ E      L+G+AKR  + + A ++    
Sbjct: 236 AAMDTLVSQLTQPVRWDLCTATLREHTVTAIVEFPPAGTLSGIAKRELRGVPARAVKSPA 295

Query: 304 DID 306
           D+D
Sbjct: 296 DLD 298


>2h1y_A Malonyl coenzyme A-acyl carrier protein transacylase; FABD, MCAT,
           transferase; 2.50A {Helicobacter pylori SS1}
          Length = 321

 Score =  170 bits (431), Expect = 3e-43
 Identities = 94/312 (30%), Positives = 153/312 (49%), Gaps = 7/312 (2%)

Query: 1   MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
           M   L FPGQGSQ IGMG+  Y+    A+ +FE   + L  ++   ++  + E L  +  
Sbjct: 13  MQYALLFPGQGSQCIGMGKSFYEGHTLAKELFERASNALKVDMKKTLFEEN-ELLKESAY 71

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
            QPA+  VS    +++ K      +   +  GHSLGE +A+  + A      ++L   RG
Sbjct: 72  TQPAIYLVSYIAYQLLNKQANGGLK-PVFALGHSLGEVSAVSLSGALDFEKALKLTHQRG 130

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
           K MQEA      SM+ ++G+ +  + S+C +   V     AN NGG QVV++G++D +K 
Sbjct: 131 KMMQEACANKDASMMVVLGVSEESLLSLCQRTKNV---WCANFNGGMQVVLAGVKDDLKA 187

Query: 181 AADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVS 240
              T    GAKR VFL +S   H   + P+    + +L+   K      I+ N       
Sbjct: 188 LEPTLKEMGAKRVVFLEMSVASHCPFLEPMIFKFQELLEKSLKDKFHFEIISNATNEAYH 247

Query: 241 SIDEISRLLVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSIS 300
           +  +   LL  Q+T  VR+++ ++   N  V   +E+G G VL GL KR+      +S+ 
Sbjct: 248 NKAKAVELLSLQLTQPVRYQDCVKS-NNDRVDIFFELGCGSVLKGLNKRLSNKP-TISVG 305

Query: 301 KVEDIDLALRSI 312
             + +D A+  +
Sbjct: 306 DNKGLDEAIEFL 317


>2vz8_A Fatty acid synthase; transferase, phosphopantetheine, multienzyme,
           megasynthase, fatty acid synthesis; 3.2A {Sus scrofa}
           PDB: 2vz9_A*
          Length = 2512

 Score =  162 bits (410), Expect = 1e-40
 Identities = 64/307 (20%), Positives = 105/307 (34%), Gaps = 23/307 (7%)

Query: 3   TVLTFPGQGSQVIGMGRDLYDS--FPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCN 60
                 G G+Q  GMG  L     F ++ L  ++    L   +SDL+ +  +  L    +
Sbjct: 492 VWFICSGMGAQWQGMGLSLMRLDRFRDSILRSDQALKPLGLRVSDLLLSTDEAVLDDIVS 551

Query: 61  AQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVRARG 120
           +  +LT++ +A I ++   GL        + GHSLGE     A    +  + +     RG
Sbjct: 552 SFVSLTSIQIALIDLLTSLGLQP----DGIIGHSLGEVACGYADGCLTQEEAVLSSYWRG 607

Query: 121 KSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKC 180
             ++EA     G+M A +GL        C           A  N    V ISG Q A+  
Sbjct: 608 YCIKEA-NVLPGAMAA-VGLSWEECKQRCPPG-----IVPACHNSKDTVTISGPQAAMSE 660

Query: 181 AADTCLNKGAKRAVFLPVS-APFHSSLMTPVSKVMKWMLDSVT--KQDPVVPILPNFCAS 237
                  +       +      FHS  M  ++  +   L  V    +      L      
Sbjct: 661 FLQQLKRED-VFVKEVRTGGIAFHSYFMESIAPTLLRQLRKVILDPKPRSKRWLSTSIPE 719

Query: 238 PVSSIDEISRL----LVEQVTGRVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRIDKS 293
                           V  +   V ++E +Q    H V  V E+    +L  + KR  +S
Sbjct: 720 AQWQGSLARTFSAEYSVNNLVSPVLFQEALQHVPAHAV--VVEIAPHALLQAVLKRSLES 777

