HHsearch alignment for GI: 254780544 and conserved domain: cd03086

>cd03086 PGM3 PGM3 (phosphoglucomutase 3), also known as PAGM (phosphoacetylglucosamine mutase) and AGM1 (N-acetylglucosamine-phosphate mutase), is an essential enzyme found in eukaryotes that reversibly catalyzes the conversion of GlcNAc-6-phosphate into GlcNAc-1-phosphate as part of the UDP-N-acetylglucosamine (UDP-GlcNAc) biosynthetic pathway. UDP-GlcNAc is an essential metabolite that serves as the biosynthetic precursor of many glycoproteins and mucopolysaccharides. AGM1 is a member of the alpha-D-phosphohexomutase superfamily, which catalyzes the intramolecular phosphoryl transfer of sugar substrates. The alpha-D-phosphohexomutases have four domains with a centrally located active site formed by four loops, one from each domain. All four domains are included in this alignment model.
Probab=100.00  E-value=0  Score=459.17  Aligned_cols=349  Identities=25%  Similarity=0.368  Sum_probs=264.4

Q ss_pred             CEEEEEEECCCCCCCEEEEEECCCCCCCCHHHHHHHHHHHHCCCCCCCCC-----------CCC-------CCCCC----
Q ss_conf             25898865477752012564036545678357899999961566433445-----------433-------22211----
Q gi|254780544|r   94 DVGVMISASHNPYQDNGIKLFGPDGYKVSTDIEDRIETLLEDDLTSYLSC-----------YDS-------IGHAK----  151 (448)
Q Consensus        94 ~gGI~iTaSHNP~~~nGiK~~~~~G~~i~~~~~~~Ie~~~~~~~~~~~~~-----------~~~-------~~~~~----  151 (448)
T Consensus        36 ~~GVmITASHNP~~dNGiK~f~~~G~kL~~~~E~~ie~l~n~~~~~~~~~~~~~~~~~~~~~~~~~~~~VvIGRDtR~Sg  115 (513)
T cd03086          36 TIGVMITASHNPVEDNGVKIVDPDGEMLEESWEPYATQLANASDDELLVLVLMLISVKELNIDLSVPANVFVGRDTRPSG  115 (513)
T ss_pred             CEEEEEECCCCCHHHCCEEEECCCCCCCCHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHCCCCCCCCCEEEECCCCCCH
T ss_conf             18999982789903578879899988279899999999745875566666554211233302334565068621577667


Q ss_pred             -----------------------------------------CCCCHHHHHHHHHHHCCC------CHHHCCCCEEEEEEC
Q ss_conf             -----------------------------------------135425666887763263------102118966999844
Q gi|254780544|r  152 -----------------------------------------RVDGVHDRYIEHVKRTLP------RDVTLQGLRIVVDCA  184 (448)
Q Consensus       152 -----------------------------------------~~~~~~~~Yi~~l~~~~~------~~~~~~~lkvvvD~~  184 (448)
T Consensus       116 ~~L~~av~~gl~s~g~~v~d~G~~tTP~l~y~V~~~n~~~~~~~~~~~~y~~~~~~~f~~l~~~~~~~~~~~~kvvvD~a  195 (513)
T cd03086         116 PALLQALLDGLKALGGNVIDYGLVTTPQLHYLVRAANTEGAYGEPTEEGYYEKLSKAFNELYNLLQDGGDEPEKLVVDCA  195 (513)
T ss_pred             HHHHHHHHHHHHHCCCEEEEECCCCCCHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCCCCEEEEECC
T ss_conf             99999999888762975886232278148788776156555566525679999999999986334445678887999899


Q ss_pred             CCCCCCCCCCCCCCC--CCCCCCCCCCCCC-CCCCCCCCCCHHHHHH----HHHCCCCCCEEEEECCCCCCCCC--CCCC
Q ss_conf             665433332221233--3222222232223-5577442210137776----42002343036753155210001--3322
Q gi|254780544|r  185 NGASYKVAPEVFWEL--GADVVVIGDKPNG-ININLDCGSTNVLSLQ----RKVHEVRADIGIALDGDGDRVII--VDEK  255 (448)
Q Consensus       185 ~G~~~~~~~~il~~l--g~~~~~i~~~pd~-~~~~~~~~~~~~~~l~----~~v~~~~ad~Gia~DgD~DR~~i--vd~~  255 (448)
T Consensus       196 NG~a~~~~~~l~~~l~~~~~v~v~n~~~~~~~~iN~~cGa~~v~~~~~~p~~~~~~~~~~~~~A~DGDADRli~~~vde~  275 (513)
T cd03086         196 NGVGALKLKELLKRLKKGLSVKIINDGEEGPELLNDGCGADYVKTKQKPPRGFELKPPGVRCCSFDGDADRLVYFYPDSS  275 (513)
T ss_pred             CCHHHHHHHHHHHHHHCCCEEEEEECCCCCCHHCCCCCCCCCHHCCCCCCHHHHHHCCCCEEEEECCCCCEEEEEEECCC
T ss_conf             74677888999987504861899968999800015656876311032110555541122446654488763789998799


