HHsearch results for GI: 254780544 and protein with PDBid: 2dka_A

>2dka_A Phosphoacetylglucosamine mutase; isomerase; 1.93A {Candida albicans} PDB: 2dkc_A* 2dkd_A*
Probab=100.00  E-value=0  Score=483.29  Aligned_cols=402  Identities=22%  Similarity=0.273  Sum_probs=294.5

Q ss_pred             HHHHHHHHHHHHCCCCCCEEEEECC---CCCHHHHHHHHHHH-HHHCCCEEEEECCCCHHHHHHHHHHHCCCEEEEEEEC
Q ss_conf             9999999999723799838999668---77979999999999-9978987999626780899999987199258988654
Q gi|254780544|r   27 RIGIAVGYLFRGKKKHRRVVIGKDT---RLSGYMLENSLVAG-FTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISAS  102 (448)
Q Consensus        27 ~i~~a~~~~~~~~~~~~~vvVg~D~---R~~s~~~~~~~~~g-l~~~G~~V~~~g~~ptP~l~~a~~~~~~~gGI~iTaS  102 (448)
                      ++.++++.|++...+...++++||+   |..+..+...++.. +.+              .+ ++....++++|||||||
T Consensus         2 ~~~~~~~~~~~~~~~~~~~~~~YgtagfR~~a~~l~~v~~~~g~~a--------------~l-~s~~~~g~~~GImITAS   66 (544)
T 2dka_A            2 SIEQTLSQYLPSHPKPQGVTFTYGTAGFRMKADKLDYVTFTVGIIA--------------SL-RSKYLQGKTVGVMITAS   66 (544)
T ss_dssp             CHHHHHHTTGGGCCCCSSCCCCCBTTBEEEEGGGCHHHHHHHHHHH--------------HH-HHHHTTTCEEEEEECCC
T ss_pred             CHHHHHHHHHHHCCCCCCCEEEECCCCCCCCHHHHHHHHHHHHHHH--------------HH-HHHHHCCCCEEEEECCC
T ss_conf             6689999999836998996574078533364244548999999999--------------99-87875797678998147


Q ss_pred             CCCCCCEEEEEECCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCC------------------------------------
Q ss_conf             77752012564036545678357899999961566433445433------------------------------------
Q gi|254780544|r  103 HNPYQDNGIKLFGPDGYKVSTDIEDRIETLLEDDLTSYLSCYDS------------------------------------  146 (448)
Q Consensus       103 HNP~~~nGiK~~~~~G~~i~~~~~~~Ie~~~~~~~~~~~~~~~~------------------------------------  146 (448)
                      |||++|||+|+|+++|.++.++.++.|+++++............                                    
T Consensus        67 HNP~~dNG~Kv~~~~G~~l~~~~e~~i~~~~n~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~~~~~v~vg~DtR~ss~  146 (544)
T 2dka_A           67 HNPPEDNGVKVVDPLGSMLESSWEKYATDLANASPSPSNDSEGEKNSLVEVIKNLVSDLKIDLSIPANVVIARDSRESSP  146 (544)
T ss_dssp             -CCTTEEEEEEECTTSSBCCGGGHHHHHHHHHSBSCC------CTTBHHHHHHHHHHHTTCCTTSCEEEEEEECSCTTHH
T ss_pred             CCCCCCCEEEEECCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCCEEEEECCCCCHH
T ss_conf             78810677999889989888699999999872645443321101456788998776543012256772587422776729


