BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780544|ref|YP_003064957.1| phosphoglucosamine mutase
protein [Candidatus Liberibacter asiaticus str. psy62]
         (448 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|254780544|ref|YP_003064957.1| phosphoglucosamine mutase protein [Candidatus Liberibacter
           asiaticus str. psy62]
 gi|254040221|gb|ACT57017.1| phosphoglucosamine mutase protein [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 448

 Score =  909 bits (2350), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 448/448 (100%), Positives = 448/448 (100%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN
Sbjct: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK
Sbjct: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV
Sbjct: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI
Sbjct: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL
Sbjct: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK
Sbjct: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
           PVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLI
Sbjct: 361 PVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420

Query: 421 RIMAEGDDLSRIKRIVDDLAKVIPMIDS 448
           RIMAEGDDLSRIKRIVDDLAKVIPMIDS
Sbjct: 421 RIMAEGDDLSRIKRIVDDLAKVIPMIDS 448


>gi|315122872|ref|YP_004063361.1| phosphoglucosamine mutase protein [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313496274|gb|ADR52873.1| phosphoglucosamine mutase protein [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 448

 Score =  813 bits (2099), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 389/448 (86%), Positives = 426/448 (95%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           MK+R+FGTDGIRGKSN FPITP+ MMR+GI VGYL  GKK++RRVVIGKDTRLSGYMLEN
Sbjct: 1   MKQRYFGTDGIRGKSNIFPITPDVMMRVGIVVGYLLGGKKRNRRVVIGKDTRLSGYMLEN 60

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +LVAGFT+AGM++FILGPIPSPAVAMLTRSLRADVGVMISASHN Y DNGIKLFG DGYK
Sbjct: 61  ALVAGFTSAGMNSFILGPIPSPAVAMLTRSLRADVGVMISASHNQYHDNGIKLFGSDGYK 120

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +STDIED IE+LLE DLT YLSCYDSIG+AKR+DGVHDRYIEHVKRTLPRDVTLQGLRIV
Sbjct: 121 ISTDIEDHIESLLEGDLTPYLSCYDSIGNAKRIDGVHDRYIEHVKRTLPRDVTLQGLRIV 180

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           VDCANGASYKVAP VFWELGADVVVIGDKPNG+NINL+CGSTNVLSLQ+KVHEVRADIGI
Sbjct: 181 VDCANGASYKVAPAVFWELGADVVVIGDKPNGMNINLNCGSTNVLSLQKKVHEVRADIGI 240

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           ALDGDGDR+IIVDEK A+VNGDQIMALIAREWMS+SLL+GNGIVTTVMSN+GLERF++ +
Sbjct: 241 ALDGDGDRIIIVDEKSAVVNGDQIMALIAREWMSNSLLKGNGIVTTVMSNVGLERFLSEI 300

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           GLSLKRT+VGDRY+MEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVL YIK+YDK
Sbjct: 301 GLSLKRTQVGDRYVMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLSYIKKYDK 360

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
           PVSTICHCFEEYPQFLRS+ VKD+ ILN+  +VQAIADAESELRG+DRL+VRASGTE LI
Sbjct: 361 PVSTICHCFEEYPQFLRSIKVKDSFILNNPLVVQAIADAESELRGMDRLVVRASGTEPLI 420

Query: 421 RIMAEGDDLSRIKRIVDDLAKVIPMIDS 448
           RIMAEG+  S+I+RIVDDLAKVIPMIDS
Sbjct: 421 RIMAEGESFSKIRRIVDDLAKVIPMIDS 448


>gi|327193461|gb|EGE60357.1| phosphoglucosamine mutase protein [Rhizobium etli CNPAF512]
          Length = 450

 Score =  641 bits (1654), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 307/448 (68%), Positives = 367/448 (81%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           MKRR+FGTDGIRG+SN FP+TP+  MR+GIA G +FR      RVVIGKDTRLSGYMLEN
Sbjct: 1   MKRRYFGTDGIRGQSNVFPMTPDLAMRVGIAAGTIFRRGNHRHRVVIGKDTRLSGYMLEN 60

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           ++VAGFTAAG+DAFILGPIP+PAVAMLTRSLR D+GVMISASHNPY+DNGIKLFGPDGYK
Sbjct: 61  AMVAGFTAAGLDAFILGPIPTPAVAMLTRSLRCDIGVMISASHNPYEDNGIKLFGPDGYK 120

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +S DIE  IE LLE DL++ L+  D IG AKRVDGVHDRYIEH KRTLPRDVTLQGLRI 
Sbjct: 121 LSDDIEAEIEDLLEKDLSTQLAKSDDIGRAKRVDGVHDRYIEHAKRTLPRDVTLQGLRIA 180

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           +DCANGA+YKVAP V WELGADVV IG++PNG NINL+CGST+ ++LQ+KV EVRADIGI
Sbjct: 181 IDCANGAAYKVAPAVLWELGADVVTIGNEPNGTNINLNCGSTSPVALQKKVDEVRADIGI 240

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           ALDGD DRVIIVDE G+IV+GDQ+MA+IA  W     LRGNGIV TVMSN+GLERF+   
Sbjct: 241 ALDGDADRVIIVDENGSIVDGDQLMAVIAESWAESQQLRGNGIVATVMSNLGLERFLDER 300

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           G++L RT+VGDRY++E+M+ + +NVGGEQSGHI+LSDYG+TGDGLVAALQ+L  +K+  +
Sbjct: 301 GMALARTKVGDRYVVEHMRQHNYNVGGEQSGHIVLSDYGTTGDGLVAALQILAAVKRTGR 360

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
            VS +C  FE  PQ LR+V +     L    + +AIADAE+EL    RL++R SGTE LI
Sbjct: 361 TVSEVCRRFEPVPQLLRNVRISGGKPLEDIQVQKAIADAEAELAKTGRLVIRPSGTEPLI 420

Query: 421 RIMAEGDDLSRIKRIVDDLAKVIPMIDS 448
           R+MAEGDD S+I+RIV++L   I  + S
Sbjct: 421 RVMAEGDDRSQIERIVNELIGTISNVRS 448


>gi|190893270|ref|YP_001979812.1| phosphoglucosamine mutase [Rhizobium etli CIAT 652]
 gi|226723908|sp|B3PYX0|GLMM_RHIE6 RecName: Full=Phosphoglucosamine mutase
 gi|190698549|gb|ACE92634.1| phosphoglucosamine mutase protein [Rhizobium etli CIAT 652]
          Length = 450

 Score =  641 bits (1653), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 306/448 (68%), Positives = 367/448 (81%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           MKRR+FGTDGIRG+SN FP+TP+  MR+GIA G +FR      RVVIGKDTRLSGYMLEN
Sbjct: 1   MKRRYFGTDGIRGQSNVFPMTPDLAMRVGIAAGTIFRRGNHRHRVVIGKDTRLSGYMLEN 60

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           ++VAGFTAAG+DAFILGPIP+PAVAMLTRSLR D+GVMISASHNPY+DNGIKLFGPDGYK
Sbjct: 61  AMVAGFTAAGLDAFILGPIPTPAVAMLTRSLRCDIGVMISASHNPYEDNGIKLFGPDGYK 120

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +S DIE  IE LLE DL++ L+  D IG AKRVDGVHDRYIEH KRTLPRDVTLQGLRI 
Sbjct: 121 LSDDIEAEIEDLLEKDLSTQLAKSDDIGRAKRVDGVHDRYIEHAKRTLPRDVTLQGLRIA 180

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           +DCANGA+YKVAP V WELGADVV IG++PNG NINL+CGST+ ++LQ+KV EVRADIGI
Sbjct: 181 IDCANGAAYKVAPAVLWELGADVVTIGNEPNGTNINLNCGSTSPVALQKKVDEVRADIGI 240

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           ALDGD DRVIIVDE G+IV+GDQ+MA+IA  W     LRGNGIV TVMSN+GLERF+   
Sbjct: 241 ALDGDADRVIIVDENGSIVDGDQLMAVIAESWAESQQLRGNGIVATVMSNLGLERFLDER 300

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           G++L RT+VGDRY++E+M+ + +NVGGEQSGHI+LSDYG+TGDGLVAALQ+L  +K+  +
Sbjct: 301 GMALARTKVGDRYVVEHMRQHNYNVGGEQSGHIVLSDYGTTGDGLVAALQILAAVKRTGR 360

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
            VS +C  FE  PQ LR+V +     L    + +AIADAE+EL    RL++R SGTE LI
Sbjct: 361 TVSEVCRRFEPVPQLLRNVRISGGKPLEDIQVQKAIADAEAELAKTGRLVIRPSGTEPLI 420

Query: 421 RIMAEGDDLSRIKRIVDDLAKVIPMIDS 448
           R+MAEGDD ++I+RIV++L   I  + S
Sbjct: 421 RVMAEGDDRAQIERIVNELIGTISNVRS 448


>gi|222086968|ref|YP_002545502.1| phosphoglucosamine mutase [Agrobacterium radiobacter K84]
 gi|254798007|sp|B9J9H0|GLMM_AGRRK RecName: Full=Phosphoglucosamine mutase
 gi|221724416|gb|ACM27572.1| phosphoglucosamine mutase [Agrobacterium radiobacter K84]
          Length = 450

 Score =  639 bits (1647), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 306/444 (68%), Positives = 371/444 (83%), Gaps = 2/444 (0%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLF-RGKKKHRRVVIGKDTRLSGYMLE 59
           MKRR+FGTDGIRG+SN +P+TP+  MR+GIA G +F RG  +HR VVIGKDTRLSGYMLE
Sbjct: 1   MKRRYFGTDGIRGQSNIYPMTPDLAMRVGIAAGTIFHRGSHRHR-VVIGKDTRLSGYMLE 59

Query: 60  NSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGY 119
           N++VAGFTAAG+DAF+LGPIP+PAVAMLTRSLRAD+GVMISASHNPY+DNGIKLFGPDGY
Sbjct: 60  NAMVAGFTAAGVDAFVLGPIPTPAVAMLTRSLRADIGVMISASHNPYEDNGIKLFGPDGY 119

