HHsearch alignment for GI: 254780544 and conserved domain: cd05799

>cd05799 PGM2 This CD includes PGM2 (phosphoglucomutase 2) and PGM2L1 (phosphoglucomutase 2-like 1). The mammalian PGM2 is thought to be a phosphopentomutase that catalyzes the conversion of the nucleoside breakdown products, ribose-1-phosphate and deoxyribose-1-phosphate to the corresponding 5-phosphopentoses. PGM2L1 is thought to catalyze the 1,3-bisphosphoglycerate-dependent synthesis of glucose 1,6-bisphosphate and other aldose-bisphosphates that serve as cofactors for several sugar phosphomutases and possibly also as regulators of glycolytic enzymes. PGM2 and PGM2L1 belong to the alpha-D-phosphohexomutase superfamily which includes several related enzymes that catalyze a reversible intramolecular phosphoryl transfer on their sugar substrates. Other members of this superfamily include phosphoglucosamine mutase (PNGM), phosphoacetylglucosamine mutase (PAGM), the bacterial phosphomannomutase ManB, the bacterial phosphoglucosamine mutase GlmM, and the bifunctional phosphomannomutase/ph
Probab=100.00  E-value=0  Score=696.78  Aligned_cols=438  Identities=24%  Similarity=0.315  Sum_probs=353.6

Q ss_pred             CCCCCEEEEECC--CCCCHHHHHHHHHHHHHHHHHCC---CCCCEEEEECCCCCHHHHHHHHHHHHHHCCCEEEEE-CCC
Q ss_conf             335860155068--77889999999999999997237---998389996687797999999999999789879996-267
Q gi|254780544|r    6 FGTDGIRGKSNT--FPITPNFMMRIGIAVGYLFRGKK---KHRRVVIGKDTRLSGYMLENSLVAGFTAAGMDAFIL-GPI   79 (448)
Q Consensus         6 FGt~GiRG~~~~--~~~t~~~v~~i~~a~~~~~~~~~---~~~~vvVg~D~R~~s~~~~~~~~~gl~~~G~~V~~~-g~~   79 (448)
T Consensus         4 FGT~GiRG~vg~~~~~~n~~~v~~~~~a~~~~l~~~~~~~~~~~VvVG~DtR~ss~~~a~~~a~~l~~~G~~V~~~~g~~   83 (487)
T cd05799           4 FGTAGLRGKMGAGTNRMNDYTVRQATQGLANYLKKKGPDAKNRGVVIGYDSRHNSREFAELTAAVLAANGIKVYLFDDLR   83 (487)
T ss_pred             CCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCEEEEEECCCCCHHHHHHHHHHHHHHCCCEEEECCCCC
T ss_conf             55885252368998868899999999999999998567678986999978986789999999999997799799889978


Q ss_pred             CHHHHHHHHHHHCCCEEEEEEECCCCCCCEEEEEECCCCCCCCHHHHHHHHHHHHCCCCCCCCC---CCCCCCCCCC-CC
Q ss_conf             8089999998719925898865477752012564036545678357899999961566433445---4332221113-54
Q gi|254780544|r   80 PSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVSTDIEDRIETLLEDDLTSYLSC---YDSIGHAKRV-DG  155 (448)
Q Consensus        80 ptP~l~~a~~~~~~~gGI~iTaSHNP~~~nGiK~~~~~G~~i~~~~~~~Ie~~~~~~~~~~~~~---~~~~~~~~~~-~~  155 (448)
T Consensus        84 PTP~~~~~~~~~~a~~GImITASHNP~~~NGiK~~~~~G~~l~~~~~~~I~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~  163 (487)
T cd05799          84 PTPLLSFAVRHLGADAGIMITASHNPKEYNGYKVYWEDGAQIIPPHDAEIAEEIEAVLEPLDIKFEEALDSGLIKYIGEE  163 (487)
T ss_pred             CCHHHHHHHHHCCCCEEEEEECCCCCCCCCCEEEECCCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCCCEEECCHH
T ss_conf             85799999996199857999348997522777987799984786688999999984335211553100247852776487


Q ss_pred             HHHHHHHHHHHCCC-CH-HHCCCCEEEEEECCCCCCCCCCCCCCCCCCCCCCC---CCCCCCCCCC-CCCCCCH---HHH
Q ss_conf             25666887763263-10-21189669998446654333322212333222222---2322235577-4422101---377
Q gi|254780544|r  156 VHDRYIEHVKRTLP-RD-VTLQGLRIVVDCANGASYKVAPEVFWELGADVVVI---GDKPNGININ-LDCGSTN---VLS  226 (448)
Q Consensus       156 ~~~~Yi~~l~~~~~-~~-~~~~~lkvvvD~~~G~~~~~~~~il~~lg~~~~~i---~~~pd~~~~~-~~~~~~~---~~~  226 (448)
T Consensus       164 ~~~~Y~~~l~~~~~~~~~~~~~~lkVvvD~~nGa~~~~~~~ll~~lG~~~v~~v~~~~~pDg~Fp~~~~pnPe~~~~l~~  243 (487)
T cd05799         164 IDDAYLEAVKKLLVNPELNEGKDLKIVYTPLHGVGGKFVPRALKEAGFTNVIVVEEQAEPDPDFPTVKFPNPEEPGALDL  243 (487)
T ss_pred             HHHHHHHHHHHHCCCHHHHCCCCCEEEEECCCCCHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCHHHHHH
T ss_conf             89999999987568844640389779995798738999999999769972699333434799989999989652567999