Q ss_pred             --------------------CCCCC---------------CCCCHHHHHHHHHHHCCCC-----HHHCCCCEEEEEECCC
Q ss_conf             --------------------22211---------------1354256668877632631-----0211896699984466
Q gi|254780544|r  147 --------------------IGHAK---------------RVDGVHDRYIEHVKRTLPR-----DVTLQGLRIVVDCANG  186 (448)
Q Consensus       147 --------------------~~~~~---------------~~~~~~~~Yi~~l~~~~~~-----~~~~~~lkvvvD~~~G  186 (448)
                                          +|..+               ......+.|++.+.+.+..     ....++++|++||+||
T Consensus       147 ~l~~a~~~gl~~~~g~~v~d~g~vtTP~l~~~~~~~n~~~~~~~~~~~y~~~l~~~~~~~~~~~~~~~~~~~iv~d~~nG  226 (544)
T 2dka_A          147 ALSMATIDGFQSVPNTKYQDFGLFTTPELHYVTRTLNDPDFGKPTEDGYYSKLAKSFQEIYTICESNNEKIDITIDAANG  226 (544)
T ss_dssp             HHHHHHHHHHHTSSSEEEEEEEECCHHHHHHHHHHHHCGGGCCSSHHHHHHHHHHHHHHHHTC-----CCEEEEEECTTS
T ss_pred             HHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHCCCCHHHCCCHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCCC
T ss_conf             99999999988605980787233265435554430372220771167899999999999873222025783498745776


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCC---C-CCCCCCCCCCCCCHHHHH---HHHHCCCCCCEEEEECCCCCCCCCCC----CC
Q ss_conf             5433332221233322222223---2-223557744221013777---64200234303675315521000133----22
Q gi|254780544|r  187 ASYKVAPEVFWELGADVVVIGD---K-PNGININLDCGSTNVLSL---QRKVHEVRADIGIALDGDGDRVIIVD----EK  255 (448)
Q Consensus       187 ~~~~~~~~il~~lg~~~~~i~~---~-pd~~~~~~~~~~~~~~~l---~~~v~~~~ad~Gia~DgD~DR~~ivd----~~  255 (448)
                      +++..++++|+++|++++.++.   . +++.+++++|++++...+   .+.+++.++|+|+++||||||+++++    ++
T Consensus       227 ~g~~~~~~ll~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ad~~~a~DgDaDRl~~~~~~~~~~  306 (544)
T 2dka_A          227 VGAPKIQELLEKYLHKEISFTVVNGDYKQPNLLNFDCGADYVKTNQKLPKNVKPVNNKLYASFDGDADRLICYYQNNDNK  306 (544)
T ss_dssp             THHHHHHHHHHHHSTTTEEEEEESCCTTCGGGTTSSCSHHHHHHHCSCCTTCCCCBTCCEEEECTTSCCEEEEEECTTSC
T ss_pred             CCHHHHHHHHHHHCCCCEEEECCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEECCCCCCCCEEEEECCCCCC
T ss_conf             30789999999837863477204566899989889988542125899999876348866543678755447875166556


Q ss_pred             CCCCCCCHHHHHHHHHHHHHHCCCCC--------CCCCCCCCCCHHHHHHHCCCCCCCCCCCCCCCHHHHHHCCCCEECC
Q ss_conf             37553311356777765532002234--------3332211360044432001211111233211011111028970013
Q gi|254780544|r  256 GAIVNGDQIMALIAREWMSHSLLRGN--------GIVTTVMSNIGLERFIAGLGLSLKRTEVGDRYIMEYMKNNGFNVGG  327 (448)
Q Consensus       256 G~~i~~d~~~~lla~~ll~~~~~~~~--------~vv~~v~ss~~i~~~a~~~g~~v~~t~vG~k~i~~~~~~~~~~~g~  327 (448)
                      |++++||++++|+++|+++.....+.        .|.++++++.+++.+++++|+++++|+|||||+.++|++.++.+||
T Consensus       307 ~~~l~Gd~i~~Lla~~l~~~~~~~~~~~~~~~~~~V~t~~~s~~~~~~i~~~~g~~~~~t~tG~k~i~~~~~~~~~~~~~  386 (544)
T 2dka_A          307 FKLLDGDKLSTLFALFLQQLFKQIDPTKISLNIGVVQTAYANGSSTKYVEDVLKIPVRCTPTGVKHLHHEAENFDIGVYF  386 (544)
T ss_dssp             EEEECHHHHHHHHHHHHHHHHTTSCTTTCCCCEEEEECTTSCHHHHHHHHHTSCCCEEECCSSHHHHHHHHTTSSEEEEE
T ss_pred             CEEECHHHHHHHHHHHHHHHHHCCCCCCCCCCCCEEEEEECCCHHHHHHHHHCCCCEEEEECCHHHHHHHHHHHCCCEEE
T ss_conf             42526999999999999985131577654567770799834766899999976982899815528899998741200005


