HHsearch alignment for GI: 254780544 and conserved domain: cd03088

>cd03088 ManB ManB is a bacterial phosphomannomutase (PMM) that catalyzes the conversion of mannose 6-phosphate to mannose-1-phosphate in the second of three steps in the GDP-mannose pathway, in which GDP-D-mannose is synthesized from fructose-6-phosphate. In Mycobacterium tuberculosis, the causative agent of tuberculosis, PMM is involved in the biosynthesis of mannosylated lipoglycans that participate in the association of mycobacteria with host macrophage phagocytic receptors. ManB belongs to the the alpha-D-phosphohexomutase superfamily which includes several related enzymes that catalyze a reversible intramolecular phosphoryl transfer on their sugar substrates. Other members of this superfamily include the phosphoglucomutases (PGM1 and PGM2), phosphoglucosamine mutase (PNGM), phosphoacetylglucosamine mutase (PAGM), the bacterial phosphoglucosamine mutase GlmM, and the bifunctional phosphomannomutase/phosphoglucomutase (PMM/PGM). Each of these enzymes has four domains with a centrall
Probab=100.00  E-value=0  Score=643.24  Aligned_cols=416  Identities=25%  Similarity=0.339  Sum_probs=337.0

Q ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHHHHHHHHHCCCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCEEEEECCCCHHHHH
Q ss_conf             33586015506877889999999999999997237998389996687797999999999999789879996267808999
Q gi|254780544|r    6 FGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSLVAGFTAAGMDAFILGPIPSPAVA   85 (448)
Q Consensus         6 FGt~GiRG~~~~~~~t~~~v~~i~~a~~~~~~~~~~~~~vvVg~D~R~~s~~~~~~~~~gl~~~G~~V~~~g~~ptP~l~   85 (448)
T Consensus         2 FGT~GiRGi~~--~~t~~~v~~~~~a~a~~l~~~~~~~~VvVG~D~R~~S~~~a~~~a~~l~s~Gi~V~~~g~~pTP~l~   79 (459)
T cd03088           2 FGTSGLRGLVT--DLTDEVCYAYTRAFLQHLESKFPGDTVAVGRDLRPSSPRIAAACAAALRDAGFRVVDCGAVPTPALA   79 (459)
T ss_pred             CCCCCCCEECC--CCCHHHHHHHHHHHHHHHHHHCCCCEEEEEECCCCCHHHHHHHHHHHHHHCCCEEEECCCCCHHHHH
T ss_conf             89987075858--8999999999999999999758998699996899787999999999999779979978989858999


Q ss_pred             HHHHHHCCCEEEEEEECCCCCCCEEEEEECCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHH
Q ss_conf             99987199258988654777520125640365456783578999999615664334454332221113542566688776
Q gi|254780544|r   86 MLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVK  165 (448)
Q Consensus        86 ~a~~~~~~~gGI~iTaSHNP~~~nGiK~~~~~G~~i~~~~~~~Ie~~~~~~~~~~~~~~~~~~~~~~~~~~~~~Yi~~l~  165 (448)
T Consensus        80 ~~v~~~~~-~gImITASHNP~eyNG~K~~~~~G-~i~~~~e~~i~~~~~~~~~~~~~--~~~~~~~~~~~~~~~Yi~~~~  155 (459)
T cd03088          80 LYAMKRGA-PAIMVTGSHIPADRNGLKFYRPDG-EITKADEAAILAALVELPEALFD--PAGALLPPDTDAADAYIARYT  155 (459)
T ss_pred             HHHHHCCC-CEEEEECCCCCCCCEEEEEECCCC-CCCHHHHHHHHHHHHHCCCCCCC--CCCCCCCCHHHHHHHHHHHHH
T ss_conf             99985468-639996578997543899988999-68868899999997420034555--445774001447999999999


Q ss_pred             HCCCCHHHCCCCEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCHHHHHHHHHCCCCCCEEEEECC
Q ss_conf             326310211896699984466543333222123332222222322235577442-2101377764200234303675315
Q gi|254780544|r  166 RTLPRDVTLQGLRIVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDC-GSTNVLSLQRKVHEVRADIGIALDG  244 (448)
Q Consensus       166 ~~~~~~~~~~~lkvvvD~~~G~~~~~~~~il~~lg~~~~~i~~~pd~~~~~~~~-~~~~~~~l~~~v~~~~ad~Gia~Dg  244 (448)
T Consensus       156 ~~~~~~~-~~~~~i~vd~~~g~g~~~~~~il~~lG~~vi~l~~~~~f~p~~~e~~~~e~~~~~~~~v~~~~aD~giA~Dg  234 (459)
T cd03088         156 DFFGAGA-LKGLRIGVYQHSSVGRDLLVRILEALGAEVVPLGRSDTFIPVDTEAVRPEDRALAAAWAAEHGLDAIVSTDG  234 (459)
T ss_pred             HHCCHHH-HCCCEEEEECCCCCHHHHHHHHHHHCCCEEEEECCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEEEECC
T ss_conf             8557366-459889997788505778899999749889995788999998999999679999999998548876886458


