HHsearch alignment for GI: 254780544 and conserved domain: cd05802

>cd05802 GlmM GlmM is a bacterial phosphoglucosamine mutase (PNGM) that belongs to the alpha-D-phosphohexomutase superfamily. It is required for the interconversion of glucosamine-6-phosphate and glucosamine-1-phosphate in the biosynthetic pathway of UDP-N-acetylglucosamine, an essential precursor to components of the cell envelope. In order to be active, GlmM must be phosphorylated, which can occur via autophosphorylation or by the Ser/Thr kinase StkP. GlmM functions in a classical ping-pong bi-bi mechanism with glucosamine-1,6-diphosphate as an intermediate. Other members of the alpha-D-phosphohexomutase superfamily include phosphoglucosamine mutase (PNGM), phosphoacetylglucosamine mutase (PAGM), the bacterial phosphomannomutase ManB, and the bifunctional phosphomannomutase/phosphoglucomutase (PMM/PGM). Each of these enzymes has four domains with a centrally located active site formed by four loops, one from each domain. All four domains are included in this alignment model.
Probab=100.00  E-value=0  Score=778.94  Aligned_cols=433  Identities=54%  Similarity=0.896  Sum_probs=403.7

Q ss_pred             CCCCCCEEEEECCCCCCHHHHHHHHHHHHHHHHHCCCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCEEEEECCCCHHHH
Q ss_conf             03358601550687788999999999999999723799838999668779799999999999978987999626780899
Q gi|254780544|r    5 FFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSLVAGFTAAGMDAFILGPIPSPAV   84 (448)
Q Consensus         5 lFGt~GiRG~~~~~~~t~~~v~~i~~a~~~~~~~~~~~~~vvVg~D~R~~s~~~~~~~~~gl~~~G~~V~~~g~~ptP~l   84 (448)
T Consensus         1 lFGT~GiRG~~~~-~lt~~~~~~ig~a~~~~~~~~~~~~~Vvvg~D~R~~s~~~~~~~~~gl~s~G~~V~~~g~~pTP~~   79 (434)
T cd05802           1 LFGTDGIRGVANE-PLTPELALKLGRAAGKVLGKGGGRPKVLIGKDTRISGYMLESALAAGLTSAGVDVLLLGVIPTPAV   79 (434)
T ss_pred             CCCCCCCEEECCC-CCCHHHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCHHHHHHHHHHHHHHCCCEEEECCCCCHHHH
T ss_conf             9899971003699-999999999999999999846999869999799988799999999999986996999188885999


Q ss_pred             HHHHHHHCCCEEEEEEECCCCCCCEEEEEECCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCHHHHHHHHH
Q ss_conf             99998719925898865477752012564036545678357899999961566433445433222111354256668877
Q gi|254780544|r   85 AMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHV  164 (448)
Q Consensus        85 ~~a~~~~~~~gGI~iTaSHNP~~~nGiK~~~~~G~~i~~~~~~~Ie~~~~~~~~~~~~~~~~~~~~~~~~~~~~~Yi~~l  164 (448)
T Consensus        80 ~~~v~~~~~~~Gi~ITASHNP~~~NGiK~~~~~G~~i~~~~~~~Ie~~~~~~~~~~~-~~~~~~~~~~~~d~~~~Y~~~l  158 (434)
T cd05802          80 AYLTRKLRADAGVVISASHNPFEDNGIKFFSSDGYKLPDEVEEEIEALIDKELELPP-TGEKIGRVYRIDDARGRYIEFL  158 (434)
T ss_pred             HHHHHHCCCCCEEEEECCCCCCCCCCEEEECCCCCCCCHHHHHHHHHHHHCCCCCCC-CCCCCCCEEECCCHHHHHHHHH
T ss_conf             999996499813896368897402848963467875798999999999837876568-6013761688500699999999


