HHsearch results for GI: 254780544 and protein with PDBid: 2z0f_A

>2z0f_A Putative phosphoglucomutase; isomerase, magnesium, metal-binding, structural genomics, NPPSFA; 2.52A {Thermus thermophilus HB8}
Probab=100.00  E-value=0  Score=664.75  Aligned_cols=439  Identities=21%  Similarity=0.247  Sum_probs=352.5

Q ss_pred             CCCCCCEEEEECCCCCCHHHHHHHHHHHHHHHHHCCCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCEEEEE---CCCCH
Q ss_conf             033586015506877889999999999999997237998389996687797999999999999789879996---26780
Q gi|254780544|r    5 FFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSLVAGFTAAGMDAFIL---GPIPS   81 (448)
Q Consensus         5 lFGt~GiRG~~~~~~~t~~~v~~i~~a~~~~~~~~~~~~~vvVg~D~R~~s~~~~~~~~~gl~~~G~~V~~~---g~~pt   81 (448)
                      -|||+||||.++..++|++++.++++|++.+++..+.+++|+||||+|++|++|+++++++|+++|++|+.+   |.+||
T Consensus        25 ~FGT~GiRG~~~~~~~t~~~v~~i~~a~~~~~~~~~~~~~VvIG~D~R~~s~~~a~~~~~~l~~~Gi~V~~~~~~g~~pT  104 (524)
T 2z0f_A           25 RFGTSGHRGSSLKATFTEAHVLAIAQAIAELRPSFGATGPLFLAKDTHALSEPAWATALSVFAAHGIEVRVEADGDYTPT  104 (524)
T ss_dssp             CEETTEEEECGGGTSSCHHHHHHHHHHHHHHTTTTTCCSCEEEEECSCTTHHHHHHHHHHHHHHTTCCEEEESSSSCCCH
T ss_pred             CCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCHHHHHHHHHHHHHHCCCEEEEECCCCCCCC
T ss_conf             76884125877888989999999999999999965999739999799706899999999999977998999389982376


Q ss_pred             HHHHHHHHHHC-----CCEEEEEEECCCCCCCEEEEEECCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCC-----CCCC
Q ss_conf             89999998719-----9258988654777520125640365456783578999999615664334454332-----2211
Q gi|254780544|r   82 PAVAMLTRSLR-----ADVGVMISASHNPYQDNGIKLFGPDGYKVSTDIEDRIETLLEDDLTSYLSCYDSI-----GHAK  151 (448)
Q Consensus        82 P~l~~a~~~~~-----~~gGI~iTaSHNP~~~nGiK~~~~~G~~i~~~~~~~Ie~~~~~~~~~~~~~~~~~-----~~~~  151 (448)
                      |+++|++++++     ++|||||||||||++||||||++++|.++.++.+++||+.++............+     ....
T Consensus       105 P~~~~av~~~~~~~~~~~~GImITASHNP~~~NGiK~~~~~G~~~~~~~~~~Ie~~~~~~~~~~~~~~~~~~~~~~~~~~  184 (524)
T 2z0f_A          105 PLVSLAILEHNAHHEAKADGVLLTPSHNPPEDGGFKYNPPTGGPANARITRAIEERANALLQEGLKGVKRLPLREALARA  184 (524)
T ss_dssp             HHHHHHHHHHHTTCSSCCEEEEECC--CCTTCEEEEEECTTSSCCCHHHHHHHHHHHHHHHHTTTTTCCCCCHHHHHHHC
T ss_pred             CHHHHHHHHHHCCCCCCCCEEEEECCCCCCCCCCEEEECCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCE
T ss_conf             68999999841012466715999547898544865762489873660578999999998765300346657731125521


Q ss_pred             CCCCHHHHHHHHHHHCCCCH-HHCCCCEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC---HH---
Q ss_conf             13542566688776326310-211896699984466543333222123332222222322235577442210---13---
Q gi|254780544|r  152 RVDGVHDRYIEHVKRTLPRD-VTLQGLRIVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGST---NV---  224 (448)
Q Consensus       152 ~~~~~~~~Yi~~l~~~~~~~-~~~~~lkvvvD~~~G~~~~~~~~il~~lg~~~~~i~~~pd~~~~~~~~~~~---~~---  224 (448)
                      ...++.+.|++.+.+.++.+ +..+++|||+||+||+++.+++++|+++||+++.+|+++|+.|+.+.+.+.   +.   
T Consensus       185 ~~~d~~~~Y~~~l~~~i~~~~~~~~~~kIvvD~~~G~~~~~~~~ll~~lG~~v~~i~~~~d~~~~~~~~~~~~~~~~~~~  264 (524)
T 2z0f_A          185 KPFDYAGLYVEKVAEAVDLEAIRASGLRIGVDPLGGASLRVWERLAESHGLPLEVVNPTLDPTFRFMPKDHDGKIRMDCS  264 (524)
T ss_dssp             EEECHHHHHHHHGGGTSCHHHHHHSCCCEEEECTTSTTHHHHHHHHHHHTCCEEEC------------------------
T ss_pred             EEECHHHHHHHHHHHCCCCHHCCCCCCEEEEECCCCCCHHHHHHHHHHHCCCEEEECCCCCCCCCCCCCCCCCCCCCCCC
T ss_conf             56112888998654014610013568779996798841345677888728821575672578778777444354478875