Query: 120 KVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRI 179
           K+S D+E +IE LLE D+T++L+  ++IG AKRVDGVHDRYIEH KRTLPRDVTLQGLRI
Sbjct: 120 KLSDDLEMKIEDLLEKDMTAHLAKSENIGRAKRVDGVHDRYIEHAKRTLPRDVTLQGLRI 179

Query: 180 VVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIG 239
            +DCANGA+YKVAP V WELGA+VV IG++PNG NINL+CGST+ ++LQ+KV EVRADIG
Sbjct: 180 AIDCANGAAYKVAPAVLWELGAEVVTIGNEPNGTNINLNCGSTSPVALQKKVDEVRADIG 239

Query: 240 IALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAG 299
           IALDGD DRVIIVDE G I++GDQ+MA+IA  W  +  LRGNGIV TVMSN+GLERF+  
Sbjct: 240 IALDGDADRVIIVDETGTIIDGDQLMAVIAESWAENQSLRGNGIVATVMSNLGLERFLED 299

Query: 300 LGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYD 359
            G++L RT VGDR+++E+M+ + FNVGGEQSGHI+LSDYG+TGDGLVAALQ+L  +K+  
Sbjct: 300 RGMALARTAVGDRHVVEHMRQHNFNVGGEQSGHIVLSDYGTTGDGLVAALQILAVVKRTG 359

Query: 360 KPVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESL 419
           KPVS +C  FE  PQ LR+V +     L  + + +AIADAESEL    RL++R SGTE L
Sbjct: 360 KPVSEVCRRFEPVPQLLRNVRISGGKPLEDNQVRKAIADAESELARNGRLVIRPSGTEPL 419

Query: 420 IRIMAEGDDLSRIKRIVDDLAKVI 443
           IR+MAEGDD  +I+RIV  L  VI
Sbjct: 420 IRVMAEGDDRGQIERIVGGLIDVI 443


>gi|241206179|ref|YP_002977275.1| phosphoglucosamine mutase [Rhizobium leguminosarum bv. trifolii
           WSM1325]
 gi|240860069|gb|ACS57736.1| phosphoglucosamine mutase [Rhizobium leguminosarum bv. trifolii
           WSM1325]
          Length = 450

 Score =  637 bits (1644), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 306/443 (69%), Positives = 364/443 (82%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           MKRR+FGTDGIRG+SN FP+TP+  MR+GIA G +FR      RVVIGKDTRLSGYMLEN
Sbjct: 1   MKRRYFGTDGIRGQSNVFPMTPDLAMRVGIAAGTIFRRGNHRHRVVIGKDTRLSGYMLEN 60

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           ++VAGFTAAG+DAFILGPIP+PAVAMLTRSLRAD+GVMISASHNPY+DNGIKLFGPDGYK
Sbjct: 61  AMVAGFTAAGLDAFILGPIPTPAVAMLTRSLRADLGVMISASHNPYEDNGIKLFGPDGYK 120

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +S DIE  IE LLE DL + L+  D IG AKRVDGVHDRYIEH KRTLPRDVTLQGLRI 
Sbjct: 121 LSDDIEAEIEDLLEKDLNAQLAKSDDIGRAKRVDGVHDRYIEHAKRTLPRDVTLQGLRIA 180

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           +DCANGA+YKVAP V WELGA+VV IG++PNG NINL+CGST+ ++LQ+KV EVRADIGI
Sbjct: 181 IDCANGAAYKVAPAVLWELGAEVVTIGNEPNGTNINLNCGSTSPVALQKKVDEVRADIGI 240

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           ALDGD DRVIIVDE G+IV+GDQ+MA+IA  W     LRGNGIV TVMSN+GLERF+   
Sbjct: 241 ALDGDADRVIIVDENGSIVDGDQLMAVIAESWAESQQLRGNGIVATVMSNLGLERFLDDK 300

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           GL L RT+VGDRY++E+M+ + +NVGGEQSGHI+LSDYG+TGDGLVAALQ+L  +K+  +
Sbjct: 301 GLGLARTKVGDRYVVEHMRQHNYNVGGEQSGHIVLSDYGTTGDGLVAALQILAAVKRTGR 360

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
            VS +C  FE  PQ LR+V +     L    + +AIADAE+EL    RL++R SGTE LI
Sbjct: 361 TVSEVCRRFEPVPQLLRNVRISGGKPLEDIQVQKAIADAEAELARNGRLVIRPSGTEPLI 420

Query: 421 RIMAEGDDLSRIKRIVDDLAKVI 443
           R+MAEGDD ++I+RIV++L   I
Sbjct: 421 RVMAEGDDRAQIERIVNELIGTI 443


>gi|116253704|ref|YP_769542.1| phosphoglucosamine mutase [Rhizobium leguminosarum bv. viciae 3841]
 gi|158564209|sp|Q1MC77|GLMM_RHIL3 RecName: Full=Phosphoglucosamine mutase
 gi|115258352|emb|CAK09454.1| putative phosphoglucosamine mutase [Rhizobium leguminosarum bv.
           viciae 3841]
          Length = 450

 Score =  637 bits (1644), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 306/443 (69%), Positives = 364/443 (82%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           MKRR+FGTDGIRG+SN FP+TP+  MR+GIA G +FR      RVVIGKDTRLSGYMLEN
Sbjct: 1   MKRRYFGTDGIRGQSNVFPMTPDLAMRVGIAAGTIFRRGNHRHRVVIGKDTRLSGYMLEN 60

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           ++VAGFTAAG+DAFILGPIP+PAVAMLTRSLRAD+GVMISASHNPY+DNGIKLFGPDGYK
Sbjct: 61  AMVAGFTAAGLDAFILGPIPTPAVAMLTRSLRADLGVMISASHNPYEDNGIKLFGPDGYK 120

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +S DIE  IE LLE DL + L+  D IG AKRVDGVHDRYIEH KRTLPRDVTLQGLRI 
Sbjct: 121 LSDDIEAEIEDLLERDLNAQLAKSDDIGRAKRVDGVHDRYIEHAKRTLPRDVTLQGLRIA 180

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           +DCANGA+YKVAP V WELGA+VV IG++PNG NINL+CGST+ ++LQ+KV EVRADIGI
Sbjct: 181 IDCANGAAYKVAPAVLWELGAEVVTIGNEPNGTNINLNCGSTSPVALQKKVDEVRADIGI 240

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           ALDGD DRVIIVDE G+IV+GDQ+MA+IA  W     LRGNGIV TVMSN+GLERF+   
Sbjct: 241 ALDGDADRVIIVDENGSIVDGDQLMAVIAESWAESQQLRGNGIVATVMSNLGLERFLDDK 300

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           GL L RT+VGDRY++E+M+ + +NVGGEQSGHI+LSDYG+TGDGLVAALQ+L  +K+  +
Sbjct: 301 GLGLARTKVGDRYVVEHMRQHNYNVGGEQSGHIVLSDYGTTGDGLVAALQILAAVKRTGR 360

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
            VS +C  FE  PQ LR+V +     L    + +AIADAE+EL    RL++R SGTE LI
Sbjct: 361 TVSEVCRRFEPVPQLLRNVRISGGKPLEDIQVQKAIADAEAELARNGRLVIRPSGTEPLI 420

Query: 421 RIMAEGDDLSRIKRIVDDLAKVI 443
           R+MAEGDD ++I+RIV++L   I
Sbjct: 421 RVMAEGDDRAQIERIVNELIGTI 443


>gi|86359048|ref|YP_470940.1| phosphosugar isomerase protein [Rhizobium etli CFN 42]
 gi|123510886|sp|Q2K4M3|GLMM_RHIEC RecName: Full=Phosphoglucosamine mutase
 gi|86283150|gb|ABC92213.1| probable phosphosugar isomerase protein [Rhizobium etli CFN 42]
          Length = 450

 Score =  637 bits (1642), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 303/443 (68%), Positives = 364/443 (82%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           MKRR+FGTDGIRG+SN FP+TP+  MR+GIA G +FR      RVVIGKDTRLSGYMLEN
Sbjct: 1   MKRRYFGTDGIRGQSNVFPMTPDLAMRVGIAAGTIFRRGNHRHRVVIGKDTRLSGYMLEN 60

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           ++VAGFTAAG+DAFILGPIP+PAVAMLTRSLR D+GVMISASHNPY+DNGIKLFGPDGYK
Sbjct: 61  AMVAGFTAAGLDAFILGPIPTPAVAMLTRSLRCDIGVMISASHNPYEDNGIKLFGPDGYK 120

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +S DIE  IE LLE DL + L+  D IG AKRVDGVHDRYIEH KRTLPRDVTLQGLR+ 
Sbjct: 121 LSDDIEAEIEDLLEKDLNAQLAKSDDIGRAKRVDGVHDRYIEHAKRTLPRDVTLQGLRVA 180

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           +DCANGA+YKVAP V WELGADVV IG++PNG NINL+CGST+ ++LQ+KV EVRADIGI
Sbjct: 181 IDCANGAAYKVAPAVLWELGADVVTIGNEPNGTNINLNCGSTSPVALQKKVDEVRADIGI 240

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           ALDGD DRVII+DE G+IV+GDQ+MA+IA  W     LRGNGIV TVMSN+GLERF+   
Sbjct: 241 ALDGDADRVIIIDENGSIVDGDQLMAVIAESWAESQQLRGNGIVATVMSNLGLERFLDER 300

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           G++L RT+VGDRY++E+M+ + +NVGGEQSGHI+LSDYG+TGDGLVAALQ+L  +K+  +
Sbjct: 301 GMALARTKVGDRYVVEHMRQHNYNVGGEQSGHIVLSDYGTTGDGLVAALQILAAVKRTGR 360

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
            VS +C  FE  PQ LR+V +     L    + +AIADAE+EL    RL++R SGTE LI
Sbjct: 361 TVSEVCRRFEPVPQLLRNVRISGGKPLEDIQVQKAIADAEAELARNGRLVIRPSGTEPLI 420