Q ss_pred             CCC--CCCCHHHHHHHHHHHHHHC---CCC---CCCCCCCCCCCHHHHHHHC-CCCCCCCCCCCCCCHHHHHHCCCCEEC
Q ss_conf             375--5331135677776553200---223---4333221136004443200-121111123321101111102897001
Q gi|254780544|r  256 GAI--VNGDQIMALIAREWMSHSL---LRG---NGIVTTVMSNIGLERFIAG-LGLSLKRTEVGDRYIMEYMKNNGFNVG  326 (448)
Q Consensus       256 G~~--i~~d~~~~lla~~ll~~~~---~~~---~~vv~~v~ss~~i~~~a~~-~g~~v~~t~vG~k~i~~~~~~~~~~~g  326 (448)
T Consensus       276 G~~~lvDGD~il~llA~~~~~~~~~~~~~~~l~~gvV~T~~sN~~s~~~l~~~~gi~v~~t~vG~k~v~~~~~~~digi~  355 (513)
T cd03086         276 NKFHLLDGDKIATLFAKFIKELLKKAGEELKLTIGVVQTAYANGASTKYLEDVLKVPVVCTPTGVKHLHHAAEEFDIGVY  355 (513)
T ss_pred             CCEEECCCCHHHHHHHHHHHHHHHHCCCCCCCCCCEEEEEECCHHHHHHHHHHCCCEEEEECCCHHHHHHHHHHCCCCEE
T ss_conf             98521372199999999999998624566673222799852253679999984397589916607999999985085256


Q ss_pred             CCCCCE--EEEECC------------------------------CCCCCCCCCCCHHHHHHHHCCCCHHHHHHHHHHCCC
Q ss_conf             346623--653010------------------------------001444233202466777558888999986564230
Q gi|254780544|r  327 GEQSGH--IILSDY------------------------------GSTGDGLVAALQVLRYIKQYDKPVSTICHCFEEYPQ  374 (448)
Q Consensus       327 ~E~sg~--~~~~~~------------------------------~~~~Dgi~a~l~~le~l~~~~~~l~~l~~~l~~~~~  374 (448)
T Consensus       356 fE~nGhG~vi~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~l~~~ttGDgi~~~l~~~~~l~~~~~s~~~l~~~~~~~Pq  435 (513)
T cd03086         356 FEANGHGTVLFSESALAKIEENSSLSDEQEKAAKTLLAFSRLINQTVGDAISDMLAVELILAALGWSPQDWDNLYTDLPN  435 (513)
T ss_pred             EEECCCEEEEECHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHCCCCHHHHHHHCCCCCC
T ss_conf             31037704995577877886520246420037899999987425777368999999999999819998999864642572


Q ss_pred             EEEEEECCCCCCCCH----------HHHHHHHHHHHHHCCCCCEEEEECCCCCCEEEEEEECCCHHHHHHHHHHHHHHH
Q ss_conf             000000567651155----------899999876554307886599967798227999961599899999999999998
Q gi|254780544|r  375 FLRSVSVKDTSILNS----------SSIVQAIADAESELRGIDRLIVRASGTESLIRIMAEGDDLSRIKRIVDDLAKVI  443 (448)
Q Consensus       375 ~~~~~~~~~~~~~~~----------~~i~~~~~~~~~~~~~~~w~liRpSgTEp~iriy~Ea~~~~~~~~l~~~~~~~i  443 (448)
T Consensus       436 ~~~nv~v~~k~~~~~~~~e~~~~~p~~lq~~Id~~~~~~~-~grvlVRpSGTEPlvRV~vEA~~~e~a~~l~~ei~~~V  513 (513)
T cd03086         436 RQLKVKVPDRSVIKTTDAERRLVEPKGLQDKIDAIVAKYN-NGRAFVRPSGTEDVVRVYAEAATQEEADELANEVAELV  513 (513)
T ss_pred             EEEEEEECCCCCCCCCHHHHHHCCCHHHHHHHHHHHHHCC-CEEEEEECCCCCEEEEEEEEECCHHHHHHHHHHHHHHC
T ss_conf             3777871672000142566653271879999999996149-85899923799718799982299999999999998459