HHsearch results for GI: 254780544 and protein with PDBid: 2f7l_A

>2f7l_A 455AA long hypothetical phospho-sugar mutase; phosphomannomutase, phosphoglucomutase, isomerase; 2.80A {Sulfolobus tokodaii}
Probab=100.00  E-value=0  Score=636.29  Aligned_cols=437  Identities=26%  Similarity=0.409  Sum_probs=386.8

Q ss_pred             CCCCCCCCCCEEEEECCCCCCHHHHHHHHHHHHHHHHHCCCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCEEEEECCCC
Q ss_conf             96520335860155068778899999999999999972379983899966877979999999999997898799962678
Q gi|254780544|r    1 MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSLVAGFTAAGMDAFILGPIP   80 (448)
Q Consensus         1 m~r~lFGt~GiRG~~~~~~~t~~~v~~i~~a~~~~~~~~~~~~~vvVg~D~R~~s~~~~~~~~~gl~~~G~~V~~~g~~p   80 (448)
                      |.| ||||+||||++|+ +|||+++.++|+|++++++   .+++|+||||+|++|++|++++++||+++|++|+++|.+|
T Consensus         1 ~~~-lFGt~GiRG~~~~-~~t~~~v~~~~~a~~~~l~---~~~~VvIG~DtR~ss~~l~~a~~~gl~a~Gv~V~d~g~~~   75 (455)
T 2f7l_A            1 MGK-LFGTDGVRGIVNK-ELTPELVLKLSKAIGTFFG---KNSKILVGRDVRAGGDMLVKIVEGGLLSVGVEVYDGGMAP   75 (455)
T ss_dssp             CCS-SCCSSSEEEEBTT-TBCHHHHHHHHHHHHHHHC---TTCEEEEEECSCTTHHHHHHHHHHHHHHTTCEEEEEEECC
T ss_pred             CCC-CCCCCCEEEEECC-CCCHHHHHHHHHHHHHHHC---CCCEEEEEECCCCCHHHHHHHHHHHHHHCCCEEEECCCCC
T ss_conf             975-3288880135389-8699999999999999967---8985999989971699999999999997699799879777


Q ss_pred             HHHHHHHHHHHCCCEEEEEEECCCCCCCEEEEEECCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCHHHHH
Q ss_conf             08999999871992589886547775201256403654567835789999996156643344543322211135425666
Q gi|254780544|r   81 SPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRY  160 (448)
Q Consensus        81 tP~l~~a~~~~~~~gGI~iTaSHNP~~~nGiK~~~~~G~~i~~~~~~~Ie~~~~~~~~~~~~~~~~~~~~~~~~~~~~~Y  160 (448)
                      ||+++|+++++++++||||||||||++|||+|+++++|.++.++.+++|++++..............+.....+...+.|
T Consensus        76 TP~l~~~v~~~~~~~gi~iTaShnp~~~ng~k~~~~~G~~~~~~~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  155 (455)
T 2f7l_A           76 TPALQYAVKTLGYDGGVVITASHNPAPYNGIKVVDKDGIEIRREKENEIEDLFFTERFNTIEWSSLTTEVKREDRVISTY  155 (455)
T ss_dssp             HHHHHHHHHHHCCSEEEEECCTTSCTTEEEEEEECTTSSBCCHHHHHHHHHHHHHTCCCCCCGGGCCCCCEECCCHHHHH
T ss_pred             HHHHHHHHHHCCCCEEEEEECCCCCCCCCCCEEECCCCCCCCCCHHHHHHHHHHHCCCCCCCCCCCCCCCCHHHHHHHHH
T ss_conf             49999999956998379996279986457816750357534520223367776430013445333345432026789999


Q ss_pred             HHHHHHCCCCH-HHCCCCEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC--CCCCCCHHHHHHHHHCCCCCC
Q ss_conf             88776326310-211896699984466543333222123332222222322235577--442210137776420023430
Q gi|254780544|r  161 IEHVKRTLPRD-VTLQGLRIVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININ--LDCGSTNVLSLQRKVHEVRAD  237 (448)
Q Consensus       161 i~~l~~~~~~~-~~~~~lkvvvD~~~G~~~~~~~~il~~lg~~~~~i~~~pd~~~~~--~~~~~~~~~~l~~~v~~~~ad  237 (448)
                      .+.+...++.. +..++++|++||+||++..+++.+|+.+++++..++..+|+.+++  ++|.......+...++..++|
T Consensus       156 ~~~~~~~~~~~~~~~~~~~i~~d~~~g~~~~~~~~~~~~l~~~~~~~~~~~d~~~~~~~~~~~~~~~~~~~~~~~~~~~d  235 (455)
T 2f7l_A          156 VNGILSHVDIEKIKKKNYKVLIDPANSVGALSTPLVARALGCKIYTINGNLDPLFSARQPEPTFDSLKETAEVVKTLKVD  235 (455)
T ss_dssp             HHHHHTTSCHHHHHHHCCEEEEECTTTGGGGTHHHHHHHTTCEEEEBSCSCCTTCTTSCSSCCTTTSHHHHHHHHHTTCS
T ss_pred             HHHHHHCCCHHHHHHCCCEEEEECCCCCCCCCCCHHHHHHCCEEEEEECCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCC
T ss_conf             99876401144564159569997787742224503355417614574025799988788887425677777888732866