Query: 421 RIMAEGDDLSRIKRIVDDLAKVI 443
           R+MAEGDD ++I+RIV++L   I
Sbjct: 421 RVMAEGDDRAQIERIVNELIGTI 443


>gi|209550771|ref|YP_002282688.1| phosphoglucosamine mutase [Rhizobium leguminosarum bv. trifolii
           WSM2304]
 gi|226723909|sp|B5ZNL4|GLMM_RHILW RecName: Full=Phosphoglucosamine mutase
 gi|209536527|gb|ACI56462.1| phosphoglucosamine mutase [Rhizobium leguminosarum bv. trifolii
           WSM2304]
          Length = 450

 Score =  635 bits (1639), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 303/443 (68%), Positives = 363/443 (81%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           MKRR+FGTDGIRG+SN FP+TP+  MR+GIA G +FR      RVVIGKDTRLSGYMLEN
Sbjct: 1   MKRRYFGTDGIRGQSNVFPMTPDLAMRVGIAAGTIFRRGNHRHRVVIGKDTRLSGYMLEN 60

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           ++VAGFTAAG+DAFILGPIP+PAVAMLTRSLR D+GVMISASHNPY+DNGIKLFGPDGYK
Sbjct: 61  AMVAGFTAAGLDAFILGPIPTPAVAMLTRSLRCDIGVMISASHNPYEDNGIKLFGPDGYK 120

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +S D+E  IE LLE DL + L+  D IG AKRVDGVHDRYIEH KRTLPRDVTLQGLRI 
Sbjct: 121 LSDDLEAEIEDLLEKDLNAQLAKSDDIGRAKRVDGVHDRYIEHAKRTLPRDVTLQGLRIA 180

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           +DCANGA+YKVAP V WELGA+VV IG++PNG NINL+CGST+ ++LQ+KV EVRADIGI
Sbjct: 181 IDCANGAAYKVAPAVLWELGAEVVTIGNEPNGTNINLNCGSTSPVALQKKVDEVRADIGI 240

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           ALDGD DRVIIVDE G+IV+GDQ+MA+IA  W     LRGNGIV TVMSN+GLERF+   
Sbjct: 241 ALDGDADRVIIVDENGSIVDGDQLMAVIAESWAESQQLRGNGIVATVMSNLGLERFLDDR 300

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           G++L RT VGDRY++E+M+ + +NVGGEQSGHI+LSDYG+TGDGLVAALQ+L  +K+  +
Sbjct: 301 GMALARTRVGDRYVVEHMRQHNYNVGGEQSGHIVLSDYGTTGDGLVAALQILAAVKRTGR 360

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
            VS +C  FE  PQ LR+V +     L    + +AIADAE+EL    RL++R SGTE LI
Sbjct: 361 TVSEVCRRFEPVPQLLRNVRISGGKPLEDIQVQKAIADAEAELAKNGRLVIRPSGTEPLI 420

Query: 421 RIMAEGDDLSRIKRIVDDLAKVI 443
           R+MAEGDD ++I+RIV++L   I
Sbjct: 421 RVMAEGDDRAQIERIVNELIGTI 443


>gi|163758785|ref|ZP_02165872.1| putative phosphoglucosamine mutase [Hoeflea phototrophica DFL-43]
 gi|162284075|gb|EDQ34359.1| putative phosphoglucosamine mutase [Hoeflea phototrophica DFL-43]
          Length = 450

 Score =  625 bits (1612), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 296/443 (66%), Positives = 364/443 (82%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M RR+FGTDGIRG++N  P+TP+  MR+GIAVG LFR      RVVIGKDTRLSGYM+EN
Sbjct: 1   MSRRYFGTDGIRGQANKSPMTPDIAMRVGIAVGNLFRRGDHRHRVVIGKDTRLSGYMIEN 60

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +LVAGFTAAG+D F+LGPIP+PAVAMLTRSLRAD+GVMISASHNPYQDNGIKLFGPDG+K
Sbjct: 61  ALVAGFTAAGLDVFLLGPIPTPAVAMLTRSLRADIGVMISASHNPYQDNGIKLFGPDGFK 120

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +S ++E RIE LL+DD+   L+  D+IG AKR+DGVHDRYIE  KRTLP+D+TL GLR+V
Sbjct: 121 LSDELESRIEDLLDDDIHLQLARPDAIGRAKRIDGVHDRYIEFAKRTLPKDITLAGLRVV 180

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           VDCANGA YKVAP   WELGADV+ IG++PNG NINL+CGST+ ++L RKVHEVRADIGI
Sbjct: 181 VDCANGAGYKVAPAALWELGADVIAIGEEPNGTNINLNCGSTHPVALSRKVHEVRADIGI 240

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           ALDGD DRV+IVDE G++++GDQ+MA+IA  W +  +LRG+GIV TVMSN+GLERF+  +
Sbjct: 241 ALDGDADRVLIVDENGSVIDGDQLMAVIAESWAADQMLRGDGIVATVMSNLGLERFLDDI 300

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           GLSL RT+VGDRY++E+M+ NGFNVGGEQSGHI+LSD+ +TGDGLVAALQV+  +++  +
Sbjct: 301 GLSLARTKVGDRYVVEHMRKNGFNVGGEQSGHIVLSDFATTGDGLVAALQVMACVQRMGR 360

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
           PVS +C  FE  PQ L++V     + LN S +  AI DAES L    RL++R SGTE LI
Sbjct: 361 PVSEVCRRFEPVPQVLKNVRHSGGNPLNDSRVKAAITDAESTLGNKARLVIRPSGTEPLI 420

Query: 421 RIMAEGDDLSRIKRIVDDLAKVI 443
           R+MAEGDD S+I+ +VD L  VI
Sbjct: 421 RVMAEGDDRSQIETVVDQLISVI 443


>gi|15966487|ref|NP_386840.1| putative phosphosugar isomerase protein [Sinorhizobium meliloti
           1021]
 gi|307300476|ref|ZP_07580256.1| phosphoglucosamine mutase [Sinorhizobium meliloti BL225C]
 gi|307318341|ref|ZP_07597776.1| phosphoglucosamine mutase [Sinorhizobium meliloti AK83]
 gi|81633969|sp|Q92M99|GLMM_RHIME RecName: Full=Phosphoglucosamine mutase
 gi|15075758|emb|CAC47313.1| Phosphoglucosamine mutase [Sinorhizobium meliloti 1021]
 gi|306896023|gb|EFN26774.1| phosphoglucosamine mutase [Sinorhizobium meliloti AK83]
 gi|306904642|gb|EFN35226.1| phosphoglucosamine mutase [Sinorhizobium meliloti BL225C]
          Length = 450

 Score =  612 bits (1578), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 290/443 (65%), Positives = 359/443 (81%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           MKRR+FGTDGIRG+SN FP+TP+  MR+GIAVG +FR      RVVIGKDTRLSGYMLEN
Sbjct: 1   MKRRYFGTDGIRGQSNIFPMTPDLAMRVGIAVGTIFRNGAHRHRVVIGKDTRLSGYMLEN 60

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           ++VAGFTAAG+D F+LGPIP+P VAMLTRSLRAD+GVMISASHN ++DNGIKLFGPDGYK
Sbjct: 61  AMVAGFTAAGLDVFLLGPIPTPGVAMLTRSLRADIGVMISASHNAFRDNGIKLFGPDGYK 120

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +S DIE +IE LLE D++  L+  + IG AKRVDG   RYIE  KRTLPRDVTL+GLRI 
Sbjct: 121 LSDDIEQKIEDLLEQDMSGQLAKPEDIGRAKRVDGDIYRYIEQAKRTLPRDVTLKGLRIA 180

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           +DCANGA+YKVAP   WELGA+VV IG +PNG+NINL+CGST+  +LQ+KVHEVRADIGI
Sbjct: 181 IDCANGAAYKVAPSALWELGAEVVTIGTEPNGVNINLECGSTHPAALQKKVHEVRADIGI 240

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           ALDGD DRV+IVDE+GA+++GDQ+MA+IA  W +  +L+G GI  TVMSN+GLER++   
Sbjct: 241 ALDGDADRVLIVDEEGAVIDGDQLMAVIADSWAADGMLKGGGIAATVMSNLGLERYLQAR 300

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
            L L RT+VGDRY++E M+ +G NVGGEQSGHI+LSD+G+TGDGLVAALQ+L  +K+  K
Sbjct: 301 RLKLHRTKVGDRYVVEQMRQDGLNVGGEQSGHIVLSDFGTTGDGLVAALQILAVVKRQGK 360

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
            VS IC  FE  PQ L++V V     L  +++ QAIA+AE++L    RL++R SGTE LI
Sbjct: 361 TVSEICRRFEPVPQVLKNVRVSAGKPLEDAAVQQAIAEAEAQLAKNGRLLIRPSGTEPLI 420

Query: 421 RIMAEGDDLSRIKRIVDDLAKVI 443
           R+MAEGDD  +++RIVD+L  VI
Sbjct: 421 RVMAEGDDRGQVERIVDELVNVI 443


>gi|222149668|ref|YP_002550625.1| phosphoglucosamine mutase [Agrobacterium vitis S4]
 gi|254798008|sp|B9JRY5|GLMM_AGRVS RecName: Full=Phosphoglucosamine mutase
 gi|221736650|gb|ACM37613.1| phosphoglucosamine mutase [Agrobacterium vitis S4]
          Length = 450

 Score =  612 bits (1578), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 296/443 (66%), Positives = 358/443 (80%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M RR+FGTDGIRG+SN FP+TP+  M++GIAVG + R      RVVIGKDTRLSGYMLE 
Sbjct: 1   MTRRYFGTDGIRGQSNVFPMTPDLAMKVGIAVGTILRRGHHRHRVVIGKDTRLSGYMLET 60

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +LVAGFTAAG+D F+LGPIP+PAVAMLTRSLRAD+GVM+SASHNP+ DNGIKLFGPDGYK
Sbjct: 61  ALVAGFTAAGLDVFLLGPIPTPAVAMLTRSLRADIGVMVSASHNPFADNGIKLFGPDGYK 120

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +S ++E  IE LL  +    L+  + IG AKRVDG   RYIE VKRTLPRDVTL GLRI 
Sbjct: 121 LSDELEAEIEALLNQEAPLPLARAEDIGRAKRVDGDIYRYIEFVKRTLPRDVTLSGLRIA 180

