HHSEARCH alignment of GI: 254780544 and SCOP domain: d1nn4a_

Alignment
>d1nn4a_ c.121.1.1 (A:) Alternate ribose 5-phosphate isomerase B, RpiB {Escherichia coli [TaxId: 562]}
Probab=92.20  E-value=0.3  Score=24.23  Aligned_cols=58  Identities=22%  Similarity=0.436  Sum_probs=40.1

Q ss_pred             CCEEEEECCCCCHHHHHHHHHHHHHHCCCEEEEECCC-----CHHHHHHH----HHHHCCCEEEEEEEC
Q ss_conf             8389996687797999999999999789879996267-----80899999----987199258988654
Q gi|254780544|r   43 RRVVIGKDTRLSGYMLENSLVAGFTAAGMDAFILGPI-----PSPAVAML----TRSLRADVGVMISAS  102 (448)
Q Consensus        43 ~~vvVg~D~R~~s~~~~~~~~~gl~~~G~~V~~~g~~-----ptP~l~~a----~~~~~~~gGI~iTaS  102 (448)
                      ++|+||.|.  .+-.++..+..-|.+.|.+|.|+|.-     --|-..+.    +....++.||.|..|
T Consensus        15 kkI~igsDh--aG~~lK~~l~~~L~~~g~~V~D~G~~~~~~~DYpd~a~~va~~v~~~~~~~GIliCGt   81 (159)
T d1nn4a_          15 KKIAFGCDH--VGFILKHEIVAHLVERGVEVIDKGTWSSERTDYPHYASQVALAVAGGEVDGGILICGT   81 (159)
T ss_dssp             SEEEEEECT--TTHHHHHHHHHHHHHTTCEEEECCCCSSSCCCHHHHHHHHHHHHHTTSSSEEEEEESS
T ss_pred             EEEEEEECC--CHHHHHHHHHHHHHHCCCEEEECCCCCCCCCCCCHHHHHHHHHHHHCCCEEEEEECCC
T ss_conf             079998487--0699999999999987998997899866666851788899999873663058882587


SCOP domain information

class: Alpha and beta proteins (a/b)
fold: Ribose/Galactose isomerase RpiB/AlsB
superfamily: Ribose/Galactose isomerase RpiB/AlsB
family: Ribose/Galactose isomerase RpiB/AlsB
domain: Alternate ribose 5-phosphate isomerase B, RpiB
species: Escherichia coli [TaxId: 562]