Q ss_pred             CCCCEEEE--E--------CCCCCCCCCCCCCHHHHHHH----------------------HCCCCHHHHHHHHHHCCCE
Q ss_conf             46623653--0--------10001444233202466777----------------------5588889999865642300
Q gi|254780544|r  328 EQSGHIIL--S--------DYGSTGDGLVAALQVLRYIK----------------------QYDKPVSTICHCFEEYPQF  375 (448)
Q Consensus       328 E~sg~~~~--~--------~~~~~~Dgi~a~l~~le~l~----------------------~~~~~l~~l~~~l~~~~~~  375 (448)
                      |+|||..+  +        .+.+.+|++++++++|++++                      ..+.+++++.+.++++|+.
T Consensus       387 E~~ghg~~~~~~~~~~~~~~~~~~~d~~~~a~~~l~~~~~~~~~~~Gd~l~~~l~~~~~~~~~~~~~~~~~~~~~~~p~~  466 (544)
T 2dka_A          387 EANGHGTVIFNPEAEKKIFDYKPNNDNEAKAIKVLQNFSQLINQTVGDAISDLLAVLIVVHYLKLSPSDWDNEYTDLPNK  466 (544)
T ss_dssp             CTTSCEEEEECHHHHHHHHHCCCSSHHHHHHHHHHHHHHHHSCSSSCCHHHHHHHHHHHHHHTTCCHHHHHTTSCCCCEE
T ss_pred             EECCCEEEEECCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHCCCCHHHHHHHHHHCCHH
T ss_conf             21486358604102543102324656899999999999998642004169999999999875499999999875540011


Q ss_pred             EEEEECCCCCCCC----------HHHHHHHHHHHHHHCCCCCEEEEECCCCCCEEEEEEECCCHHHHHHHHHHHHHHHH
Q ss_conf             0000056765115----------58999998765543078865999677982279999615998999999999999987
Q gi|254780544|r  376 LRSVSVKDTSILN----------SSSIVQAIADAESELRGIDRLIVRASGTESLIRIMAEGDDLSRIKRIVDDLAKVIP  444 (448)
Q Consensus       376 ~~~~~~~~~~~~~----------~~~i~~~~~~~~~~~~~~~w~liRpSgTEp~iriy~Ea~~~~~~~~l~~~~~~~i~  444 (448)
                      ..++++.+....+          ....+..+......++ .+|++||||||||++|||+||++++.++++++++.++|+
T Consensus       467 ~~~v~v~~~~~~~~~~~~~~~~~~~~~~~~idgi~~~~~-~g~~~vRpSGTEP~iRiY~Ea~s~~~a~~l~~~~~~lvk  544 (544)
T 2dka_A          467 LVKVIVPDRSIFKTTNAERTLVEPKGMQDEIDKLVAQYP-NGRSFVRASGTEDAVRVYAEADTQNNVEELSKAVSELVK  544 (544)
T ss_dssp             EEEC-------CCCCTTTC-CC-CTTHHHHHHHHHTTST-TCEEEEEEC----CEEEEEECSSHHHHHHHHHHHHHHHC
T ss_pred             CCCEECCCHHHHHHHHHHHHHCCCCCCCCCCCEEEEECC-CEEEEEECCCCCCEEEEEEEECCHHHHHHHHHHHHHHHC
T ss_conf             015442546755322677651354223233143999829-889999747982026999986999999999999999649