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           +DCANGA+YKVAP   WELGA+VV IG++PNG+NINL+CGST+  +LQ+KVHEVRADIGI
Sbjct: 181 IDCANGAAYKVAPTALWELGAEVVTIGNEPNGLNINLECGSTHPAALQKKVHEVRADIGI 240

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           ALDGD DRVIIVDE GAIV+GDQ+MA+IA  W +   L+G GIV TVMSN+GLERF+ G 
Sbjct: 241 ALDGDADRVIIVDETGAIVDGDQLMAVIAESWANDQTLKGGGIVATVMSNLGLERFLGGK 300

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           GL+L RT+VGDR+++E+M+ N +N+GGEQSGHI+LSD+G+TGDGLVAALQ+L  +K+  K
Sbjct: 301 GLTLARTKVGDRHVVEHMRQNHYNIGGEQSGHIVLSDFGTTGDGLVAALQILAAVKRTGK 360

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
            VS ICH F+  PQ LR+V +     L  S + QAIADAESEL    RL++R SGTE LI
Sbjct: 361 TVSQICHRFDPVPQLLRNVRISGGKPLEDSFVRQAIADAESELARNGRLVIRPSGTEPLI 420

Query: 421 RIMAEGDDLSRIKRIVDDLAKVI 443
           R+MAEGDD S+I+RIV+DL  VI
Sbjct: 421 RVMAEGDDRSQIERIVNDLIGVI 443


>gi|150397820|ref|YP_001328287.1| phosphoglucosamine mutase [Sinorhizobium medicae WSM419]
 gi|166990427|sp|A6UCS2|GLMM_SINMW RecName: Full=Phosphoglucosamine mutase
 gi|150029335|gb|ABR61452.1| phosphoglucosamine mutase [Sinorhizobium medicae WSM419]
          Length = 451

 Score =  608 bits (1567), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 287/443 (64%), Positives = 357/443 (80%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           MKR++FGTDGIRG+SN FP+TP+  MR+GIAVG +FR      RVVIGKDTRLSGYMLEN
Sbjct: 1   MKRKYFGTDGIRGQSNIFPMTPDLAMRVGIAVGTIFRNGAHRHRVVIGKDTRLSGYMLEN 60

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           ++VAGFTAAG+D F+LGPIP+P VAMLTRSLRAD+GVMISASHN ++DNGIKLFGPDGYK
Sbjct: 61  AMVAGFTAAGLDVFLLGPIPTPGVAMLTRSLRADIGVMISASHNAFRDNGIKLFGPDGYK 120

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +S DIE++IE LL+ D+T  L+  + IG AKRVDG   RYIE  KRTLPRDVTL GLRI 
Sbjct: 121 LSDDIEEKIEELLDQDMTRQLAKPEDIGRAKRVDGDIYRYIEQAKRTLPRDVTLTGLRIA 180

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           +DCANGA+YKVAP   WELGA+VV IG +PNG+NINL+CGST+  +LQ+KVHEVRADIGI
Sbjct: 181 IDCANGAAYKVAPSALWELGAEVVPIGTEPNGVNINLECGSTHPAALQKKVHEVRADIGI 240

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           ALDGD DRV+I+DE+G +++GDQ+MA+IA  W +  +L+G GI  TVMSN+GLER++   
Sbjct: 241 ALDGDADRVLIIDEEGQVIDGDQLMAVIADSWAADGMLKGGGIAATVMSNLGLERYLQAR 300

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
            L L RT+VGDRY++E M+ +G NVGGEQSGHI+LSD+G+TGDGLVAALQ+L  +K+  K
Sbjct: 301 RLKLHRTKVGDRYVVEQMRQDGLNVGGEQSGHIVLSDFGTTGDGLVAALQILAVVKRQGK 360

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
            VS IC  FE  PQ L++V +     L  + + QAIADAE++L    RL++R SGTE LI
Sbjct: 361 TVSEICRRFEPVPQVLKNVRISAGKPLEDAGVKQAIADAEAQLAKNGRLLIRPSGTEPLI 420

Query: 421 RIMAEGDDLSRIKRIVDDLAKVI 443
           R+MAEGDD  +++RIVD+L  VI
Sbjct: 421 RVMAEGDDRGKVERIVDELVSVI 443


>gi|227823303|ref|YP_002827275.1| phosphoglucosamine mutase [Sinorhizobium fredii NGR234]
 gi|227342304|gb|ACP26522.1| phosphoglucomutase/phosphomannomutase family protein MrsA
           [Sinorhizobium fredii NGR234]
          Length = 476

 Score =  607 bits (1566), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 287/443 (64%), Positives = 358/443 (80%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           MKR++FGTDGIRG+SN FP+T +  MR+G+AVG +FR      RVVIGKDTRLSGYMLEN
Sbjct: 27  MKRKYFGTDGIRGQSNIFPMTADLAMRVGVAVGTIFRNGAHRHRVVIGKDTRLSGYMLEN 86

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           ++VAGFTAAG+D F+LGPIP+P VAMLTRSLRAD+GVMISASHNP++DNGIKLFGPDGYK
Sbjct: 87  AMVAGFTAAGLDVFLLGPIPTPGVAMLTRSLRADIGVMISASHNPFRDNGIKLFGPDGYK 146

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +S DIE +IE L++ D++  L+  + IG AKRVDG   RYIE  KRTLPRDVTL+GLRI 
Sbjct: 147 LSDDIEQKIEELIDQDMSGQLAKPEDIGRAKRVDGDIYRYIEQAKRTLPRDVTLKGLRIA 206

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           +DCANGA+YKVAP   WELGA+VV IG +PNG+NINL+CGST+  +LQ+KVHEVRADIGI
Sbjct: 207 IDCANGAAYKVAPLALWELGAEVVSIGTEPNGVNINLECGSTHPEALQKKVHEVRADIGI 266

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           ALDGD DRV+IVDEKG +++GDQ+MA+IA  W +  +L+G GI  TVMSN+GLER++   
Sbjct: 267 ALDGDADRVLIVDEKGTVIDGDQLMAVIADSWAADGMLQGGGIAATVMSNLGLERYLQAR 326

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
            L L RT+VGDRY++E M+ +G NVGGEQSGHI+LSD+G+TGDGLVAALQ+L  +K+  +
Sbjct: 327 RLKLHRTKVGDRYVVEQMRQDGLNVGGEQSGHIVLSDFGTTGDGLVAALQILAVVKRQGR 386

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
            VS +C  FE  PQ L++V V     L   ++ QAIADAE+EL    RL++R SGTE LI
Sbjct: 387 AVSEVCRRFEPVPQVLKNVRVSAGKPLEHEAVRQAIADAEAELAKGGRLLIRPSGTEPLI 446

Query: 421 RIMAEGDDLSRIKRIVDDLAKVI 443
           R+MAEGDD S+++RIVD+L  VI
Sbjct: 447 RVMAEGDDRSKVERIVDELVTVI 469


>gi|332716438|ref|YP_004443904.1| phosphoglucomutase/phosphomannomutasefamily protein MrsA
           [Agrobacterium sp. H13-3]
 gi|325063123|gb|ADY66813.1| phosphoglucomutase/phosphomannomutasefamily protein MrsA
           [Agrobacterium sp. H13-3]
          Length = 450

 Score =  604 bits (1557), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 300/443 (67%), Positives = 360/443 (81%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M RR+FGTDGIRG+SN FP+TP+  MR+GIAVG +FR      RVVIGKDTRLSGYMLEN
Sbjct: 1   MARRYFGTDGIRGQSNVFPMTPDLAMRVGIAVGTIFRRGHHRHRVVIGKDTRLSGYMLEN 60

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +LVAGFTAAG+D F+LGPIP+PAVAMLTRSLRAD+GVMISASHNP+ DNGIKLFGPDGYK
Sbjct: 61  ALVAGFTAAGLDVFLLGPIPTPAVAMLTRSLRADIGVMISASHNPFSDNGIKLFGPDGYK 120

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +S ++E  IE LL+ DL + L+    IG AKRVDG   RYIE VKRTLPRDVTL GLRI 
Sbjct: 121 LSDELELEIEDLLDKDLYAQLAKPSEIGRAKRVDGDIYRYIEFVKRTLPRDVTLSGLRIA 180

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           +DCANGA+YKVAP   WELGA+VV IG++PNGININL+CGST+  +LQ+KVHEVRADIGI
Sbjct: 181 IDCANGAAYKVAPAALWELGAEVVTIGNEPNGININLECGSTHPEALQKKVHEVRADIGI 240

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           ALDGD DRVIIVDE+G IV+GDQ+MA+IA  W S + LRG GIV TVMSN+GLERF+   
Sbjct: 241 ALDGDADRVIIVDERGEIVDGDQLMAVIADSWASDNTLRGGGIVATVMSNLGLERFLGDK 300

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           GL+L RT+VGDRY++E+M+N+ FNVGGEQSGHI+LSDYG+TGDGLVAALQVL  +K+   
Sbjct: 301 GLTLARTKVGDRYVVEHMRNHNFNVGGEQSGHIVLSDYGTTGDGLVAALQVLAKVKRSGL 360

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
            VS +C  FE  PQ L++V +     L +  + QAIADAES L    RL++R SGTE LI
Sbjct: 361 TVSEVCRKFEPVPQLLKNVRISGGKPLENPIVQQAIADAESALANNGRLVIRPSGTEPLI 420

Query: 421 RIMAEGDDLSRIKRIVDDLAKVI 443
           R+MAEGDD +++++IV+DL  VI
Sbjct: 421 RVMAEGDDSAKVEQIVNDLVGVI 443


>gi|159185870|ref|NP_356911.2| phosphoglucomutase/phosphomannomutase [Agrobacterium tumefaciens
           str. C58]
 gi|84029233|sp|Q8U9L9|GLMM_AGRT5 RecName: Full=Phosphoglucosamine mutase
 gi|159141004|gb|AAK89696.2| phosphoglucomutase/phosphomannomutase [Agrobacterium tumefaciens
           str. C58]
          Length = 450