Q ss_pred             CCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHCCCCCCCCCCCCCCCHHHHHHC----
Q ss_conf             5210001332237553311356777765532002234333221136004443200121111123321101111102----
Q gi|254780544|r  245 DGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLGLSLKRTEVGDRYIMEYMKN----  320 (448)
Q Consensus       245 D~DR~~ivd~~G~~i~~d~~~~lla~~ll~~~~~~~~~vv~~v~ss~~i~~~a~~~g~~v~~t~vG~k~i~~~~~~----  320 (448)
T Consensus       235 DaDR~~vvD~~G~~l~gd~l~~L~a~~l~------~~~vv~~v~s~~~~~~--~~~~~~v~~T~vG~~~i~~~m~~~~~~  306 (459)
T cd03088         235 DGDRPLVADETGEWLRGDILGLLTARFLG------ADTVVTPVSSNSAIEL--SGFFKRVVRTRIGSPYVIAAMAEAAAA  306 (459)
T ss_pred             CCCEEEEECCCCCCCCHHHHHHHHHHHHC------CCEEEEEEECHHHHHH--HCCCCCEEEECCCCHHHHHHHHHHHHC
T ss_conf             87602013799888373999999999865------9916965741199997--178982699636679999999997632


Q ss_pred             -CCCEECCCCCCEEEEECCCC----------CCCCCCCCCHHHHHHHHCCCCHHHHHHHHHHCCCEEEEEECCCCCCCCH
Q ss_conf             -89700134662365301000----------1444233202466777558888999986564230000000567651155
Q gi|254780544|r  321 -NGFNVGGEQSGHIILSDYGS----------TGDGLVAALQVLRYIKQYDKPVSTICHCFEEYPQFLRSVSVKDTSILNS  389 (448)
Q Consensus       321 -~~~~~g~E~sg~~~~~~~~~----------~~Dgi~a~l~~le~l~~~~~~l~~l~~~l~~~~~~~~~~~~~~~~~~~~  389 (448)
T Consensus       307 ~~~~~~G~E~sgg~~~~~~~~~~~~~~~al~~rD~~~~~l~~l~~~~~~~~~l~~l~~~l~~~~~~~~~~--~~~p~~~~  384 (459)
T cd03088         307 GAGRVVGYEANGGFLLGSDIERNGRTLKALPTRDAVLPILAVLAAAKEAGIPLSELVASLPARFTASDRL--QNFPTEKS  384 (459)
T ss_pred             CCCEEEEEEEECCEEECCCCCCCCCHHHCCCCHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHCCHHHHH--HCCCHHHH
T ss_conf             5682899997486998982314862220301134799999999999876998999998700223645776--32867789


Q ss_pred             HHHHHHHHHHH-----------------HH-------CCCCCEEEEECCCCCCEEEEEEECCCHHHHHHHHHH
Q ss_conf             89999987655-----------------43-------078865999677982279999615998999999999
Q gi|254780544|r  390 SSIVQAIADAE-----------------SE-------LRGIDRLIVRASGTESLIRIMAEGDDLSRIKRIVDD  438 (448)
Q Consensus       390 ~~i~~~~~~~~-----------------~~-------~~~~~w~liRpSgTEp~iriy~Ea~~~~~~~~l~~~  438 (448)
T Consensus       385 ~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~DG~k~~~~dg~~l~iRpSgTEP~iriy~Ea~t~e~~~~ll~~  457 (459)
T cd03088         385 QALIARLSADPEARAAFFFALGGEVASIDTTDGLRMTFANGDIVHLRPSGNAPELRCYVEADSEERARELLAR  457 (459)
T ss_pred             HHHHHHHHCCHHHHHHHHHHCCCCCCCCCCCCEEEEEECCCCEEEEECCCCCEEEEEEEEECCHHHHHHHHHC
T ss_conf             9999997506777754444202420320266628999469809999757993889999973999999999866