Query: 294 LSAVSIS 300
              +   
Sbjct: 778 SCTIIPL 784


>2pff_B Fatty acid synthase subunit beta; fatty acid synthase,
           acyl-carrier-protein, beta-ketoacyl reductase,
           beta-ketoacyl synthase, dehydratase; 4.00A
           {Saccharomyces cerevisiae}
          Length = 2006

 Score =  123 bits (311), Expect = 4e-29
 Identities = 82/407 (20%), Positives = 129/407 (31%), Gaps = 162/407 (39%)

Query: 7   FPGQG------SQVIGMGRDLYDSFPE--ARLVFEEVDHTLNQNLS-------------- 44
           F GQG       ++    RDLY ++      L+ +    TL   L               
Sbjct: 160 FGGQGNTDDYFEEL----RDLYQTYHVLVGDLI-KFSAETL-SELIRTTLDAEKVFTQGL 213

Query: 45  DLM-WNGSQEELTATCNAQPA----LTA-VSMAFI------------RVMEKNGLCVK-- 84
           +++ W      L    +  P     L+  +S   I            +++   G      
Sbjct: 214 NILEW------LE-NPSNTPDKDYLLSIPISCPLIGVIQLAHYVVTAKLL---GFTPGEL 263

Query: 85  RD-ISYVAGHSLGEYTALCAAKAFSLSDT-----------IRL-----VRARGKSMQEA- 126
           R  +    GHS G    L  A A + +D+           I +     VR       EA 
Sbjct: 264 RSYLKGATGHSQG----LVTAVAIAETDSWESFFVSVRKAITVLFFIGVRC-----YEAY 314

Query: 127 ----VPP---------GLGS---MVAIIGLDDCVVDSICAQ-------ASRVGICEIAND 163
               +PP           G    M++I  L    V     +         +V I  +   
Sbjct: 315 PNTSLPPSILEDSLENNEGVPSPMLSISNLTQEQVQDYVNKTNSHLPAGKQVEISLV--- 371

Query: 164 NGGGQVVISG----LQ------DAVKCAADTCLNK--GAKRAV-----FLPVSAPFHSSL 206
           NG   +V+SG    L          K  +    ++   ++R +     FLPV++PFHS L
Sbjct: 372 NGAKNLVVSGPPQSLYGLNLTLRKAKAPSGLDQSRIPFSERKLKFSNRFLPVASPFHSHL 431

Query: 207 MTPVSKVMKWMLDSVTKQDPVVPILPNFCASPV----------SSIDEISRLLVEQVT-G 255
           + P S ++      + K +  V         PV               IS  +V+ +   
Sbjct: 432 LVPASDLIN---KDLVKNN--VSFNAKDIQIPVYDTFDGSDLRVLSGSISERIVDCIIRL 486

Query: 256 RVRWRETIQWFANH-------GVKSVYEVGSGKVLT-----GLAKRI 290
            V+W  T Q+ A H       G       G G VLT     G   R+
Sbjct: 487 PVKWETTTQFKATHILDFGPGGAS-----GLG-VLTHRNKDGTGVRV 527



 Score = 88.1 bits (218), Expect = 2e-18
 Identities = 56/183 (30%), Positives = 91/183 (49%), Gaps = 23/183 (12%)

Query: 21   LYDSFPEARLVFEEVDHTLNQNLSDLMWNGSQEELTATCNAQPALTAVSMAFIRVMEKNG 80
            ++++  + +L  E++   +N++ +   +   +  L+AT   QPALT +  A    ++  G
Sbjct: 1692 IFETIVDGKLKTEKIFKEINEHSTSYTFRSEKGLLSATQFTQPALTLMEKAAFEDLKSKG 1751

Query: 81   LCVKRDISYVAGHSLGEYTALCA-AKAFSLSDTIRLVRARGKSMQEAVPPG-LG-SMVAI 137
            L +  D ++ AGHSLGEY AL + A   S+   + +V  RG +MQ AVP   LG S   +
Sbjct: 1752 L-IPADATF-AGHSLGEYAALASLADVMSIESLVEVVFYRGMTMQVAVPRDELGRSNYGM 1809

Query: 138  IGLDDCVVDSICAQAS------RVG-----ICEIANDN-GGGQVVISG-LQDAVKCAADT 184
            I ++   V +  +Q +      RVG     + EI N N    Q V +G L+     A DT
Sbjct: 1810 IAINPGRVAASFSQEALQYVVERVGKRTGWLVEIVNYNVENQQYVAAGDLR-----ALDT 1864