 Score =  601 bits (1550), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 297/443 (67%), Positives = 361/443 (81%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M RR+FGTDGIRG+SN FP+TP+  MR+GIAVG +FR      RVVIGKDTRLSGYMLEN
Sbjct: 1   MARRYFGTDGIRGQSNVFPMTPDLAMRVGIAVGTIFRRGHHRHRVVIGKDTRLSGYMLEN 60

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +LVAGFTAAG+D F+LGPIP+PAVAMLTRSLRAD+GVMISASHNP+ DNGIKLFGPDGYK
Sbjct: 61  ALVAGFTAAGLDVFLLGPIPTPAVAMLTRSLRADIGVMISASHNPFSDNGIKLFGPDGYK 120

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +S ++E  IE LL+ D+ + L+    IG AKRVDG   RYIE VKRTLPRDVTL GLRI 
Sbjct: 121 LSDELELEIEDLLDKDIYAQLAKPAEIGRAKRVDGDIYRYIEFVKRTLPRDVTLSGLRIA 180

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           +DCANGA+YKVAP   WELGA+VV IG++PNGININL+CGST+  +LQ+K+HEVRADIGI
Sbjct: 181 IDCANGAAYKVAPAALWELGAEVVTIGNEPNGININLECGSTHPEALQKKLHEVRADIGI 240

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           ALDGD DRVIIVDE+G IV+GDQ+MA+IA  W + + LRG GIV TVMSN+GLERF+   
Sbjct: 241 ALDGDADRVIIVDERGEIVDGDQLMAVIADSWAADNTLRGGGIVATVMSNLGLERFLGDK 300

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           GL+L RT+VGDRY++E+M+N+ FNVGGEQSGHI+LSDYG+TGDGLVAALQVL  +K+   
Sbjct: 301 GLTLARTKVGDRYVVEHMRNHNFNVGGEQSGHIVLSDYGTTGDGLVAALQVLAKVKRSGL 360

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
            VS +C  FE  PQ L++V +     L +  ++QAIADAES L    RL++R SGTE LI
Sbjct: 361 TVSEVCRKFEPVPQLLKNVRISGGKPLENPIVLQAIADAESALANNGRLVIRPSGTEPLI 420

Query: 421 RIMAEGDDLSRIKRIVDDLAKVI 443
           R+MAEGDD +++++IV+DL  VI
Sbjct: 421 RVMAEGDDSAKVEKIVNDLVGVI 443


>gi|254503536|ref|ZP_05115687.1| phosphoglucosamine mutase [Labrenzia alexandrii DFL-11]
 gi|222439607|gb|EEE46286.1| phosphoglucosamine mutase [Labrenzia alexandrii DFL-11]
          Length = 447

 Score =  597 bits (1540), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 277/441 (62%), Positives = 354/441 (80%)

Query: 3   RRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSL 62
           R+FFGTDGIRG++N +P+T    ++IG+A G +F+      RVVIGKDTRLSGYMLEN+L
Sbjct: 2   RKFFGTDGIRGQANAYPMTAEMALKIGMAAGLVFKNGGHRHRVVIGKDTRLSGYMLENAL 61

Query: 63  VAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVS 122
           VAGFT+ GMD F+LGP+P+PAVAMLTRSLR D+GVMISASHNP+QDNGIK FGPDG+K+S
Sbjct: 62  VAGFTSVGMDVFLLGPLPTPAVAMLTRSLRTDLGVMISASHNPFQDNGIKFFGPDGFKLS 121

Query: 123 TDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVVD 182
            +IE  IETL+E DLT +L+    +G AKR+DG  +RYIE  KRTLPR ++L+GLR+VVD
Sbjct: 122 DEIEKSIETLVESDLTPHLANAQELGRAKRIDGAQERYIETAKRTLPRKMSLEGLRVVVD 181

Query: 183 CANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIAL 242
           CANGA+YKVAP+  +ELGADV+ +G  P+G NIN DCGST+  +L +KVHEVRADIGIAL
Sbjct: 182 CANGAAYKVAPDALFELGADVIRMGVSPDGFNINKDCGSTSTDALSKKVHEVRADIGIAL 241

Query: 243 DGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLGL 302
           DGD DRVIIVDE G +V+GDQ+MA++A+ W ++  L GNGIV TVMSN+GLER++  LGL
Sbjct: 242 DGDADRVIIVDENGTVVDGDQLMAVVAQSWQANGRLAGNGIVATVMSNLGLERYLGDLGL 301

Query: 303 SLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKPV 362
            L+RT+VGDRY++E+M+ NGFNVGGEQSGHI+LSD+ +TGDGL+AALQ++  IKQ DKPV
Sbjct: 302 GLERTKVGDRYVVEHMRANGFNVGGEQSGHIVLSDFATTGDGLIAALQIMACIKQQDKPV 361

Query: 363 STICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLIRI 422
           S +C  FE  PQ L++V  K  + L  S +  AI D E+ L    RL++RASGTE LIR+
Sbjct: 362 SEVCRRFEPVPQILKNVRYKGGAPLQHSEVKSAIEDGEARLGTSGRLVIRASGTEPLIRV 421

Query: 423 MAEGDDLSRIKRIVDDLAKVI 443
           MAEGDD   +K++V+D+A V+
Sbjct: 422 MAEGDDADLVKQVVNDIAGVV 442


>gi|118588320|ref|ZP_01545729.1| phosphoglucomutase/phosphomannomutase family protein MrsA [Stappia
           aggregata IAM 12614]
 gi|118439026|gb|EAV45658.1| phosphoglucomutase/phosphomannomutase family protein MrsA [Stappia
           aggregata IAM 12614]
          Length = 447

 Score =  589 bits (1519), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 272/441 (61%), Positives = 346/441 (78%)

Query: 3   RRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSL 62
           R+FFGTDGIRG++N++P+T    +++G+A G  F+      RVVIGKDTRLSGYMLEN+L
Sbjct: 2   RKFFGTDGIRGQANSYPMTAEMALKVGMAAGLAFKNGGHRHRVVIGKDTRLSGYMLENAL 61

Query: 63  VAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVS 122
           VAGFT+ GMD F+LGP+P+PAVAMLTRSLR+D+GVMISASHNP+QDNGIK FGPDG+K+S
Sbjct: 62  VAGFTSVGMDVFLLGPMPTPAVAMLTRSLRSDLGVMISASHNPFQDNGIKFFGPDGFKLS 121

Query: 123 TDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVVD 182
             IE  IE L+E DLTS L     +G AKR+DG   RYIE  KRTLPR+++L+GLR+V+D
Sbjct: 122 DQIEQTIEELMESDLTSRLPSASELGRAKRIDGAQQRYIETAKRTLPREMSLEGLRVVID 181

Query: 183 CANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIAL 242
           CANGA+YKVAPE  WELGADV+ +G  P+G NIN +CGST+  +L RKVHEVRADIGIAL
Sbjct: 182 CANGAAYKVAPEALWELGADVITMGVTPDGFNINKECGSTSTDALSRKVHEVRADIGIAL 241

Query: 243 DGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLGL 302
           DGD DRVIIVDE G++V+GDQ+MA++A+ W + + L   GIV TVMSN+GLER++  LGL
Sbjct: 242 DGDADRVIIVDENGSVVDGDQLMAVVAQSWQASNRLSAPGIVATVMSNLGLERYLQSLGL 301

Query: 303 SLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKPV 362
            L RT+VGDRY++E+M+ NG+NVGGEQSGHI+LSD+ +TGDGL+A LQVL  +K  DKPV
Sbjct: 302 GLARTKVGDRYVVEHMRANGYNVGGEQSGHIVLSDFATTGDGLIAGLQVLACVKDQDKPV 361

Query: 363 STICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLIRI 422
           S +C  FE  PQ L++V  K    L    +  AI D E+ L    RL++RASGTE LIR+
Sbjct: 362 SEVCRRFEPVPQILKNVRYKGGKPLEQDLVKSAIEDGEARLGNSGRLVIRASGTEPLIRV 421

Query: 423 MAEGDDLSRIKRIVDDLAKVI 443
           MAEGDD   +K++V+D+A V+
Sbjct: 422 MAEGDDADLVKQVVNDIAGVV 442


>gi|110635495|ref|YP_675703.1| phosphoglucosamine mutase [Mesorhizobium sp. BNC1]
 gi|110286479|gb|ABG64538.1| phosphoglucosamine mutase [Chelativorans sp. BNC1]
          Length = 465

 Score =  588 bits (1516), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 274/439 (62%), Positives = 349/439 (79%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M +++FGTDGIRG++N FP+T    MR+G+A G  F+      RVV+GKDTRLSGYM+EN
Sbjct: 15  MSKQYFGTDGIRGRANRFPMTAEVAMRVGMAAGLSFQNGSHRHRVVLGKDTRLSGYMIEN 74

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           ++VAGF AAGMD F+LGPIP+PAVAML RSLRAD+GVMISASHNPY DNGIKLFGPDGYK
Sbjct: 75  AMVAGFCAAGMDVFLLGPIPTPAVAMLVRSLRADIGVMISASHNPYHDNGIKLFGPDGYK 134

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +S +IE+RIE +L+ D+   L+  +S+G AKRVDGVHDRYIE  KRTLPRD++L GLR+V
Sbjct: 135 LSDEIENRIEAMLDRDVELALADSESLGRAKRVDGVHDRYIEFAKRTLPRDMSLSGLRVV 194

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           +DCANGA+YKVAP   WELGA+VV I   PNG N+N +CGST+ +SL +KVHEVRADIGI
Sbjct: 195 IDCANGAAYKVAPAALWELGAEVVPIYVDPNGFNVNEECGSTHPMSLAKKVHEVRADIGI 254

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           ALDGD DRV+IVDE G I++GDQIMALIA  W  +  L G GIV TVMSN+GLERF+ G 
Sbjct: 255 ALDGDADRVVIVDENGTIIDGDQIMALIAESWHENEKLIGGGIVATVMSNLGLERFLRGR 314

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           GL L RT+VGDRY++E+M+ +G N+GGEQSGH++LSD+ ++GDGLV ALQVL +IK+ +K
Sbjct: 315 GLELHRTKVGDRYVVEHMREHGLNIGGEQSGHVVLSDFSTSGDGLVTALQVLAHIKRLNK 374

