RPSBLAST alignment of GI: 254780536 and SCOP domain: d1mlaa2

Alignment
>d1mlaa2 d.58.23.1 (A:128-197) Probable ACP-binding domain of malonyl-CoA ACP transacylase {Escherichia coli [TaxId: 562]} Length = 70
 Score = 73.4 bits (180), Expect = 2e-14
 Identities = 33/70 (47%), Positives = 43/70 (61%)

Query: 130 GLGSMVAIIGLDDCVVDSICAQASRVGICEIANDNGGGQVVISGLQDAVKCAADTCLNKG 189
           G G+M AIIGLDD  +   C +A+   +    N N  GQVVI+G ++AV+ A   C   G
Sbjct: 1   GTGAMAAIIGLDDASIAKACEEAAEGQVVSPVNFNSPGQVVIAGHKEAVERAGAACKAAG 60

Query: 190 AKRAVFLPVS 199
           AKRA+ LPVS
Sbjct: 61  AKRALPLPVS 70

SCOP domain information

class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: Probable ACP-binding domain of malonyl-CoA ACP transacylase
family: Probable ACP-binding domain of malonyl-CoA ACP transacylase
domain: Probable ACP-binding domain of malonyl-CoA ACP transacylase
species: Escherichia coli [TaxId: 562]