HHsearch results for GI: 254780544 and protein with PDBid: 2fuv_A

>2fuv_A Phosphoglucomutase; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG, isomerase; HET: MSE; 2.00A {Salmonella typhimurium LT2}
Probab=100.00  E-value=0  Score=672.26  Aligned_cols=440  Identities=20%  Similarity=0.264  Sum_probs=352.5

Q ss_pred             CCCCCCCCCEEEEECCCCCCHHHHHHHHHHHHHHHHHCCCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCEEEE---ECC
Q ss_conf             65203358601550687788999999999999999723799838999668779799999999999978987999---626
Q gi|254780544|r    2 KRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSLVAGFTAAGMDAFI---LGP   78 (448)
Q Consensus         2 ~r~lFGt~GiRG~~~~~~~t~~~v~~i~~a~~~~~~~~~~~~~vvVg~D~R~~s~~~~~~~~~gl~~~G~~V~~---~g~   78 (448)
                      ||-.|||+||||++|...|||+++.++|+|||++++.+..+++|+||||+|++|++|++++++||+++|++|++   +|.
T Consensus        41 ~~i~FGT~GiRG~~g~~~~t~~~~~~~~~a~~~~l~~~~~~~~VvIg~D~R~~s~~~~~~~~~gL~s~Gi~V~~~~~~G~  120 (549)
T 2fuv_A           41 HAVKFGTSGHRGSAGRHSFNEPHILAIAQAIAEERAKNGITGPCYVGKDTHALSEPAFISVLEVLAANGVDVIVQENNGF  120 (549)
T ss_dssp             GSCCCBTTBEEECGGGTSSSHHHHHHHHHHHHHHHHHTTCCSCEEEEECSCTTHHHHHHHHHHHHHHTTCCEEEEGGGCC
T ss_pred             CCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCHHHHHHHHHHHHHHCCCEEEEECCCCC
T ss_conf             66686798767566999889999999999999999863999809999789615899999999999977997999588883


Q ss_pred             CCHHHHHHHHHHHCC-----CEEEEEEECCCCCCCEEEEEECCCCCCCCHHHHHHHHHHHHCCCCCCCCCCC--------
Q ss_conf             780899999987199-----2589886547775201256403654567835789999996156643344543--------
Q gi|254780544|r   79 IPSPAVAMLTRSLRA-----DVGVMISASHNPYQDNGIKLFGPDGYKVSTDIEDRIETLLEDDLTSYLSCYD--------  145 (448)
Q Consensus        79 ~ptP~l~~a~~~~~~-----~gGI~iTaSHNP~~~nGiK~~~~~G~~i~~~~~~~Ie~~~~~~~~~~~~~~~--------  145 (448)
                      +|||+++|+++++++     ++||||||||||++||||||++++|.+++++.+++||+.++...........        
T Consensus       121 ~pTP~~~~av~~~~~~~~~~~~GimITASHNP~~~NGiK~~~~~G~~l~~~~~~~Ie~~~~~~~~~~~~~~~~~~~~~~~  200 (549)
T 2fuv_A          121 TPTPAVSNAILVHNKKGGPLADGIVITPSHNPPEDGGIKYNPPNGGPADTNVTKVVEDRANALLAGGLQGVKRISLDAAM  200 (549)
T ss_dssp             CCHHHHHHHHHHHHHTCSSCCEEEEECCTTCCTTCEEEEEECTTSSCCCHHHHHHHHHHHHHHHHTTTTTCCCCCHHHHH
T ss_pred             CCHHHHHHHHHHHCCCCCCCCCEEEEECCCCCCCCCCEEEECCCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCC
T ss_conf             68089999999960136773425999647898322766763489864645789999999976532023334334421113


Q ss_pred             CCCCCCCCCCHHHHHHHHHHHCCCCH-HHCCCCEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC--CCCCC-C
Q ss_conf             32221113542566688776326310-21189669998446654333322212333222222232223557--74422-1
Q gi|254780544|r  146 SIGHAKRVDGVHDRYIEHVKRTLPRD-VTLQGLRIVVDCANGASYKVAPEVFWELGADVVVIGDKPNGINI--NLDCG-S  221 (448)
Q Consensus       146 ~~~~~~~~~~~~~~Yi~~l~~~~~~~-~~~~~lkvvvD~~~G~~~~~~~~il~~lg~~~~~i~~~pd~~~~--~~~~~-~  221 (448)
                      ..+.+. ..+..+.|++++++.++.+ ++.+++||++||+||+++.+++++|+++||+++.+|++||+.|+  +|+|. +
T Consensus       201 ~~~~i~-~~d~~~~Y~~~l~~~i~~~~i~~~~lkIvvD~~nG~~~~~~~~il~~lg~~~~~~~~~~~~~f~~~~~~~~~~  279 (549)
T 2fuv_A          201 ASGHVK-AVDLVQPFVEGLADIVDMAAIQKAGLTLGVDPLGGSGIEYWKRIAEHYKLNLTLVNDQVDQTFRFMHLDKDGA  279 (549)
T ss_dssp             HTSCEE-EECCHHHHHHHGGGTSCHHHHHHHTCCEEEECTTCTTHHHHHHHHHHTTCCEEESCCCCCTTCTTSBCCTTSC
T ss_pred             CCCEEE-ECCHHHHHHHHHHHHHCCHHHHCCCCEEEEECCCCCCCCCCCHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCC
T ss_conf             577067-4211889999998871402242269769984577653556612433216642112223456689889999644


