BLAST/PSIBLAST alignment of GI: 254780542 and GI: 23501790 at iteration 1
>gi|23501790|ref|NP_697917.1| hypothetical protein BR0904 [Brucella suis 1330] Length = 156
>gi|62289847|ref|YP_221640.1| hypothetical protein BruAb1_0915 [Brucella abortus bv. 1 str. 9-941] Length = 156
>gi|82699773|ref|YP_414347.1| hypothetical protein BAB1_0922 [Brucella melitensis biovar Abortus 2308] Length = 156
>gi|148559612|ref|YP_001258882.1| hypothetical protein BOV_0900 [Brucella ovis ATCC 25840] Length = 156
>gi|161618862|ref|YP_001592749.1| hypothetical protein BCAN_A0917 [Brucella canis ATCC 23365] Length = 156
>gi|163843175|ref|YP_001627579.1| hypothetical protein BSUIS_A0943 [Brucella suis ATCC 23445] Length = 156
>gi|225852416|ref|YP_002732649.1| hypothetical protein BMEA_A0943 [Brucella melitensis ATCC 23457] Length = 156
>gi|254689153|ref|ZP_05152407.1| hypothetical protein Babob68_02995 [Brucella abortus bv. 6 str. 870] Length = 156
>gi|254693636|ref|ZP_05155464.1| hypothetical protein Babob3T_03019 [Brucella abortus bv. 3 str. Tulya] Length = 156
>gi|254697288|ref|ZP_05159116.1| hypothetical protein Babob28_06109 [Brucella abortus bv. 2 str. 86/8/59] Length = 156
>gi|254701668|ref|ZP_05163496.1| hypothetical protein Bsuib55_12531 [Brucella suis bv. 5 str. 513] Length = 156
>gi|254704211|ref|ZP_05166039.1| hypothetical protein Bsuib36_09839 [Brucella suis bv. 3 str. 686] Length = 156
>gi|254706887|ref|ZP_05168715.1| hypothetical protein BpinM_07851 [Brucella pinnipedialis M163/99/10] Length = 156
>gi|254710005|ref|ZP_05171816.1| hypothetical protein BpinB_06966 [Brucella pinnipedialis B2/94] Length = 156
>gi|254714006|ref|ZP_05175817.1| hypothetical protein BcetM6_11741 [Brucella ceti M644/93/1] Length = 156
>gi|254716935|ref|ZP_05178746.1| hypothetical protein BcetM_11037 [Brucella ceti M13/05/1] Length = 156
>gi|254730186|ref|ZP_05188764.1| hypothetical protein Babob42_03034 [Brucella abortus bv. 4 str. 292] Length = 156
>gi|256031500|ref|ZP_05445114.1| hypothetical protein BpinM2_12743 [Brucella pinnipedialis M292/94/1] Length = 156
>gi|256044577|ref|ZP_05447481.1| hypothetical protein Bmelb1R_08773 [Brucella melitensis bv. 1 str. Rev.1] Length = 156
>gi|256061009|ref|ZP_05451166.1| hypothetical protein Bneo5_11692 [Brucella neotomae 5K33] Length = 156
>gi|256113450|ref|ZP_05454291.1| hypothetical protein Bmelb3E_11952 [Brucella melitensis bv. 3 str. Ether] Length = 156
>gi|256159625|ref|ZP_05457387.1| hypothetical protein BcetM4_11713 [Brucella ceti M490/95/1] Length = 156
>gi|256254905|ref|ZP_05460441.1| hypothetical protein BcetB_11530 [Brucella ceti B1/94] Length = 156
>gi|256257403|ref|ZP_05462939.1| hypothetical protein Babob9C_08584 [Brucella abortus bv. 9 str. C68] Length = 156
>gi|256369332|ref|YP_003106840.1| hypothetical protein BMI_I903 [Brucella microti CCM 4915] Length = 156
>gi|260168633|ref|ZP_05755444.1| hypothetical protein BruF5_09729 [Brucella sp. F5/99] Length = 156
>gi|260563928|ref|ZP_05834414.1| conserved hypothetical protein [Brucella melitensis bv. 1 str. 16M] Length = 156
>gi|261213902|ref|ZP_05928183.1| conserved hypothetical protein [Brucella abortus bv. 3 str. Tulya] Length = 156
>gi|261218741|ref|ZP_05933022.1| conserved hypothetical protein [Brucella ceti M13/05/1] Length = 156
>gi|261222087|ref|ZP_05936368.1| conserved hypothetical protein [Brucella ceti B1/94] Length = 156
>gi|261317553|ref|ZP_05956750.1| conserved hypothetical protein [Brucella pinnipedialis B2/94] Length = 156
>gi|261321760|ref|ZP_05960957.1| conserved hypothetical protein [Brucella ceti M644/93/1] Length = 156
