HHsearch alignment for GI: 254780544 and conserved domain: KOG2537

>KOG2537 consensus.
Probab=100.00  E-value=1.9e-37  Score=250.58  Aligned_cols=353  Identities=22%  Similarity=0.302  Sum_probs=251.4

Q ss_pred             CCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCEEEEECCCCHHHHHHHHHHHCCCEEEEEEECCCCCCCEEEEEECCCCC
Q ss_conf             79983899966877979999999999997898799962678089999998719925898865477752012564036545
Q gi|254780544|r   40 KKHRRVVIGKDTRLSGYMLENSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGY  119 (448)
Q Consensus        40 ~~~~~vvVg~D~R~~s~~~~~~~~~gl~~~G~~V~~~g~~ptP~l~~a~~~~~~~gGI~iTaSHNP~~~nGiK~~~~~G~  119 (448)
T Consensus       122 t~~~~v~~G~DtR~s~~~L~~~~~~~~~~l~a~~~d~GvvtTPqLHy~v~~~n~~-~~~~-~~-----------------  182 (539)
T KOG2537         122 TVSAHVVVGRDTRPSSPRLLNAVRDGVGALFAQVDDYGVVTTPQLHYMVRASNTK-GAYG-KG-----------------  182 (539)
T ss_pred             CCCCEEEEECCCCCCCHHHHHHHHHHHHHHHEEECCEEEECCHHHHHHHHHCCCC-CCCC-CC-----------------
T ss_conf             5221699803798752789988888888664285326887512665666433555-6556-67-----------------


Q ss_pred             CCCHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHCCCCH------HHCCCCEEEEEECCCCCCCCCC
Q ss_conf             6783578999999615664334454332221113542566688776326310------2118966999844665433332
Q gi|254780544|r  120 KVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRD------VTLQGLRIVVDCANGASYKVAP  193 (448)
Q Consensus       120 ~i~~~~~~~Ie~~~~~~~~~~~~~~~~~~~~~~~~~~~~~Yi~~l~~~~~~~------~~~~~lkvvvD~~~G~~~~~~~  193 (448)
T Consensus       183 --~~t~--------------------------------~~Y~~~ls~af~~l~~~~~~~~~~~~k~~VD~ANGvG~~klk  228 (539)
T KOG2537         183 --KPTE--------------------------------EGYYSKLSKAFNELRNITQESGDEVSKLIVDCANGVGAPKLK  228 (539)
T ss_pred             --CCCC--------------------------------CCHHHHHHHHHHHHHHHCCCCCCCCCEEEEECCCCCCHHHHH
T ss_conf             --7883--------------------------------207788988788765301246776623899885655628788


Q ss_pred             CCCCCCC--CCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHCC---CCC-CEEEEECCCCCCCCCC--CCCC--CCCCCCH
Q ss_conf             2212333--222222232223557744221013777642002---343-0367531552100013--3223--7553311
Q gi|254780544|r  194 EVFWELG--ADVVVIGDKPNGININLDCGSTNVLSLQRKVHE---VRA-DIGIALDGDGDRVIIV--DEKG--AIVNGDQ  263 (448)
Q Consensus       194 ~il~~lg--~~~~~i~~~pd~~~~~~~~~~~~~~~l~~~v~~---~~a-d~Gia~DgD~DR~~iv--d~~G--~~i~~d~  263 (448)
T Consensus       229 ~l~~i~~~~l~vEivNd~~dpelLN~~CGADFVkt~QkpP~~~~~~~~~~~caSfDGDADRlvyf~~~~~~~f~llDGDk  308 (539)
T KOG2537         229 ELLGIDSGLLNVEVVNDGIDPGLLNNGCGADFVKTKQKPPKGLSPIKANTRCASFDGDADRLVYFYIDDDSEFHLLDGDK  308 (539)
T ss_pred             HHHCCCCCCCCEEEECCCCCHHHHCCCCCCCHHHCCCCCCCCCCCCCCCCCEEEEECCCCEEEEEEECCCCEEEEECCHH
T ss_conf             88515887674699718987545415656342210466988889888887503440356516999936984067624508