Q ss_pred             ------CHHHHHHHHHCCCCCCEEEEECCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCC--CCCCCCCCCCCHH
Q ss_conf             ------01377764200234303675315521000133223755331135677776553200223--4333221136004
Q gi|254780544|r  222 ------TNVLSLQRKVHEVRADIGIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRG--NGIVTTVMSNIGL  293 (448)
Q Consensus       222 ------~~~~~l~~~v~~~~ad~Gia~DgD~DR~~ivd~~G~~i~~d~~~~lla~~ll~~~~~~~--~~vv~~v~ss~~i  293 (448)
                            .....+...+++.++|+|+++||||||++++|++|. +.+++++++++.++++++..++  ..|+.+++||.++
T Consensus       280 ~~~~~~~~~~~~~~~~~~~~adlgia~DgDaDR~~ivd~~g~-v~~~~~~~ll~~~l~~~~~~~~~~~~vv~tv~ss~~~  358 (549)
T 2fuv_A          280 IRMDCSSECAMAGLLALRDKFDLAFANDPDYDRHGIVTPAGL-MNPNHYLAVAINYLFQHRPLWGKDVAVGKTLVSSAMI  358 (549)
T ss_dssp             CCCCTTCTTTTHHHHTTGGGCSEEEECCTTSCBCEEEETTEE-CCHHHHHHHHHHHHHHSCTTSCTTCEEEEETTSCTHH
T ss_pred             CCCCHHHHHHHHHHHHHHCCCEEEEEECCCCCEEEEEECCCC-CCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCHHH
T ss_conf             443315689999987651360599998699876899968984-2587155899999997151148773003565562788


Q ss_pred             HHHHHCCCCCCCCCCCCCCCHHHHHHCCCCEECCCCCCEEEEEC-----CCCCCCCCCCCCHHHHHHHHCCCCHHHHHHH
Q ss_conf             44320012111112332110111110289700134662365301-----0001444233202466777558888999986
Q gi|254780544|r  294 ERFIAGLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSD-----YGSTGDGLVAALQVLRYIKQYDKPVSTICHC  368 (448)
Q Consensus       294 ~~~a~~~g~~v~~t~vG~k~i~~~~~~~~~~~g~E~sg~~~~~~-----~~~~~Dgi~a~l~~le~l~~~~~~l~~l~~~  368 (448)
                      +++++++|++++||+|||||+.++|++.+++||||+|||++|++     |.+++||++++++++++++.+++++++++++
T Consensus       359 ~~ia~~~g~~v~~t~vG~k~i~~~m~~~~~~~ggEeSgg~~~~~~~~~~~~~~kDgi~a~l~ile~la~~~~~l~~ll~e  438 (549)
T 2fuv_A          359 DRVVNDLGRKLVEVPVGFKWFVDGLFDGSFGFGGEESAGASFLRFDGTPWSTDKDGIIMCLLAAEITAVTGKNPQEHYNE  438 (549)
T ss_dssp             HHHHHHHTCCEEEECSSGGGGHHHHHHTSEEEEEETTTEEEECCTTSSCSCSSCCHHHHHHHHHHHHHHHSSCHHHHHHH
T ss_pred             HHHHHHCCCCCCCCCCHHHHHHHHHHCCCCEEEEEECCCEEECCCCCCCCCCCCHHHHHHHHHHHHHHHHCCCHHHHHHH
T ss_conf             99999739810125650899999875058516897048767424666531267369999999999999859699999999


Q ss_pred             HHHCC-C--E-EEEEECCCCCCCCHHHHHHHHHHH------------------H---------HHCCCCCEEEEECCCCC
Q ss_conf             56423-0--0-000005676511558999998765------------------5---------43078865999677982
Q gi|254780544|r  369 FEEYP-Q--F-LRSVSVKDTSILNSSSIVQAIADA------------------E---------SELRGIDRLIVRASGTE  417 (448)
Q Consensus       369 l~~~~-~--~-~~~~~~~~~~~~~~~~i~~~~~~~------------------~---------~~~~~~~w~liRpSgTE  417 (448)
                      +++.. .  + ...+.+..   ..+..+.+...+.                  .         .-+.+.+|++|||||||
T Consensus       439 l~~~~g~~~~~~~~~~~~~---~~k~~~~~~~~~~~~~~~~~~~~i~~~~~~~~~~~~~idGlki~~~~gw~lvRpSGTE  515 (549)
T 2fuv_A          439 LAARFGAPSYNRLQASATS---AQKAALSKLSPEMVSASTLAGDPITARLTAAPGNGASIGGLKVMTDNGWFAARPSGTE  515 (549)
T ss_dssp             HHHHHCCCEEEEEEEECCH---HHHHHHHTCCGGGCCCCEETTEECCEEEEECTTTCCEEEEEEEECSSEEEEEEECSSS
T ss_pred             HHHHHCCCCCEEEECCCCH---HHHHHHHHHHHHHCCCCHHCCCCEEEEEECCCCCCCCCCCEEEEECCEEEEEECCCCC
T ss_conf             9999689976066044676---7899999866764254101476216887316676556662799849989999857980


Q ss_pred             CEEEEEEECCC-HHHHHHHHHHHHHHHHHH
Q ss_conf             27999961599-899999999999998752
Q gi|254780544|r  418 SLIRIMAEGDD-LSRIKRIVDDLAKVIPMI  446 (448)
Q Consensus       418 p~iriy~Ea~~-~~~~~~l~~~~~~~i~~i  446 (448)
                      |++|||+||.+ ++.++++.+++.++|+++
T Consensus       516 P~iRvy~Ea~~~~e~~~~l~~~~~~~i~~~  545 (549)
T 2fuv_A          516 DAYKIYCESFLGEEHRKQIEKEAVEIVSEV  545 (549)
T ss_dssp             SEEEEEEEESSCHHHHHHHHHHHHHHHHHH
T ss_pred             EEEEEEEEECCCHHHHHHHHHHHHHHHHHH
T ss_conf             569999983785899999999999999999