Query: 185  CLN 187
              N
Sbjct: 1865 VTN 1867


>2uva_G Fatty acid synthase beta subunits; fungal, dehydratase, enoyl
            reductase, ketoacyl synthase, ketoacyl reductase; HET:
            FMN; 3.10A {Thermomyces lanuginosus} PDB: 2uvc_G*
          Length = 2060

 Score = 96.1 bits (239), Expect = 9e-21
 Identities = 69/259 (26%), Positives = 95/259 (36%), Gaps = 79/259 (30%)

Query: 2    STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVD-HTLN-------------------- 40
             T   F GQGSQ  GMG DLY + P A+ V++  D H                       
Sbjct: 1671 VTAYVFTGQGSQEQGMGMDLYATSPVAKEVWDRADKHFRENYGFSIIDIVKNNPKELTVH 1730

Query: 41   ----------QNLSDLMW-----NGSQE------ELTATCN----------------AQP 63
                      QN   + +     +GS +      E+                      QP
Sbjct: 1731 FGGPRGKIIRQNYMSMTFETVNADGSIKTEKIFKEVDENSTSYTYRSPSGLLSATQFTQP 1790

Query: 64   ALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCA-AKAFSLSDTIRLVRARGKS 122
            ALT +  A    M   GL  +   S  AGHSLGEY+AL A A    +   + +V  RG +
Sbjct: 1791 ALTLMEKASFEDMRSKGLVQRD--STFAGHSLGEYSALVALADVMPIESLVSVVFYRGLT 1848

Query: 123  MQEAVP-PGLG----SMVAI----IGLD------DCVVDSICAQASRVGICEIANDN-GG 166
            MQ AV     G    +M A+    I           VV++I A+ +   + EI N N   
Sbjct: 1849 MQVAVERDEQGRSNYAMCAVNPSRISPTFTEQALQYVVENI-AEVTG-WLLEIVNYNVAN 1906

Query: 167  GQVVISGLQDAVKCAADTC 185
             Q V +G   A+   A+  
Sbjct: 1907 MQYVAAGDLRALDTLANVL 1925



 Score = 54.1 bits (130), Expect = 4e-08
 Identities = 43/239 (17%), Positives = 77/239 (32%), Gaps = 50/239 (20%)

Query: 74  RVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVR---------------- 117
           + + +    +    S   GHS G   A   A A +  +     +                
Sbjct: 248 KTLGREPGELLERFSGTTGHSQGIVVAAAIATARTWDEFATAAKRAVELLFWIGLRSQQA 307

Query: 118 ARGKSM-----QEAVPPGLG---SMVAIIGLD----DCVVDSICAQASRVGICEIANDNG 165
               S+     Q++V  G G    M++I  L        +D+            I+  N 
Sbjct: 308 YPRTSLAPSTLQDSVENGEGTPTPMLSIRDLTRSAVQEHIDATNQHLPEDRHIGISLVNS 367

Query: 166 GGQVVISGLQDAV--------KCAADTCL---------NKGAKRAVFLPVSAPFHSSLMT 208
               V++G   ++        K  A T L          K      FLP++APFHS  + 
Sbjct: 368 ARNFVVTGPPISLYGLNLRLRKVKAPTGLDQNRIPFTQRKARFVNRFLPITAPFHSPYLA 427

Query: 209 P-VSKVMKWMLD-SVTKQDPVVPILPNFCASPVSSI--DEISRLLVEQVT-GRVRWRET 262
              + ++  + D  +     V+P+        +  +  ++I   LV  +T   V W   
Sbjct: 428 GAHAHILGDVDDMKIPASSLVIPVYDTKTGQDLRELGDEDIIPELVRMITYDPVNWETA 486


>2uv8_G Fatty acid synthase subunit beta (FAS1); fatty acid biosynthesis,
           malonyl/palmitoyl transferase, phosphopantetheine,
           transferase; HET: GVL FMN; 3.10A {Saccharomyces
           cerevisiae} PDB: 2vkz_G* 3hmj_G*
          Length = 2051

 Score = 92.3 bits (229), Expect = 1e-19
 Identities = 70/367 (19%), Positives = 125/367 (34%), Gaps = 90/367 (24%)

