HHSEARCH alignment of GI: 254780544 and SCOP domain: d1p5dx4

Alignment
>d1p5dx4 d.129.2.1 (X:368-463) Phosphomannomutase/phosphoglucomutase {Pseudomonas aeruginosa [TaxId: 287]}
Probab=99.27  E-value=5.4e-12  Score=90.57  Aligned_cols=68  Identities=25%  Similarity=0.361  Sum_probs=50.9

Q ss_pred             EEECCCCCCCCHHHHHHHHHHH----HH---HCCC------CCEEEEECCCCCCEEEEEEECCCHHHHHHHHHHHHHHHH
Q ss_conf             0005676511558999998765----54---3078------865999677982279999615998999999999999987
Q gi|254780544|r  378 SVSVKDTSILNSSSIVQAIADA----ES---ELRG------IDRLIVRASGTESLIRIMAEGDDLSRIKRIVDDLAKVIP  444 (448)
Q Consensus       378 ~~~~~~~~~~~~~~i~~~~~~~----~~---~~~~------~~w~liRpSgTEp~iriy~Ea~~~~~~~~l~~~~~~~i~  444 (448)
                      ++.|++   .++..+++.+.+.    ..   .+||      .+|++||||||||++|+|+||.+++.++++.+++.++|+
T Consensus        10 ~i~~~d---~~K~~ii~~l~~~~~~~~~~i~~iDGvrv~~~dgW~liR~SnTEP~lri~~Ea~s~~~~~~l~~~~~~~l~   86 (96)
T d1p5dx4          10 NITVTE---DSKFAIIEALQRDAQWGEGNITTLDGVRVDYPKGWGLVRASNTTPVLVLRFEADTEEELERIKTVFRNQLK   86 (96)
T ss_dssp             EEECCT---TTHHHHHHHHHHHCCCCSSEEECSSSEEEEETTEEEEEEECSSSSEEEEEEEESSHHHHHHHHHHHHHHHH
T ss_pred             CCCCCC---HHHHHHHHHHHHHHHHCCCCEEEECCEEEEECCCEEEEEECCCCCEEEEEEEECCHHHHHHHHHHHHHHHH
T ss_conf             442583---78888999999874104675135035289852628999867999779999988999999999999999999


Q ss_pred             HHCC
Q ss_conf             5209
Q gi|254780544|r  445 MIDS  448 (448)
Q Consensus       445 ~i~~  448 (448)
                      .+++
T Consensus        87 ~i~~   90 (96)
T d1p5dx4          87 AVDS   90 (96)
T ss_dssp             HHCT
T ss_pred             HHHH
T ss_conf             7533


SCOP domain information

class: Alpha and beta proteins (a+b)
fold: TBP-like
superfamily: Phosphoglucomutase, C-terminal domain
family: Phosphoglucomutase, C-terminal domain
domain: Phosphomannomutase/phosphoglucomutase
species: Pseudomonas aeruginosa [TaxId: 287]