Q ss_pred             HHHHHHHHHHHHHCC----CCCCCCCCCCCCCHHHHHHHC-CCCCCCCCCCCCCCHHHHHHCCCCEECCCCCCE--EEEE
Q ss_conf             356777765532002----234333221136004443200-121111123321101111102897001346623--6530
Q gi|254780544|r  264 IMALIAREWMSHSLL----RGNGIVTTVMSNIGLERFIAG-LGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGH--IILS  336 (448)
Q Consensus       264 ~~~lla~~ll~~~~~----~~~~vv~~v~ss~~i~~~a~~-~g~~v~~t~vG~k~i~~~~~~~~~~~g~E~sg~--~~~~  336 (448)
T Consensus       309 istlla~~l~~ll~~~~~~l~~GvVqtaYaNgast~yl~~~l~~~vv~v~tGvKhlh~~A~efDiGiyFEaNGHGti~FS  388 (539)
T KOG2537         309 IATLIAGYLRELLKQIELSLRLGVVQTAYANGASTDYLKETLKFPVVCVPTGVKHLHHAAAEFDIGIYFEANGHGTILFS  388 (539)
T ss_pred             HHHHHHHHHHHHHHHHHCCCEEEEEEEEEECCCCHHHHHHHCCCCEEEECCCCCHHHHHHHHHCCEEEEECCCCCCEEEH
T ss_conf             99999999999999851452000589886258507666653188657710254348888886161269850676212310


Q ss_pred             C-------------------------------CCCCCCCCCCCCHHHHHHHHCCCCHHHHHHHHHHCCCEEEEEECCCCC
Q ss_conf             1-------------------------------000144423320246677755888899998656423000000056765
Q gi|254780544|r  337 D-------------------------------YGSTGDGLVAALQVLRYIKQYDKPVSTICHCFEEYPQFLRSVSVKDTS  385 (448)
Q Consensus       337 ~-------------------------------~~~~~Dgi~a~l~~le~l~~~~~~l~~l~~~l~~~~~~~~~~~~~~~~  385 (448)
T Consensus       389 ~~~~~~i~~~~~~~~~~~~~a~~~L~~~~~Linq~vGDAisd~llv~~il~~~~~s~~~w~e~y~dlPnrq~Kv~v~Dr~  468 (539)
T KOG2537         389 EAFLATIKDLAETKEPGESKALKTLKLLSDLINQTVGDAISDMLAVEAILAHKGWSVQDWDELYRDLPNRQLKVKVPDRS  468 (539)
T ss_pred             HHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHCCCCHHHHCCHHHHHHHHHHCCCCHHHHHHHHCCCCCCEEEEEECCCE
T ss_conf             77787545565178752149999999987653212013320059999999863777878899835786634777750220


Q ss_pred             CCCHHHHHHHHHH----------HHHHCCCCCEEEEECCCCCCEEEEEEECCCHHHHHHHHHHHHHHHHHH
Q ss_conf             1155899999876----------554307886599967798227999961599899999999999998752
Q gi|254780544|r  386 ILNSSSIVQAIAD----------AESELRGIDRLIVRASGTESLIRIMAEGDDLSRIKRIVDDLAKVIPMI  446 (448)
Q Consensus       386 ~~~~~~i~~~~~~----------~~~~~~~~~w~liRpSgTEp~iriy~Ea~~~~~~~~l~~~~~~~i~~i  446 (448)
T Consensus       469 i~~ttdaer~~v~P~glQ~~Ida~vaky-~~gRaFvR~SGTEdvVRVYAEa~t~~~~d~l~~~v~~~v~~~  538 (539)
T KOG2537         469 IIKTTDAERQLVKPVGLQDKIDALVAKY-KRGRSFVRPSGTEDVVRVYAEASTKEDADQLALEVAQLVLKL  538 (539)
T ss_pred             EEECHHHHHHCCCCHHHHHHHHHHHHHC-CCCCEEEECCCCCCEEEEEEECCCHHHHHHHHHHHHHHHHHH
T ss_conf             3412055553279488999999988623-588517702676203788874685455899999999999852