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
           P S +C  FE  PQ L++V +     L ++S+  AIADA+++L    RL++R SGTE LI
Sbjct: 375 PASEVCRKFEPVPQVLKNVRISGGKPLEAASVKAAIADAQAQLGDTGRLVIRPSGTEPLI 434

Query: 421 RIMAEGDDLSRIKRIVDDL 439
           R+MAEGDD   ++++VD +
Sbjct: 435 RVMAEGDDPELVRKMVDSI 453


>gi|254700352|ref|ZP_05162180.1| phosphoglucosamine mutase [Brucella suis bv. 5 str. 513]
          Length = 459

 Score =  588 bits (1516), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 271/443 (61%), Positives = 353/443 (79%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M R+FFGTDGIRG++N+FP+TP   M++G+AVGY+FR K +  RVVIGKDTR SGYMLEN
Sbjct: 9   MTRKFFGTDGIRGQANSFPMTPEIAMKVGMAVGYIFRRKGQASRVVIGKDTRRSGYMLEN 68

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +LVAGFTAAGMD F+LGPIP+PAVAML RSLRAD+GVMISASHNP+ DNGIKLFGPDG+K
Sbjct: 69  ALVAGFTAAGMDVFLLGPIPTPAVAMLCRSLRADIGVMISASHNPFYDNGIKLFGPDGFK 128

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +S  IE +IE ++E D+T +L+ +  +G AKRVDG   RYIE  KRTLPR+++L GLR+V
Sbjct: 129 LSDQIELQIEAMIEGDMTPFLASHGDVGRAKRVDGDIYRYIEFAKRTLPRNISLNGLRVV 188

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           VDCANGA YKVAP   WELGA+V+ I ++PNGININ DCGST+ + L +KVHEVRAD+GI
Sbjct: 189 VDCANGAGYKVAPAALWELGAEVITINNEPNGININEDCGSTHPIGLMKKVHEVRADVGI 248

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           ALDGD DRV++VDE G +++GDQ+MA+IA  W + + L G GIV TVMSN+GLERF+A  
Sbjct: 249 ALDGDADRVLLVDENGTVIDGDQLMAVIAESWAASNRLEGGGIVATVMSNLGLERFLADR 308

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
            L+L RT+VGDRY++E+M+ +GFNVGGEQSGHI+LSD+ +TGDGL++ALQ+L   ++ +K
Sbjct: 309 NLTLARTKVGDRYVVEHMREHGFNVGGEQSGHIVLSDFATTGDGLISALQILAVAQEQNK 368

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
           P+S +C  F+  PQ L++V       L +  +  AI +A+  L G  RL++R SGTE LI
Sbjct: 369 PISDVCRKFQPVPQLLKNVRTTGGKPLENKRVKSAINEAKERLGGQGRLVIRPSGTEPLI 428

Query: 421 RIMAEGDDLSRIKRIVDDLAKVI 443
           R+MAEGDD   ++++V+D+  VI
Sbjct: 429 RVMAEGDDRGLVEKVVNDIIDVI 451


>gi|261750846|ref|ZP_05994555.1| phosphoglucosamine mutase [Brucella suis bv. 5 str. 513]
 gi|261740599|gb|EEY28525.1| phosphoglucosamine mutase [Brucella suis bv. 5 str. 513]
          Length = 451

 Score =  588 bits (1515), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 271/443 (61%), Positives = 353/443 (79%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M R+FFGTDGIRG++N+FP+TP   M++G+AVGY+FR K +  RVVIGKDTR SGYMLEN
Sbjct: 1   MTRKFFGTDGIRGQANSFPMTPEIAMKVGMAVGYIFRRKGQASRVVIGKDTRRSGYMLEN 60

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +LVAGFTAAGMD F+LGPIP+PAVAML RSLRAD+GVMISASHNP+ DNGIKLFGPDG+K
Sbjct: 61  ALVAGFTAAGMDVFLLGPIPTPAVAMLCRSLRADIGVMISASHNPFYDNGIKLFGPDGFK 120

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +S  IE +IE ++E D+T +L+ +  +G AKRVDG   RYIE  KRTLPR+++L GLR+V
Sbjct: 121 LSDQIELQIEAMIEGDMTPFLASHGDVGRAKRVDGDIYRYIEFAKRTLPRNISLNGLRVV 180

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           VDCANGA YKVAP   WELGA+V+ I ++PNGININ DCGST+ + L +KVHEVRAD+GI
Sbjct: 181 VDCANGAGYKVAPAALWELGAEVITINNEPNGININEDCGSTHPIGLMKKVHEVRADVGI 240

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           ALDGD DRV++VDE G +++GDQ+MA+IA  W + + L G GIV TVMSN+GLERF+A  
Sbjct: 241 ALDGDADRVLLVDENGTVIDGDQLMAVIAESWAASNRLEGGGIVATVMSNLGLERFLADR 300

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
            L+L RT+VGDRY++E+M+ +GFNVGGEQSGHI+LSD+ +TGDGL++ALQ+L   ++ +K
Sbjct: 301 NLTLARTKVGDRYVVEHMREHGFNVGGEQSGHIVLSDFATTGDGLISALQILAVAQEQNK 360

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
           P+S +C  F+  PQ L++V       L +  +  AI +A+  L G  RL++R SGTE LI
Sbjct: 361 PISDVCRKFQPVPQLLKNVRTTGGKPLENKRVKSAINEAKERLGGQGRLVIRPSGTEPLI 420

Query: 421 RIMAEGDDLSRIKRIVDDLAKVI 443
           R+MAEGDD   ++++V+D+  VI
Sbjct: 421 RVMAEGDDRGLVEKVVNDIIDVI 443


>gi|23502548|ref|NP_698675.1| phosphoglucosamine mutase [Brucella suis 1330]
 gi|148559167|ref|YP_001259544.1| phosphoglucosamine mutase [Brucella ovis ATCC 25840]
 gi|256370099|ref|YP_003107610.1| phosphoglucosamine mutase [Brucella microti CCM 4915]
 gi|260568777|ref|ZP_05839245.1| phosphoglucosamine mutase [Brucella suis bv. 4 str. 40]
 gi|261325732|ref|ZP_05964929.1| phosphoglucosamine mutase [Brucella neotomae 5K33]
 gi|261754099|ref|ZP_05997808.1| phosphoglucosamine mutase [Brucella suis bv. 3 str. 686]
 gi|265984708|ref|ZP_06097443.1| phosphoglucosamine mutase [Brucella sp. 83/13]
 gi|81752147|sp|Q8FZ13|GLMM_BRUSU RecName: Full=Phosphoglucosamine mutase
 gi|158705795|sp|A5VS47|GLMM_BRUO2 RecName: Full=Phosphoglucosamine mutase
 gi|205830880|sp|A9WWG7|GLMM_BRUSI RecName: Full=Phosphoglucosamine mutase
 gi|205830881|sp|A9M7I9|GLMM_BRUC2 RecName: Full=Phosphoglucosamine mutase
 gi|23348548|gb|AAN30590.1| phosphoglucosamine mutase [Brucella suis 1330]
 gi|148370424|gb|ABQ60403.1| phosphoglucosamine mutase [Brucella ovis ATCC 25840]
 gi|256000262|gb|ACU48661.1| phosphoglucosamine mutase [Brucella microti CCM 4915]
 gi|260154161|gb|EEW89243.1| phosphoglucosamine mutase [Brucella suis bv. 4 str. 40]
 gi|261301712|gb|EEY05209.1| phosphoglucosamine mutase [Brucella neotomae 5K33]
 gi|261743852|gb|EEY31778.1| phosphoglucosamine mutase [Brucella suis bv. 3 str. 686]
 gi|264663300|gb|EEZ33561.1| phosphoglucosamine mutase [Brucella sp. 83/13]
          Length = 451

 Score =  588 bits (1515), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 271/443 (61%), Positives = 353/443 (79%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M R+FFGTDGIRG++N+FP+TP   M++G+AVGY+FR K +  RVVIGKDTR SGYMLEN
Sbjct: 1   MTRKFFGTDGIRGQANSFPMTPEIAMKVGMAVGYIFRRKGQASRVVIGKDTRRSGYMLEN 60

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +LVAGFTAAGMD F+LGPIP+PAVAML RSLRAD+GVMISASHNP+ DNGIKLFGPDG+K
Sbjct: 61  ALVAGFTAAGMDVFLLGPIPTPAVAMLCRSLRADIGVMISASHNPFYDNGIKLFGPDGFK 120

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +S  IE +IE ++E D+T +L+ +  +G AKRVDG   RYIE  KRTLPR+++L GLR+V
Sbjct: 121 LSDQIELQIEAMIEGDMTPFLASHGDVGRAKRVDGDIYRYIEFAKRTLPRNISLNGLRVV 180

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           VDCANGA YKVAP   WELGA+V+ I ++PNGININ DCGST+ + L +KVHEVRAD+GI
Sbjct: 181 VDCANGAGYKVAPAALWELGAEVITINNEPNGININEDCGSTHPIGLMKKVHEVRADVGI 240

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           ALDGD DRV++VDE G +++GDQ+MA+IA  W + + L G GIV TVMSN+GLERF+A  
Sbjct: 241 ALDGDADRVLLVDENGTVIDGDQLMAVIAESWAASNRLEGGGIVATVMSNLGLERFLADR 300

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
            L+L RT+VGDRY++E+M+ +GFNVGGEQSGHI+LSD+ +TGDGL++ALQ+L   ++ +K
Sbjct: 301 NLTLARTKVGDRYVVEHMREHGFNVGGEQSGHIVLSDFATTGDGLISALQILAVAQEQNK 360

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
           P+S +C  F+  PQ L++V       L +  +  AI +A+  L G  RL++R SGTE LI
Sbjct: 361 PISDVCRKFQPVPQLLKNVRTTGGKPLENKRVKSAIDEAKERLGGQGRLVIRPSGTEPLI 420