>gi|261752220|ref|ZP_05995929.1| conserved hypothetical protein [Brucella suis bv. 5 str. 513] Length = 156
>gi|261754879|ref|ZP_05998588.1| conserved hypothetical protein [Brucella suis bv. 3 str. 686] Length = 156
>gi|261758106|ref|ZP_06001815.1| conserved hypothetical protein [Brucella sp. F5/99] Length = 156
>gi|265988587|ref|ZP_06101144.1| conserved hypothetical protein [Brucella pinnipedialis M292/94/1] Length = 156
>gi|265994838|ref|ZP_06107395.1| conserved hypothetical protein [Brucella melitensis bv. 3 str. Ether] Length = 156
>gi|265998052|ref|ZP_06110609.1| conserved hypothetical protein [Brucella ceti M490/95/1] Length = 156
>gi|297248252|ref|ZP_06931970.1| hypothetical protein BAYG_01190 [Brucella abortus bv. 5 str. B3196] Length = 156
>gi|23347721|gb|AAN29832.1| conserved hypothetical protein [Brucella suis 1330] Length = 156
>gi|62195979|gb|AAX74279.1| conserved hypothetical protein [Brucella abortus bv. 1 str. 9-941] Length = 156
>gi|82615874|emb|CAJ10878.1| conserved hypothetical protein [Brucella melitensis biovar Abortus 2308] Length = 156
>gi|148370869|gb|ABQ60848.1| conserved hypothetical protein [Brucella ovis ATCC 25840] Length = 156
>gi|161335673|gb|ABX61978.1| Hypothetical protein BCAN_A0917 [Brucella canis ATCC 23365] Length = 156
>gi|163673898|gb|ABY38009.1| Hypothetical protein BSUIS_A0943 [Brucella suis ATCC 23445] Length = 156
>gi|225640781|gb|ACO00695.1| Hypothetical protein, conserved [Brucella melitensis ATCC 23457] Length = 156
>gi|255999492|gb|ACU47891.1| hypothetical protein BMI_I903 [Brucella microti CCM 4915] Length = 156
>gi|260153944|gb|EEW89036.1| conserved hypothetical protein [Brucella melitensis bv. 1 str. 16M] Length = 156
>gi|260915509|gb|EEX82370.1| conserved hypothetical protein [Brucella abortus bv. 3 str. Tulya] Length = 156
>gi|260920671|gb|EEX87324.1| conserved hypothetical protein [Brucella ceti B1/94] Length = 156
>gi|260923830|gb|EEX90398.1| conserved hypothetical protein [Brucella ceti M13/05/1] Length = 156
>gi|261294450|gb|EEX97946.1| conserved hypothetical protein [Brucella ceti M644/93/1] Length = 156
>gi|261296776|gb|EEY00273.1| conserved hypothetical protein [Brucella pinnipedialis B2/94] Length = 156
>gi|261738090|gb|EEY26086.1| conserved hypothetical protein [Brucella sp. F5/99] Length = 156
>gi|261741973|gb|EEY29899.1| conserved hypothetical protein [Brucella suis bv. 5 str. 513] Length = 156
>gi|261744632|gb|EEY32558.1| conserved hypothetical protein [Brucella suis bv. 3 str. 686] Length = 156
>gi|262552520|gb|EEZ08510.1| conserved hypothetical protein [Brucella ceti M490/95/1] Length = 156
>gi|262765951|gb|EEZ11740.1| conserved hypothetical protein [Brucella melitensis bv. 3 str. Ether] Length = 156
>gi|264660784|gb|EEZ31045.1| conserved hypothetical protein [Brucella pinnipedialis M292/94/1] Length = 156
>gi|297175421|gb|EFH34768.1| hypothetical protein BAYG_01190 [Brucella abortus bv. 5 str. B3196] Length = 156
 Score =  147 bits (372), Expect = 8e-34,   Method: Compositional matrix adjust.
 Identities = 61/103 (59%), Positives = 80/103 (77%)

Query: 20  ANSARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQRIDAF 79
           A + R +N VA+F+G+DKITGR+ TFDV IN++ QFG+L + P VCYSR + EA R DAF
Sbjct: 42  ARAERISNPVAQFSGLDKITGRITTFDVYINETVQFGALQVTPKVCYSRTEDEAPRTDAF 101

Query: 80  VSISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCK 122
           V++ EI  DR +R IF+GWMFADSP +NA++H IYD+WL  CK
Sbjct: 102 VTVDEITLDRKIRRIFTGWMFADSPGLNAVEHPIYDVWLKDCK 144