Q ss_pred             HHHHHCCCCCCEEEEECCCCCCCCCC--CCCC--CCCCCCHHHHHHHHHHHHHHCCC-----CCCCCCCCCCCCHHHHHH
Q ss_conf             76420023430367531552100013--3223--75533113567777655320022-----343332211360044432
Q gi|254780544|r  227 LQRKVHEVRADIGIALDGDGDRVIIV--DEKG--AIVNGDQIMALIAREWMSHSLLR-----GNGIVTTVMSNIGLERFI  297 (448)
Q Consensus       227 l~~~v~~~~ad~Gia~DgD~DR~~iv--d~~G--~~i~~d~~~~lla~~ll~~~~~~-----~~~vv~~v~ss~~i~~~a  297 (448)
T Consensus       244 ~~~~v~~~~aD~Gia~DGDaDR~~vv~~d~~g~~~~i~GD~i~al~a~~ll~~~~~~~~~~~~~~vv~t~~ss~~~~~ia  323 (487)
T cd05799         244 AIELAKKVGADLILATDPDADRLGVAVKDKDGEWRLLTGNEIGALLADYLLEQRKEKGKLPKNPVIVKTIVSSELLRKIA  323 (487)
T ss_pred             HHHHHHHHCCCEEEEECCCCCCEEEEEECCCCCEEEECHHHHHHHHHHHHHHHHHHHCCCCCCCEEEEEECCCHHHHHHH
T ss_conf             99999852898899977888746899985899779706589999999999999887166789977999840627999999


Q ss_pred             HCCCCCCCCCCCCCCCHHHHHHC-----CCCEECCCCCCEEEEECCCCCCCCCCCCCHHHHHHH---HCCCCHHHHHHHH
Q ss_conf             00121111123321101111102-----897001346623653010001444233202466777---5588889999865
Q gi|254780544|r  298 AGLGLSLKRTEVGDRYIMEYMKN-----NGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIK---QYDKPVSTICHCF  369 (448)
Q Consensus       298 ~~~g~~v~~t~vG~k~i~~~~~~-----~~~~~g~E~sg~~~~~~~~~~~Dgi~a~l~~le~l~---~~~~~l~~l~~~l  369 (448)
T Consensus       324 ~~~g~~~~~t~VG~k~v~~~m~~~~~~~~~~~~ggEeS~G~~~~~~~~~~Dgi~aal~~lei~~~~~~~~~~l~e~l~~i  403 (487)
T cd05799         324 KKYGVKVEETLTGFKWIGNKIEELESGGKKFLFGFEESIGYLVGPFVRDKDGISAAALLAEMAAYLKAQGKTLLDRLDEL  403 (487)
T ss_pred             HHCCCEEEEECCCHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCHHHHHHHH
T ss_conf             98799799927870999999998655587537886110474557865578679999999999999987599899999999


Q ss_pred             -HHCC---CEEEEEECCCCCC-CCHHHHHHHHHHHH----HHCCCCCEEEEECCCCCCEEEEEEECCCHHHHHHHHHHHH
Q ss_conf             -6423---0000000567651-15589999987655----4307886599967798227999961599899999999999
Q gi|254780544|r  370 -EEYP---QFLRSVSVKDTSI-LNSSSIVQAIADAE----SELRGIDRLIVRASGTESLIRIMAEGDDLSRIKRIVDDLA  440 (448)
Q Consensus       370 -~~~~---~~~~~~~~~~~~~-~~~~~i~~~~~~~~----~~~~~~~w~liRpSgTEp~iriy~Ea~~~~~~~~l~~~~~  440 (448)
T Consensus       404 ~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~dg~~~~~~dg~w~lvR~SGTEP~iRvy~Ea~~~~~~e~~~~~~~  483 (487)
T cd05799         404 YEKYGYYKEKTISITFEGKEGPEKIKAIMDRLRNNPNVLTFYLEDGSRVTVRPSGTEPKIKFYIEVVGKKTLEEAEKKLD  483 (487)
T ss_pred             HHHHCCCCCEEEEEECCCCCCHHHHHHHHHHHHHCCCEEEEEECCCEEEEEECCCCHHHEEEEEEECCHHHHHHHHHHHH
T ss_conf             99828775405889836867699999999998635785999978984999976388423379997689999999999999


Q ss_pred             HHH
Q ss_conf             998
Q gi|254780544|r  441 KVI  443 (448)
Q Consensus       441 ~~i  443 (448)
T Consensus       484 ~~~  486 (487)
T cd05799         484 ALK  486 (487)
T ss_pred             HHH
T ss_conf             853