Query: 421 RIMAEGDDLSRIKRIVDDLAKVI 443
           R+MAEGDD   ++++V+D+  VI
Sbjct: 421 RVMAEGDDRGLVEKVVNDIIDVI 443


>gi|161619620|ref|YP_001593507.1| phosphoglucosamine mutase [Brucella canis ATCC 23365]
 gi|163845270|ref|YP_001622925.1| phosphoglucosamine mutase [Brucella suis ATCC 23445]
 gi|254703469|ref|ZP_05165297.1| phosphoglucosamine mutase [Brucella suis bv. 3 str. 686]
 gi|254719693|ref|ZP_05181504.1| phosphoglucosamine mutase [Brucella sp. 83/13]
 gi|256061728|ref|ZP_05451865.1| phosphoglucosamine mutase [Brucella neotomae 5K33]
 gi|306837848|ref|ZP_07470710.1| phosphoglucosamine mutase [Brucella sp. NF 2653]
 gi|161336431|gb|ABX62736.1| phosphoglucosamine mutase [Brucella canis ATCC 23365]
 gi|163675993|gb|ABY40103.1| phosphoglucosamine mutase [Brucella suis ATCC 23445]
 gi|306407087|gb|EFM63304.1| phosphoglucosamine mutase [Brucella sp. NF 2653]
          Length = 459

 Score =  587 bits (1514), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 271/443 (61%), Positives = 353/443 (79%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M R+FFGTDGIRG++N+FP+TP   M++G+AVGY+FR K +  RVVIGKDTR SGYMLEN
Sbjct: 9   MTRKFFGTDGIRGQANSFPMTPEIAMKVGMAVGYIFRRKGQASRVVIGKDTRRSGYMLEN 68

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +LVAGFTAAGMD F+LGPIP+PAVAML RSLRAD+GVMISASHNP+ DNGIKLFGPDG+K
Sbjct: 69  ALVAGFTAAGMDVFLLGPIPTPAVAMLCRSLRADIGVMISASHNPFYDNGIKLFGPDGFK 128

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +S  IE +IE ++E D+T +L+ +  +G AKRVDG   RYIE  KRTLPR+++L GLR+V
Sbjct: 129 LSDQIELQIEAMIEGDMTPFLASHGDVGRAKRVDGDIYRYIEFAKRTLPRNISLNGLRVV 188

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           VDCANGA YKVAP   WELGA+V+ I ++PNGININ DCGST+ + L +KVHEVRAD+GI
Sbjct: 189 VDCANGAGYKVAPAALWELGAEVITINNEPNGININEDCGSTHPIGLMKKVHEVRADVGI 248

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           ALDGD DRV++VDE G +++GDQ+MA+IA  W + + L G GIV TVMSN+GLERF+A  
Sbjct: 249 ALDGDADRVLLVDENGTVIDGDQLMAVIAESWAASNRLEGGGIVATVMSNLGLERFLADR 308

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
            L+L RT+VGDRY++E+M+ +GFNVGGEQSGHI+LSD+ +TGDGL++ALQ+L   ++ +K
Sbjct: 309 NLTLARTKVGDRYVVEHMREHGFNVGGEQSGHIVLSDFATTGDGLISALQILAVAQEQNK 368

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
           P+S +C  F+  PQ L++V       L +  +  AI +A+  L G  RL++R SGTE LI
Sbjct: 369 PISDVCRKFQPVPQLLKNVRTTGGKPLENKRVKSAIDEAKERLGGQGRLVIRPSGTEPLI 428

Query: 421 RIMAEGDDLSRIKRIVDDLAKVI 443
           R+MAEGDD   ++++V+D+  VI
Sbjct: 429 RVMAEGDDRGLVEKVVNDIIDVI 451


>gi|158705924|sp|Q11DI7|GLMM_MESSB RecName: Full=Phosphoglucosamine mutase
          Length = 451

 Score =  587 bits (1513), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 274/439 (62%), Positives = 349/439 (79%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M +++FGTDGIRG++N FP+T    MR+G+A G  F+      RVV+GKDTRLSGYM+EN
Sbjct: 1   MSKQYFGTDGIRGRANRFPMTAEVAMRVGMAAGLSFQNGSHRHRVVLGKDTRLSGYMIEN 60

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           ++VAGF AAGMD F+LGPIP+PAVAML RSLRAD+GVMISASHNPY DNGIKLFGPDGYK
Sbjct: 61  AMVAGFCAAGMDVFLLGPIPTPAVAMLVRSLRADIGVMISASHNPYHDNGIKLFGPDGYK 120

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +S +IE+RIE +L+ D+   L+  +S+G AKRVDGVHDRYIE  KRTLPRD++L GLR+V
Sbjct: 121 LSDEIENRIEAMLDRDVELALADSESLGRAKRVDGVHDRYIEFAKRTLPRDMSLSGLRVV 180

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           +DCANGA+YKVAP   WELGA+VV I   PNG N+N +CGST+ +SL +KVHEVRADIGI
Sbjct: 181 IDCANGAAYKVAPAALWELGAEVVPIYVDPNGFNVNEECGSTHPMSLAKKVHEVRADIGI 240

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           ALDGD DRV+IVDE G I++GDQIMALIA  W  +  L G GIV TVMSN+GLERF+ G 
Sbjct: 241 ALDGDADRVVIVDENGTIIDGDQIMALIAESWHENEKLIGGGIVATVMSNLGLERFLRGR 300

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           GL L RT+VGDRY++E+M+ +G N+GGEQSGH++LSD+ ++GDGLV ALQVL +IK+ +K
Sbjct: 301 GLELHRTKVGDRYVVEHMREHGLNIGGEQSGHVVLSDFSTSGDGLVTALQVLAHIKRLNK 360

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
           P S +C  FE  PQ L++V +     L ++S+  AIADA+++L    RL++R SGTE LI
Sbjct: 361 PASEVCRKFEPVPQVLKNVRISGGKPLEAASVKAAIADAQAQLGDTGRLVIRPSGTEPLI 420

Query: 421 RIMAEGDDLSRIKRIVDDL 439
           R+MAEGDD   ++++VD +
Sbjct: 421 RVMAEGDDPELVRKMVDSI 439


>gi|254708442|ref|ZP_05170270.1| phosphoglucosamine mutase [Brucella pinnipedialis M163/99/10]
 gi|254708705|ref|ZP_05170516.1| phosphoglucosamine mutase [Brucella pinnipedialis B2/94]
 gi|254714552|ref|ZP_05176363.1| phosphoglucosamine mutase [Brucella ceti M644/93/1]
 gi|254717449|ref|ZP_05179260.1| phosphoglucosamine mutase [Brucella ceti M13/05/1]
 gi|256030231|ref|ZP_05443845.1| phosphoglucosamine mutase [Brucella pinnipedialis M292/94/1]
 gi|260167906|ref|ZP_05754717.1| phosphoglucosamine mutase [Brucella sp. F5/99]
          Length = 459

 Score =  587 bits (1513), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 271/443 (61%), Positives = 353/443 (79%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M R+FFGTDGIRG++N+FP+TP   M++G+AVGY+FR K +  RVVIGKDTR SGYMLEN
Sbjct: 9   MTRKFFGTDGIRGQANSFPMTPEIAMKVGMAVGYIFRRKGQASRVVIGKDTRRSGYMLEN 68

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +LVAGFTAAGMD F+LGPIP+PAVAML RSLRAD+GVMISASHNP+ DNGIKLFGPDG+K
Sbjct: 69  ALVAGFTAAGMDVFLLGPIPTPAVAMLCRSLRADIGVMISASHNPFYDNGIKLFGPDGFK 128

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +S  IE +IE ++E D+T +L+ +  +G AKRVDG   RYIE  KRTLPR+++L GLR+V
Sbjct: 129 LSDQIELQIEAMIEGDMTPFLASHGDVGRAKRVDGDIYRYIEFAKRTLPRNISLNGLRVV 188

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           VDCANGA YKVAP   WELGA+V+ I ++PNGININ DCGST+ + L +KVHEVRAD+GI
Sbjct: 189 VDCANGAVYKVAPAALWELGAEVITINNEPNGININEDCGSTHPIGLMKKVHEVRADVGI 248

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           ALDGD DRV++VDE G +++GDQ+MA+IA  W + + L G GIV TVMSN+GLERF+A  
Sbjct: 249 ALDGDADRVLLVDENGTVIDGDQLMAVIAESWAASNRLEGGGIVATVMSNLGLERFLADR 308

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
            L+L RT+VGDRY++E+M+ +GFNVGGEQSGHI+LSD+ +TGDGL++ALQ+L   ++ +K
Sbjct: 309 NLTLARTKVGDRYVVEHMREHGFNVGGEQSGHIVLSDFATTGDGLISALQILAVAQEQNK 368

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
           P+S +C  F+  PQ L++V       L +  +  AI +A+  L G  RL++R SGTE LI
Sbjct: 369 PISDVCRKFQPVPQLLKNVRTTGGKPLENKRVKSAIDEAKERLGGQGRLVIRPSGTEPLI 428

Query: 421 RIMAEGDDLSRIKRIVDDLAKVI 443
           R+MAEGDD   ++++V+D+  VI
Sbjct: 429 RVMAEGDDRGLVEKVVNDIIDVI 451


>gi|261219280|ref|ZP_05933561.1| phosphoglucosamine mutase [Brucella ceti M13/05/1]
 gi|261315942|ref|ZP_05955139.1| phosphoglucosamine mutase [Brucella pinnipedialis M163/99/10]
 gi|261316196|ref|ZP_05955393.1| phosphoglucosamine mutase [Brucella pinnipedialis B2/94]
 gi|261322341|ref|ZP_05961538.1| phosphoglucosamine mutase [Brucella ceti M644/93/1]
 gi|261757344|ref|ZP_06001053.1| phosphoglucosamine mutase [Brucella sp. F5/99]
 gi|265987259|ref|ZP_06099816.1| phosphoglucosamine mutase [Brucella pinnipedialis M292/94/1]
 gi|260924369|gb|EEX90937.1| phosphoglucosamine mutase [Brucella ceti M13/05/1]
 gi|261295031|gb|EEX98527.1| phosphoglucosamine mutase [Brucella ceti M644/93/1]
 gi|261295419|gb|EEX98915.1| phosphoglucosamine mutase [Brucella pinnipedialis B2/94]
 gi|261304968|gb|EEY08465.1| phosphoglucosamine mutase [Brucella pinnipedialis M163/99/10]
 gi|261737328|gb|EEY25324.1| phosphoglucosamine mutase [Brucella sp. F5/99]
 gi|264659456|gb|EEZ29717.1| phosphoglucosamine mutase [Brucella pinnipedialis M292/94/1]
          Length = 451