Q ss_pred             ---HHHHHHHCCCCCCEEEEECCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHCCC
Q ss_conf             ---77764200234303675315521000133223755331135677776553200223433322113600444320012
Q gi|254780544|r  225 ---LSLQRKVHEVRADIGIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLG  301 (448)
Q Consensus       225 ---~~l~~~v~~~~ad~Gia~DgD~DR~~ivd~~G~~i~~d~~~~lla~~ll~~~~~~~~~vv~~v~ss~~i~~~a~~~g  301 (448)
                         ....+.+++.++|+|+++||||||++++|++|++++++.++++++.++. .+..++..|+.+++||.+++++++++|
T Consensus       265 ~~~~~~~~~~~~~~adlgia~DgDaDR~~~vd~~G~~~~~~~l~~l~~~~~~-~~~~~~~~vv~t~~ss~~~~~ia~~~G  343 (524)
T 2z0f_A          265 SPYAMAGLLALKDRFDLAIGNDPDADRHGIVTPRGLMNPNHYLAAALHHLYT-TRSWPGAKVGKTAVTSALLDRVAQALG  343 (524)
T ss_dssp             -------CCCCCCCSSEEEEECTTSCSEEEEETTEECCHHHHHHHHHHHHHT-TCCCTTCEEEEETTSCTHHHHHHHHTT
T ss_pred             CHHHHHHHHHHHHHCCCCEEECCCCCEEEEEECCCCEECCHHHHHHHHHHHH-HHCCCCCEEEEEECCCHHHHHHHHHCC
T ss_conf             1567899987764014416874888769999189966221689999999987-503687727886312228899999679


Q ss_pred             CCCCCCCCCCCCHHHHHHCCCCEECCCCCCEEEE-----ECCCCCCCCCCCCCHHHHHHHHCCCCHHHHHHHHHH-CC--
Q ss_conf             1111123321101111102897001346623653-----010001444233202466777558888999986564-23--
Q gi|254780544|r  302 LSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIIL-----SDYGSTGDGLVAALQVLRYIKQYDKPVSTICHCFEE-YP--  373 (448)
Q Consensus       302 ~~v~~t~vG~k~i~~~~~~~~~~~g~E~sg~~~~-----~~~~~~~Dgi~a~l~~le~l~~~~~~l~~l~~~l~~-~~--  373 (448)
                      +++++|+|||||+.++|.+.++.||||+|||++|     ++|.+++||++++++++++++++++++++|++.+++ |+  
T Consensus       344 ~~v~~t~vG~k~i~~~~~e~~~~~ggEesgg~~~~~~~~~~~~~d~Dgi~a~l~~le~~a~~~~~~~~l~~~l~~~~~~~  423 (524)
T 2z0f_A          344 REVYETPVGFKHFVAGLLEGWLGFAGEESAGASFLRFDGRPFSTDKDGILMGLLAAELMAKRGQAPDALYEALAEKLGRP  423 (524)
T ss_dssp             CCEEEECSSTHHHHHHHHHSSEEEEEETTTEEEECCTTSCCSCSSCCHHHHHHHHHHHHHHHSSCHHHHHHHHHHHHCCC
T ss_pred             CEEEEECCCHHHHHHHHHHHCCCCCCCCCCCEEECCCCCCCCCCCCHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHCCC
T ss_conf             87998256359999987651035544445627862455544156722689999999999983999999999999986767


Q ss_pred             -CEEEEEECCCCCCCCHHHHHHHHH-H-----------------HH---------HHCCCCCEEEEECCCCCCEEEEEEE
Q ss_conf             -000000056765115589999987-6-----------------55---------4307886599967798227999961
Q gi|254780544|r  374 -QFLRSVSVKDTSILNSSSIVQAIA-D-----------------AE---------SELRGIDRLIVRASGTESLIRIMAE  425 (448)
Q Consensus       374 -~~~~~~~~~~~~~~~~~~i~~~~~-~-----------------~~---------~~~~~~~w~liRpSgTEp~iriy~E  425 (448)
                       ....++++..   ..+..+.+... +                 ..         .-..+.+|++||||||||++|||+|
T Consensus       424 ~~~~~~~~~~~---~~k~~~~~~~~~~~~~~~~~~~~v~~~~d~~~~~~~~idGik~~~~~gw~lvRpSGTEP~irvy~E  500 (524)
T 2z0f_A          424 YYARKDLPVSP---EAKARLARLSAKEVHPSTLAGEPVLQVLDRATGNGEPLGGIKVVAANAWFAVRPSGTEDVAKVYAE  500 (524)
T ss_dssp             EEEEEEEECCH---HHHHHHTTCCTTTSCCSEETTEECCEEEEECTTTCCEEEEEEEECSSEEEEEEECSSSSEEEEEEE
T ss_pred             CEEECCCCCCH---HHHHHHHHHHHHHCCCHHHCCCCEEEEEECCCCCCCCCCCEEEECCCEEEEEECCCCCEEEEEEEE
T ss_conf             40531413598---999999985532057045457613678730457666667879982998999984798136999998


Q ss_pred             CC-CHHHHHHHHHHHHHHHHHHC
Q ss_conf             59-98999999999999987520
Q gi|254780544|r  426 GD-DLSRIKRIVDDLAKVIPMID  447 (448)
Q Consensus       426 a~-~~~~~~~l~~~~~~~i~~i~  447 (448)
                      |. +++.++++++++.++|++.=
T Consensus       501 a~~~e~~~~~l~~~~~~~i~~~l  523 (524)
T 2z0f_A          501 SFLGEAHLERVLEEATALLHKAL  523 (524)
T ss_dssp             ESSCHHHHHHHHHHHHHHHHHHT
T ss_pred             ECCCHHHHHHHHHHHHHHHHHHH
T ss_conf             56889999999999999999974