Q ss_pred             HHCCCCHHHCCCCEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCEEEEECC
Q ss_conf             63263102118966999844665433332221233322222223222355774422101377764200234303675315
Q gi|254780544|r  165 KRTLPRDVTLQGLRIVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIALDG  244 (448)
Q Consensus       165 ~~~~~~~~~~~~lkvvvD~~~G~~~~~~~~il~~lg~~~~~i~~~pd~~~~~~~~~~~~~~~l~~~v~~~~ad~Gia~Dg  244 (448)
T Consensus       159 ~~~~~~~~-~~~lkvvvD~~~Ga~~~~~~~il~~lG~~v~~~~~~pdg~~~n~~~~~~~p~~l~~~v~~~~aDlgia~Dg  237 (434)
T cd05802         159 KSTFPKDL-LSGLKIVLDCANGAAYKVAPEVFRELGAEVIVINNAPDGLNINVNCGSTHPESLQKAVLENGADLGIAFDG  237 (434)
T ss_pred             HHHCCHHH-HCCCEEEEECCCCCHHHHHHHHHHHCCCCEEEECCCCCCCCCCCCCCCCCHHHHHHHHHHCCCCEEEEECC
T ss_conf             87588144-15988999899861245699999872984477425788776789989899799999998559967888869


Q ss_pred             CCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHCCCCCCCCCCCCCCCHHHHHHCCCCE
Q ss_conf             52100013322375533113567777655320022343332211360044432001211111233211011111028970
Q gi|254780544|r  245 DGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLGLSLKRTEVGDRYIMEYMKNNGFN  324 (448)
Q Consensus       245 D~DR~~ivd~~G~~i~~d~~~~lla~~ll~~~~~~~~~vv~~v~ss~~i~~~a~~~g~~v~~t~vG~k~i~~~~~~~~~~  324 (448)
T Consensus       238 D~DR~~~vd~~G~~i~~d~l~~l~a~~~l~~~~~~~~~vv~tv~ss~~l~~~~~~~g~~~~~t~vG~k~i~~~m~~~~~~  317 (434)
T cd05802         238 DADRVIAVDEKGNIVDGDQILAICARDLKERGRLKGNTVVGTVMSNLGLEKALKELGIKLVRTKVGDRYVLEEMLKHGAN  317 (434)
T ss_pred             CCCEEEEECCCCCEECHHHHHHHHHHHHHHHCCCCCCEEEEECCCCHHHHHHHHHCCCEEEEECCCHHHHHHHHHHCCCE
T ss_conf             98769999899978588999999999999850468987999734427899999976998999437249999999966977


Q ss_pred             ECCCCCCEEEEECCCCCCCCCCCCCHHHHHHHHCCCCHHHHHHHHHHCCCEEEEEECCCCCCC-CHHHHHHHHHHHHHHC
Q ss_conf             013466236530100014442332024667775588889999865642300000005676511-5589999987655430
Q gi|254780544|r  325 VGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKPVSTICHCFEEYPQFLRSVSVKDTSIL-NSSSIVQAIADAESEL  403 (448)
Q Consensus       325 ~g~E~sg~~~~~~~~~~~Dgi~a~l~~le~l~~~~~~l~~l~~~l~~~~~~~~~~~~~~~~~~-~~~~i~~~~~~~~~~~  403 (448)
T Consensus       318 ~ggE~sG~~~f~~~~~~~Dgi~aal~ile~l~~~~~~ls~l~~~~~~y~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  397 (434)
T cd05802         318 LGGEQSGHIIFLDHSTTGDGLLTALQLLAIMKRSGKSLSELASDMKLYPQVLVNVRVKDKKALLENPRVQAAIAEAEKEL  397 (434)
T ss_pred             EEECCCCCEEECCCCCCCCHHHHHHHHHHHHHHHCCCHHHHHHHHHHCCCEEECEECCCCCCHHHHHHHHHHHHHHHHHC
T ss_conf             97415475774588868989999999999999839999999987544102014604376421120288999999999861


Q ss_pred             CCCCEEEEECCCCCCEEEEEEECCCHHHHHHHHHHHH
Q ss_conf             7886599967798227999961599899999999999
Q gi|254780544|r  404 RGIDRLIVRASGTESLIRIMAEGDDLSRIKRIVDDLA  440 (448)
Q Consensus       404 ~~~~w~liRpSgTEp~iriy~Ea~~~~~~~~l~~~~~  440 (448)
T Consensus       398 ~d~~wvlvRpSgTEP~lriy~Ea~~~~~~~~L~~~ia  434 (434)
T cd05802         398 GGEGRVLVRPSGTEPLIRVMVEGEDEELVEKLAEELA  434 (434)
T ss_pred             CCCEEEEEECCCCCEEEEEEEEECCHHHHHHHHHHHC
T ss_conf             7977999981598416899997699999999999759