Query: 7   FPGQGSQVIGMG--RDLYDSFPEARLVFEEVDHTLNQNLSDLM----------------- 47
           F GQG+        RDLY ++     +  ++     + LS+L+                 
Sbjct: 160 FGGQGNTDDYFEELRDLYQTYHV---LVGDLIKFSAETLSELIRTTLDAEKVFTQGLNIL 216

Query: 48  -WNGSQEE------LTATCNAQPALTAVSMAFI----RVMEKNGLCVKRDISYVAGHSLG 96
            W  +         L +   + P +  + +A      +++      ++  +    GHS G
Sbjct: 217 EWLENPSNTPDKDYLLSIPISCPLIGVIQLAHYVVTAKLLGFTPGELRSYLKGATGHSQG 276

Query: 97  EYTALCAAKAFSLSDTIRLVR----------------ARGKSM-----QEAVPPGLG--- 132
             TA+  A+  S       VR                    S+     ++++    G   
Sbjct: 277 LVTAVAIAETDSWESFFVSVRKAITVLFFIGVRCYEAYPNTSLPPSILEDSLENNEGVPS 336

Query: 133 SMVAIIGLD----DCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAADTCLNK 188
            M++I  L        V+   +        EI+  NG   +V+SG   ++     T    
Sbjct: 337 PMLSISNLTQEQVQDYVNKTNSHLPAGKQVEISLVNGAKNLVVSGPPQSLYGLNLTLRKA 396

Query: 189 GAK-----------------RAVFLPVSAPFHSSLMTP-VSKVMKWMLD---SVTKQDPV 227
            A                     FLPV++PFHS L+ P    + K ++    S   +D  
Sbjct: 397 KAPSGLDQSRIPFSERKLKFSNRFLPVASPFHSHLLVPASDLINKDLVKNNVSFNAKDIQ 456

Query: 228 VPILPNFCASPVSSID-EISRLLVEQVT-GRVRWRETIQWFANHGVKSVYEVGSGKV--L 283
           +P+   F  S +  +   IS  +V+ +    V+W  T Q+ A H    + + G G    L
Sbjct: 457 IPVYDTFDGSDLRVLSGSISERIVDCIIRLPVKWETTTQFKATH----ILDFGPGGASGL 512

Query: 284 TGLAKRI 290
             L  R 
Sbjct: 513 GVLTHRN 519



 Score = 83.4 bits (206), Expect = 5e-17
 Identities = 59/258 (22%), Positives = 87/258 (33%), Gaps = 78/258 (30%)

Query: 2    STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEEVD-HTLN-------------------- 40
             T   F GQGSQ  GMG DLY +   A+ V+   D H  +                    
Sbjct: 1661 VTTFVFTGQGSQEQGMGMDLYKTSKAAQDVWNRADNHFKDTYGFSILDIVINNPVNLTIH 1720

Query: 41   ----------QNLSDLMWNGSQEELTATCNAQPALTAVS--------------------- 69
                      +N S +++    +    T      +   S                     
Sbjct: 1721 FGGEKGKRIRENYSAMIFETIVDGKLKTEKIFKEINEHSTSYTFRSEKGLLSATQFTQPA 1780

Query: 70   ---MAFIRV--MEKNGLCVKRDISYVAGHSLGEYTALCA-AKAFSLSDTIRLVRARGKSM 123
               M       ++  GL      +  AGHSLGEY AL + A   S+   + +V  RG +M
Sbjct: 1781 LTLMEKAAFEDLKSKGLIPAD--ATFAGHSLGEYAALASLADVMSIESLVEVVFYRGMTM 1838

Query: 124  QEAVP-PGLG----SMVAI----IGLD------DCVVDSICAQASRVGICEIANDN-GGG 167
            Q AVP   LG     M+AI    +           VV+ +  + +   + EI N N    
Sbjct: 1839 QVAVPRDELGRSNYGMIAINPGRVAASFSQEALQYVVERV-GKRTG-WLVEIVNYNVENQ 1896

Query: 168  QVVISGLQDAVKCAADTC 185
            Q V +G   A+    +  
Sbjct: 1897 QYVAAGDLRALDTVTNVL 1914


>2uv8_A Fatty acid synthase subunit alpha (FAS2); fatty acid biosynthesis,
            malonyl/palmitoyl transferase, phosphopantetheine,
            transferase; HET: GVL FMN; 3.10A {Saccharomyces
            cerevisiae} PDB: 2vkz_A* 3hmj_A*
          Length = 1887

