RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254780542|ref|YP_003064955.1| hypothetical protein CLIBASIA_02145 [Candidatus Liberibacter asiaticus str. psy62] (210 letters) >gnl|CDD|150579 pfam09923, DUF2155, Uncharacterized protein conserved in bacteria (DUF2155). This domain, found in various hypothetical prokaryotic proteins, has no known function. Length = 91 Score = 123 bits (311), Expect = 3e-29 Identities = 37/92 (40%), Positives = 55/92 (59%), Gaps = 1/92 (1%) Query: 30 AEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQRIDAFVSISEIFTDR 89 A G+DKITGR ++++ ++A+FG+L + C R E DAF + I Sbjct: 1 AVLRGLDKITGRTTDLELKVGETARFGALQVTLRECEKRYPEENPDGDAFAEL-TIRERG 59 Query: 90 IVRSIFSGWMFADSPAMNAIDHSIYDIWLMQC 121 IFSGWMFA SPA+NA++H YD+W+++C Sbjct: 60 DGEPIFSGWMFASSPALNALEHPRYDVWVLRC 91 >gnl|CDD|132141 TIGR03097, PEP_O_lig_1, probable O-glycosylation ligase, exosortase system type 1-associated. These proteins are members of the O-antigen polymerase (wzy) family described by Pfam model pfam04932. This group is associated with genomes and ususally genomic contexts containing elements of the exosortase/PEP-CTERM protein export system, specificially the type 1 variety of this system described by the Genome Property, GenProp0652. Length = 402 Score = 27.4 bits (61), Expect = 2.6 Identities = 14/56 (25%), Positives = 20/56 (35%), Gaps = 7/56 (12%) Query: 66 YSRDDREAQRIDAFVSISEIFTDRIVR-SIFSGW------MFADSPAMNAIDHSIY 114 Y D RI+A++ + DR + F +A P HSIY Sbjct: 266 YEEDASAMGRINAWLLAWNLAKDRPLVGGGFEYQDEFRFSTYAPVPTNVHAAHSIY 321 >gnl|CDD|183443 PRK12328, nusA, transcription elongation factor NusA; Provisional. Length = 374 Score = 27.3 bits (61), Expect = 3.3 Identities = 15/48 (31%), Positives = 22/48 (45%) Query: 37 KITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQRIDAFVSISE 84 K G +DVEI+ + L K V D+R + F+S+SE Sbjct: 36 KELGPEYEYDVEIDPENKTLKLYQKIEVVADDDERLQNDPEKFISLSE 83 >gnl|CDD|182265 PRK10144, PRK10144, formate-dependent nitrite reductase complex subunit NrfF; Provisional. Length = 126 Score = 26.8 bits (59), Expect = 4.3 Identities = 10/27 (37%), Positives = 17/27 (62%) Query: 1 MKYRVLLLILFFVFSHAKFANSARFAN 27 K + LL+LF F+ A+ ++ +FAN Sbjct: 1 NKGLLTLLLLFTCFARAQVVDTWQFAN 27 >gnl|CDD|130809 TIGR01748, rhaA, L-rhamnose isomerase. This enzyme interconverts L-rhamnose and L-rhamnulose. In some species, including E. coli, this is the first step in rhamnose catabolism. Sequential steps are catalyzed by rhamnulose kinase (rhaB), then rhamnulose-1-phosphate aldolase (rhaD) to yield glycerone phosphate and (S)-lactaldehyde. Characterization of this family is based on members in E. coli and Salmonella. Length = 414 Score = 26.4 bits (58), Expect = 5.1 Identities = 10/30 (33%), Positives = 15/30 (50%) Query: 93 SIFSGWMFADSPAMNAIDHSIYDIWLMQCK 122 + FS + AD ++ D SI W+ CK Sbjct: 130 TCFSHPLSADGFTLSHPDDSIRQFWIDHCK 159 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.315 0.129 0.359 Gapped Lambda K H 0.267 0.0711 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 3,144,291 Number of extensions: 182351 Number of successful extensions: 332 Number of sequences better than 10.0: 1 Number of HSP's gapped: 331 Number of HSP's successfully gapped: 13 Length of query: 210 Length of database: 5,994,473 Length adjustment: 89 Effective length of query: 121 Effective length of database: 4,071,361 Effective search space: 492634681 Effective search space used: 492634681 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 55 (25.0 bits)