Q ss_pred             EEEEECCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHCCCCCCCCCCCCCCCHHHH
Q ss_conf             36753155210001332237553311356777765532002234333221136004443200121111123321101111
Q gi|254780544|r  238 IGIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLGLSLKRTEVGDRYIMEY  317 (448)
Q Consensus       238 ~Gia~DgD~DR~~ivd~~G~~i~~d~~~~lla~~ll~~~~~~~~~vv~~v~ss~~i~~~a~~~g~~v~~t~vG~k~i~~~  317 (448)
                      +|+++||||||+.++|++|++++++++.++++.+++.+.......+++++.+|.+++.+++.+|.+++++++|++|+.++
T Consensus       236 ~g~~~D~D~DR~~~~~~~g~~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~s~~~~~~~~~~~~~~~~~~~g~~~i~~~  315 (455)
T 2f7l_A          236 LGVAHDGDADRAIFIDSEGRVQWGDRSGTLLSYWASVKNPKAIKKIVTAVSSSSLVEEYLSKYNIQVDWTKVGSVDIAHK  315 (455)
T ss_dssp             EEEECCTTSCCCEEEETTSCBCCHHHHHHHHHHHHHHTCTTSCSEEEEETTSCTHHHHHHHTTTCEEEEECSCHHHHHHH
T ss_pred             EEEEECCCCCCCCCCCCCCEEECCHHHHHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHHHCCCEEEEEEECHHHHHHH
T ss_conf             36787143221000234430432315899999999873756655555432333014567876197125532448999999


Q ss_pred             HHCCCCEECCCCCCEEEEECCCCCCCCCCCCCHHHHHHHHCCCCHHHHHHHHHHCCCEEEEEECCCCCCCCHHHHHHHHH
Q ss_conf             10289700134662365301000144423320246677755888899998656423000000056765115589999987
Q gi|254780544|r  318 MKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKPVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIA  397 (448)
Q Consensus       318 ~~~~~~~~g~E~sg~~~~~~~~~~~Dgi~a~l~~le~l~~~~~~l~~l~~~l~~~~~~~~~~~~~~~~~~~~~~i~~~~~  397 (448)
                      |.+.++++|+|+||||+++.+.+++||++++++++++++.++++++++.+.||++++...++.+.+  ......+++.+.
T Consensus       316 ~~~~~~~~~~E~sg~~~~~~~~~~~D~i~~~ll~~~~l~~~~~~l~~l~~~l~~~~~~~~~v~~~~--~~~~~~~~~~~~  393 (455)
T 2f7l_A          316 VADENALAGFEENGGFMYPPHQYVRDGAMSFALMLELLANENVSSAELFDRLPKYYLVKTKVDLKP--GLMVEEIYKKIL  393 (455)
T ss_dssp             HHHTTCSEEEETTEEEEBTTTBSSCCHHHHHHHHHHHHHHHTCCHHHHHHTSCCCEEEEEEEECCT--TCCHHHHHHHHH
T ss_pred             HHCCCCEEEECCCCCEEEECCCCCCCHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHCCCEEEECCC--HHHHHHHHHHHH
T ss_conf             845890899647686263023446647889999999999818638999997566401120120470--132999999999


Q ss_pred             HH----HH---HCCC------CCEEEEECCCCCCEEEEEEECCCHHHHHHHHHHHHHHHH
Q ss_conf             65----54---3078------865999677982279999615998999999999999987
Q gi|254780544|r  398 DA----ES---ELRG------IDRLIVRASGTESLIRIMAEGDDLSRIKRIVDDLAKVIP  444 (448)
Q Consensus       398 ~~----~~---~~~~------~~w~liRpSgTEp~iriy~Ea~~~~~~~~l~~~~~~~i~  444 (448)
                      +.    ..   .+||      .+|++||||||||++|||+||+|++.+++++++++++|+
T Consensus       394 ~~~~~~~~~~~~iDgik~~~~~gr~~vRpSGTEp~vRvYaEa~~~~~a~~l~~~i~~lVe  453 (455)
T 2f7l_A          394 EVYSTSSVKAITIDGVKIIGKDFWFLVRKSGTEPIIRIMAEAKDENVANNLVNELKKIVE  453 (455)
T ss_dssp             HHHCCTTSEEECSSSEEEEETTEEEEEEECSSSSEEEEEEEESSHHHHHHHHHHHHHHHT
T ss_pred             HHHCCCCCCEEEECEEEEECCCEEEEEECCCCCEEEEEEEEECCHHHHHHHHHHHHHHHC
T ss_conf             763236453444044999849889999802981058999986899999999999999976