 Score = 57.0 bits (137), Expect = 5e-09
 Identities = 15/133 (11%), Positives = 33/133 (24%), Gaps = 32/133 (24%)

Query: 1    MSTVLTFPGQGSQVIGMGRDLYDSFPEARLVF----------EEVDHTLNQNLSDLMWNG 50
            M   +T     +  +G+  +L  S       F          E      +   S      
Sbjct: 1755 MIENMTKEKVSNGGVGVDVELITSINVENDTFIERNFTPQEIEYCSAQPSVQSSFAGTWS 1814

Query: 51   SQEELTATCNA---------------QPALTAV----SMAFIRVMEKNGLCVKRDISYVA 91
            ++E +  +                  +    A          +  E+ G+    D+    
Sbjct: 1815 AKEAVFKSLGVKSLGGGAALKDIEIVRVNKNAPAVELHGNAKKAAEEAGV---TDVKVSI 1871

Query: 92   GHSLGEYTALCAA 104
             H   +  A+  +
Sbjct: 1872 SHDDLQAVAVAVS 1884



 Score = 34.7 bits (79), Expect = 0.026
 Identities = 17/53 (32%), Positives = 25/53 (47%), Gaps = 6/53 (11%)

Query: 243 DEISR-LLVE----QVTGRVRWRETI-QWFANHGVKSVYEVGSGKVLTGLAKR 289
            E++  LL E    Q    VRW ET   +  +   + V E+G    L G+A+R
Sbjct: 7   QELAHILLTELLAYQFASPVRWIETQDVFLKDFNTERVVEIGPSPTLAGMAQR 59


>2uv9_A Fatty acid synthase alpha subunits; fungal, dehydratase, enoyl
            reductase, ketoacyl synthase, ketoacyl reductase; 3.1A
            {Thermomyces lanuginosus} PDB: 2uvb_A*
          Length = 1878

 Score = 55.8 bits (134), Expect = 1e-08
 Identities = 10/133 (7%), Positives = 31/133 (23%), Gaps = 32/133 (24%)

Query: 2    STVLTFPGQGSQVIGMGRDLYDSFPEARLVFEE------------------VDHTLNQNL 43
              +       +  +G+  +  DS       F                             
Sbjct: 1748 EALAATAASPASRVGVDVESVDSINIDNEEFISRNFTEREQAYCRRAPNPRASFAGRWTA 1807

Query: 44   SDLMWN-------GSQEELTATCNAQPALTAVSMAFI----RVMEKNGLCVKRDISYVAG 92
             + ++        G+   +        A  A  +          ++ G+   + ++    
Sbjct: 1808 KEAIFKSLGVASKGAGAAMREIEVINDANGAPEVHLHGAAAEAAKQAGV---KTVNVSIS 1864

Query: 93   HSLGEYTALCAAK 105
            H   +  A+  ++
Sbjct: 1865 HGDLQAVAVAVSR 1877



 Score = 34.3 bits (78), Expect = 0.040
 Identities = 18/52 (34%), Positives = 25/52 (48%), Gaps = 6/52 (11%)

Query: 244 EISR-LLVE----QVTGRVRWRETI-QWFANHGVKSVYEVGSGKVLTGLAKR 289
           E++  LLVE    Q    VRW ET     A    + + E+G    L G+A+R
Sbjct: 8   ELAYTLLVELLAYQFAMPVRWIETQDVILAEKRTERIVEIGPSDTLGGMARR 59


>2wd5_B Structural maintenance of chromosomes protein 3; DNA damage, cell
           cycle, cell division; 2.70A {Mus musculus}
          Length = 213

 Score = 31.6 bits (71), Expect = 0.21
 Identities = 14/137 (10%), Positives = 33/137 (24%), Gaps = 6/137 (4%)

Query: 159 EIANDNGGGQVVISGLQDAVKCAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWML 218
           E+   N     ++   + + K   +           FLP++         P +     M+
Sbjct: 68  EVTAGNRLFYHIVDSDEVSTKILMEFNKMNLPGEVTFLPLNKLDVRDTAYPETNDAIPMI 127

Query: 219 DSVTKQDPVVPILPNFCASPVSSIDEISRLLVEQVTGRVRWRETI---QWFANHGVKSVY 275
             +           +     +            Q+                ++ G  +  
Sbjct: 128 SKLRYNPRFDKAFKHVFGKTLICRSMEVST---QLARAFTMDCITLEGDQVSHRGALTGG 184

