HHSEARCH alignment of GI: 254780544 and SCOP domain: d3pmga3

Alignment
>d3pmga3 c.84.1.1 (A:304-420) Phosphoglucomutase {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
Probab=99.82  E-value=2e-21  Score=148.76  Aligned_cols=90  Identities=20%  Similarity=0.198  Sum_probs=85.0

Q ss_pred             CCCCCCCCCCCHHHHHHHCCCCCCCCCCCCCCCHHHHHHCCCCEECCCCCCEEEEECCCCCCCCCCCCCHHHHHHHHCCC
Q ss_conf             43332211360044432001211111233211011111028970013466236530100014442332024667775588
Q gi|254780544|r  281 NGIVTTVMSNIGLERFIAGLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK  360 (448)
Q Consensus       281 ~~vv~~v~ss~~i~~~a~~~g~~v~~t~vG~k~i~~~~~~~~~~~g~E~sg~~~~~~~~~~~Dgi~a~l~~le~l~~~~~  360 (448)
                      ..|+.|++||.+++++++++|++++||+||||||.++|++.+++||||+|||++++ |.+++||++++++++++++++++
T Consensus        25 ~~Vv~tv~tS~~l~~i~~~~g~~~~~t~VG~k~i~~~m~~~~~~~GgE~Sg~~~~~-~~~~~Dgi~aal~~le~l~~~~~  103 (117)
T d3pmga3          25 RGFARSMPTSGALDRVANATKIALYETPTGWKFFGNLMDASKLSLCGEESFGTGSD-HIREKDGLWAVLAWLSILATRKQ  103 (117)
T ss_dssp             CCEEEETTSCTHHHHHHHTSSSCEEEECSSHHHHHHHHHTTCCSEEEETTTEEEET-TSSSCCHHHHHHHHHHHHHHHCS
T ss_pred             CCCEEEECCCHHHHHHHHHCCEEEEEECCCCCEEEEEECCCCEEEEECCCCCCCCC-CCCCCCCHHHHHHHHHHHHHHCC
T ss_conf             87746735898899989628605999157551200110027777874465774378-76778717999999999999399


Q ss_pred             CHHHHHHHHHH
Q ss_conf             88999986564
Q gi|254780544|r  361 PVSTICHCFEE  371 (448)
Q Consensus       361 ~l~~l~~~l~~  371 (448)
                      +++++++++++
T Consensus       104 ~lsel~~~l~~  114 (117)
T d3pmga3         104 SVEDILKDHWH  114 (117)
T ss_dssp             CHHHHHHHHHH
T ss_pred             CHHHHHHHHHH
T ss_conf             99999999998


SCOP domain information

class: Alpha and beta proteins (a/b)
fold: Phosphoglucomutase, first 3 domains
superfamily: Phosphoglucomutase, first 3 domains
family: Phosphoglucomutase, first 3 domains
domain: Phosphoglucomutase
species: Rabbit (Oryctolagus cuniculus) [TaxId: 9986]