Query: 276 EVGSGKVLTGLAKRIDK 292
              + K    L K + K
Sbjct: 185 YYDTRKSRLELQKDVRK 201


>2pff_A Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl-carrier-; fatty
            acid synthase, acyl-carrier-protein, beta-ketoacyl
            reductase, beta-ketoacyl synthase, dehydratase; 4.00A
            {Saccharomyces cerevisiae}
          Length = 1688

 Score = 29.8 bits (66), Expect = 0.94
 Identities = 34/165 (20%), Positives = 65/165 (39%), Gaps = 44/165 (26%)

Query: 104  AKAFSLSDTIRLVRARGKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQA--------SRV 155
            AK + +SD I         + +  P  L  +V+       VV++  A            V
Sbjct: 996  AKTYGISDDI---------ISQVDPITLFVLVS-------VVEAFIASGITDPYEMYKYV 1039

Query: 156  GICEIANDNGGGQVVISGLQDAVKCAADTCLNKGAKRAVFLPVSAPFHSSLMTPVSKVMK 215
             + E+ N +G G   +S L+   K   D   ++  +  +          S +  +S  + 
Sbjct: 1040 HVSEVGNCSGSGMGGVSALRGMFK---DRFKDEPVQNDI-------LQESFINTMSAWVN 1089

Query: 216  WMLDSVTKQDPV-VPILPNFCASPVSSIDEISRLLVEQV-TGRVR 258
             +L  ++   P+  P+    CA+ V S+D    + VE + +G+ R
Sbjct: 1090 MLL--ISSSGPIKTPV--GACATSVESVD----IGVETILSGKAR 1126


>2zet_C Melanophilin; complex, GTP-binding protein, GTPase, G-protein, RAB,
           RAB27B, effector, SLP homology domain, acetylation,
           lipoprotein, membrane; HET: GTP; 3.00A {Mus musculus}
          Length = 153

 Score = 28.9 bits (64), Expect = 1.6
 Identities = 10/35 (28%), Positives = 16/35 (45%)

Query: 256 RVRWRETIQWFANHGVKSVYEVGSGKVLTGLAKRI 290
           RV    +++W+  H        GS KV+  L  R+
Sbjct: 118 RVVKIGSLEWYYQHVRARFKRFGSAKVIRSLCGRL 152


>2gj4_A Glycogen phosphorylase, muscle form; transferase; HET: PLR 2TH;
           1.60A {Oryctolagus cuniculus} SCOP: c.87.1.4 PDB:
           2gm9_A* 1abb_A* 2pyi_A* 2pyd_A* 2qnb_A* 1c8l_A* 1axr_A*
           1gpy_A* 1e1y_A* 1lwo_A* 1pyg_A* 1uzu_A* 1lwn_A* 1xkx_A*
           1xl0_A* 1xl1_A* 1z62_A* 2amv_A* 2f3p_A* 2f3q_A* ...
          Length = 824

 Score = 28.5 bits (63), Expect = 1.8
 Identities = 15/66 (22%), Positives = 25/66 (37%), Gaps = 14/66 (21%)

Query: 258 RWRETIQWFANHGVKSVY----EVGSGKVLT------GLAKRIDKSLSA--VSISKVEDI 305
           RW  T Q +     K +Y    E   G+ L        L    D++     + + ++E+I
Sbjct: 55  RWIRTQQHYYEKDPKRIYYLSLEFYMGRTLQNTMVNLALENACDEATYQLGLDMEELEEI 114

Query: 306 --DLAL 309
             D  L
Sbjct: 115 EEDAGL 120


>3mfb_A Uncharacterized protein; alpha-beta protein, structural genomics,
           PSI-2, protein structure initiative; 2.20A {Erwinia
           carotovora}
          Length = 157

 Score = 28.6 bits (63), Expect = 1.9
 Identities = 16/90 (17%), Positives = 34/90 (37%), Gaps = 3/90 (3%)

Query: 186 LNKGAKRAVFLPVSAPFHSSLMTPVSKVMKWMLDSVTKQDPVVPILPNFCASPVSSIDEI 245
            +    R  F    A   + L TP +  ++   D+   + PV+P         +  +D++
Sbjct: 58  HDFPNNRYEFWEEGATGPTILWTPDNPGIELPTDTAHGEQPVIP--SAIPGLEIPEMDDV 115

Query: 246 SRLLVEQVTGRVRWRETIQWFANHGVKSVY 275
             +L   +     +R+ I  F  +    +Y
Sbjct: 116 -SILATPMPDEKDFRDYILVFPENAFPPIY 144


>2ord_A Acoat, acetylornithine aminotransferase; TM1785, acetylornithine
           aminotransferase (EC 2.6.1.11) (acoat), structural
           genomics; HET: MSE PLP; 1.40A {Thermotoga maritima MSB8}
           PDB: 2e54_A*
          Length = 397

 Score = 26.9 bits (59), Expect = 6.5
 Identities = 14/100 (14%), Positives = 27/100 (27%), Gaps = 19/100 (19%)

Query: 58  TCNAQPALTAVSMAFIRVMEKNGLCVKRDISYVAGHSLGEYTALCAAKAFSLSDTIRLVR 117
           T    P      +  I+ + K G   +           G Y      +     D +  VR
Sbjct: 280 TFGGNPLACRAGVTVIKELTKEGFLEE-------VEEKGNYLMKKLQEMKEEYDVVADVR 332

Query: 118 ARGKSMQEAVPPGLGSMVAIIGLDDCVVDSICAQASRVGI 157
                       G+G M+ I   ++     +  +     +
Sbjct: 333 ------------GMGLMIGIQFREEVSNREVATKCFENKL 360


>1gpm_A GMP synthetase, XMP aminase; class I glutamine amidotransferase,
           N-type ATP pyrophosphatase, transferase (glutamine
           amidotransferase); HET: AMP CIT; 2.20A {Escherichia coli
           K12} SCOP: c.23.16.1 c.26.2.1 d.52.2.1
          Length = 525

 Score = 26.9 bits (59), Expect = 6.9
 Identities = 24/172 (13%), Positives = 52/172 (30%), Gaps = 20/172 (11%)

Query: 156 GIC----EIANDNGG-----GQVVISGLQDAVKCAADTCLNKGAKRAVFLPVSAPFHSSL 206
           G+C     +A   GG      +      Q  V   +                      S 
Sbjct: 84  GVCYGMQTMAMQLGGHVEASNEREFGYAQVEVVNDSALVRGIEDALTADGKPLLDVWMSH 143

Query: 207 MTPVSKVMKWMLDSVTKQDPVVPILPN-------FCASPVSSIDEISRLLVEQ-VTGRVR 258
              V+ +    +   + +     I+ N           P  +       ++E+ V    +
Sbjct: 144 GDKVTAIPSDFITVASTESCPFAIMANEEKRFYGVQFHPEVTHTRQGMRMLERFVRDICQ 203

Query: 259 WRETI---QWFANHGVKSVYEVGSGKVLTGLAKRIDKSLSAVSISKVEDIDL 307
                   +   +   +   +VG  KV+ GL+  +D S++A+ + +    +L
Sbjct: 204 CEALWTPAKIIDDAVARIREQVGDDKVILGLSGGVDSSVTAMLLHRAIGKNL 255


>3h4l_A DNA mismatch repair protein PMS1; ATP binding, DNA repair, DNA
           damage, nucleus, phosphop DNA binding protein, protein
           binding; HET: DNA ANP; 2.50A {Saccharomyces cerevisiae}
          Length = 367

 Score = 26.6 bits (58), Expect = 8.5
 Identities = 14/48 (29%), Positives = 18/48 (37%), Gaps = 17/48 (35%)

Query: 132 GSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVK 179
           GSM  I  ++D  V  I +                GQV+   L  AVK
Sbjct: 1   GSMTQIHQINDIDVHRITS----------------GQVITD-LTTAVK 31


  Database: pdb70
    Posted date:  Jan 26, 2011 11:21 AM
  Number of letters in database: 5,693,230
  Number of sequences in database:  24,244
  
Lambda     K      H
   0.319    0.133    0.389 

Gapped
Lambda     K      H
   0.267   0.0491    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 24244
Number of Hits to DB: 2,572,721
Number of extensions: 114632
Number of successful extensions: 441
Number of sequences better than 10.0: 1
Number of HSP's gapped: 384
Number of HSP's successfully gapped: 39
Length of query: 314
Length of database: 5,693,230
Length adjustment: 92
Effective length of query: 222
Effective length of database: 3,462,782
Effective search space: 768737604
Effective search space used: 768737604
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 57 (26.3 bits)