 Score =  587 bits (1513), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 271/443 (61%), Positives = 353/443 (79%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M R+FFGTDGIRG++N+FP+TP   M++G+AVGY+FR K +  RVVIGKDTR SGYMLEN
Sbjct: 1   MTRKFFGTDGIRGQANSFPMTPEIAMKVGMAVGYIFRRKGQASRVVIGKDTRRSGYMLEN 60

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +LVAGFTAAGMD F+LGPIP+PAVAML RSLRAD+GVMISASHNP+ DNGIKLFGPDG+K
Sbjct: 61  ALVAGFTAAGMDVFLLGPIPTPAVAMLCRSLRADIGVMISASHNPFYDNGIKLFGPDGFK 120

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +S  IE +IE ++E D+T +L+ +  +G AKRVDG   RYIE  KRTLPR+++L GLR+V
Sbjct: 121 LSDQIELQIEAMIEGDMTPFLASHGDVGRAKRVDGDIYRYIEFAKRTLPRNISLNGLRVV 180

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           VDCANGA YKVAP   WELGA+V+ I ++PNGININ DCGST+ + L +KVHEVRAD+GI
Sbjct: 181 VDCANGAVYKVAPAALWELGAEVITINNEPNGININEDCGSTHPIGLMKKVHEVRADVGI 240

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           ALDGD DRV++VDE G +++GDQ+MA+IA  W + + L G GIV TVMSN+GLERF+A  
Sbjct: 241 ALDGDADRVLLVDENGTVIDGDQLMAVIAESWAASNRLEGGGIVATVMSNLGLERFLADR 300

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
            L+L RT+VGDRY++E+M+ +GFNVGGEQSGHI+LSD+ +TGDGL++ALQ+L   ++ +K
Sbjct: 301 NLTLARTKVGDRYVVEHMREHGFNVGGEQSGHIVLSDFATTGDGLISALQILAVAQEQNK 360

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
           P+S +C  F+  PQ L++V       L +  +  AI +A+  L G  RL++R SGTE LI
Sbjct: 361 PISDVCRKFQPVPQLLKNVRTTGGKPLENKRVKSAIDEAKERLGGQGRLVIRPSGTEPLI 420

Query: 421 RIMAEGDDLSRIKRIVDDLAKVI 443
           R+MAEGDD   ++++V+D+  VI
Sbjct: 421 RVMAEGDDRGLVEKVVNDIIDVI 443


>gi|225628259|ref|ZP_03786293.1| phosphoglucosamine mutase [Brucella ceti str. Cudo]
 gi|225616105|gb|EEH13153.1| phosphoglucosamine mutase [Brucella ceti str. Cudo]
          Length = 475

 Score =  587 bits (1512), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 271/443 (61%), Positives = 353/443 (79%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M R+FFGTDGIRG++N+FP+TP   M++G+AVGY+FR K +  RVVIGKDTR SGYMLEN
Sbjct: 25  MTRKFFGTDGIRGQANSFPMTPEIAMKVGMAVGYIFRRKGQASRVVIGKDTRRSGYMLEN 84

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +LVAGFTAAGMD F+LGPIP+PAVAML RSLRAD+GVMISASHNP+ DNGIKLFGPDG+K
Sbjct: 85  ALVAGFTAAGMDVFLLGPIPTPAVAMLCRSLRADIGVMISASHNPFYDNGIKLFGPDGFK 144

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +S  IE +IE ++E D+T +L+ +  +G AKRVDG   RYIE  KRTLPR+++L GLR+V
Sbjct: 145 LSDQIELQIEAMIEGDMTPFLASHGDVGRAKRVDGDIYRYIEFAKRTLPRNISLNGLRVV 204

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           VDCANGA YKVAP   WELGA+V+ I ++PNGININ DCGST+ + L +KVHEVRAD+GI
Sbjct: 205 VDCANGAVYKVAPAALWELGAEVITINNEPNGININEDCGSTHPIGLMKKVHEVRADVGI 264

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           ALDGD DRV++VDE G +++GDQ+MA+IA  W + + L G GIV TVMSN+GLERF+A  
Sbjct: 265 ALDGDADRVLLVDENGTVIDGDQLMAVIAESWAASNRLEGGGIVATVMSNLGLERFLADR 324

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
            L+L RT+VGDRY++E+M+ +GFNVGGEQSGHI+LSD+ +TGDGL++ALQ+L   ++ +K
Sbjct: 325 NLTLARTKVGDRYVVEHMREHGFNVGGEQSGHIVLSDFATTGDGLISALQILAVAQEQNK 384

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
           P+S +C  F+  PQ L++V       L +  +  AI +A+  L G  RL++R SGTE LI
Sbjct: 385 PISDVCRKFQPVPQLLKNVRTTGGKPLENKRVKSAIDEAKERLGGQGRLVIRPSGTEPLI 444

Query: 421 RIMAEGDDLSRIKRIVDDLAKVI 443
           R+MAEGDD   ++++V+D+  VI
Sbjct: 445 RVMAEGDDRGLVEKVVNDIIDVI 467


>gi|306841409|ref|ZP_07474111.1| phosphoglucosamine mutase [Brucella sp. BO2]
 gi|306844683|ref|ZP_07477268.1| phosphoglucosamine mutase [Brucella sp. BO1]
 gi|306274855|gb|EFM56625.1| phosphoglucosamine mutase [Brucella sp. BO1]
 gi|306288515|gb|EFM59867.1| phosphoglucosamine mutase [Brucella sp. BO2]
          Length = 459

 Score =  586 bits (1511), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 270/443 (60%), Positives = 352/443 (79%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M R+FFGTDGIRG++N+FP+TP   M++G+AVGY+FR K +  RVVIGKDTR SGYMLEN
Sbjct: 9   MTRKFFGTDGIRGQANSFPMTPEIAMKVGMAVGYIFRRKGQASRVVIGKDTRRSGYMLEN 68

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +LVAGFTAAGM+ F+LGPIP+PAVAML RSLRAD+GVMISASHNP+ DNGIKLFGPDG+K
Sbjct: 69  ALVAGFTAAGMEVFLLGPIPTPAVAMLCRSLRADIGVMISASHNPFYDNGIKLFGPDGFK 128

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +S  IE +IE ++E D+T +L+ +  +G AKRVDG   RYIE  KRTLPR+++L GLR+V
Sbjct: 129 LSDQIELQIEAMIEGDMTPFLASHGDVGRAKRVDGDIYRYIEFAKRTLPRNISLNGLRVV 188

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           VDCANGA YKVAP   WELGA+V+ I ++PNGININ DCGST+ + L +KVHEVRAD+GI
Sbjct: 189 VDCANGAGYKVAPAALWELGAEVITINNEPNGININEDCGSTHPIGLMKKVHEVRADVGI 248

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           ALDGD DRV++VDE G +++GDQ+MA+IA  W   + L G GIV TVMSN+GLERF+A  
Sbjct: 249 ALDGDADRVLLVDENGTVIDGDQLMAVIAESWAESNRLEGGGIVATVMSNLGLERFLADR 308

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
            L+L RT+VGDRY++E+M+ +GFNVGGEQSGHI+LSD+ +TGDGL++ALQ+L   ++ +K
Sbjct: 309 NLTLARTKVGDRYVVEHMREHGFNVGGEQSGHIVLSDFATTGDGLISALQILAVAQEQNK 368

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
           P+S +C  F+  PQ L++V       L +  +  AI +A+  L G  RL++R SGTE LI
Sbjct: 369 PISDVCRKFQPVPQLLKNVRTTGGKPLENKRVKSAIDEAKERLGGQGRLVIRPSGTEPLI 428

Query: 421 RIMAEGDDLSRIKRIVDDLAKVI 443
           R+MAEGDD   ++++V+D+  VI
Sbjct: 429 RVMAEGDDRGLVEKVVNDIIDVI 451


>gi|254694351|ref|ZP_05156179.1| Phosphoglucosamine mutase [Brucella abortus bv. 3 str. Tulya]
          Length = 459

 Score =  584 bits (1506), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 269/443 (60%), Positives = 351/443 (79%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M R+FFGTDGIRG++N+FP+TP   M++G+AVGY+FR K +  R VIGKDTR SGYMLE 
Sbjct: 9   MTRKFFGTDGIRGQANSFPMTPEIAMKVGMAVGYIFRRKGQASRAVIGKDTRRSGYMLEK 68

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +LVAGFTAAGMD F+LGPIP+PAVAML RSLRAD+GVMISASHNP+ DNGIKLFGPDG+K
Sbjct: 69  ALVAGFTAAGMDVFLLGPIPTPAVAMLCRSLRADIGVMISASHNPFYDNGIKLFGPDGFK 128

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +S  IE +IE ++E D+T +L+ +  +G AKRVDG   RYIE  KRTLPR+++L GLR+V
Sbjct: 129 LSDQIELQIEAMIEGDMTPFLASHGDVGRAKRVDGDIYRYIEFAKRTLPRNISLNGLRVV 188

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           VDCANGA YKVAP   WELGA+V+ I ++PNGININ DCGST+ + L +KVHEVRAD+GI
Sbjct: 189 VDCANGAGYKVAPAALWELGAEVITINNEPNGININEDCGSTHPIGLMKKVHEVRADVGI 248

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           ALDGD DRV++VDE G +++GDQ+MA+IA  W + + L G GIV TVMSN+GLERF+A  
Sbjct: 249 ALDGDADRVLLVDENGTVIDGDQLMAVIAESWAASNRLEGGGIVATVMSNLGLERFLADR 308

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
            L+L RT+VGDRY++E+M+ +GFNVGGEQSGHI+LSD+ +TGDGL++ALQ+L   ++ +K
Sbjct: 309 NLTLARTKVGDRYVVEHMREHGFNVGGEQSGHIVLSDFATTGDGLISALQILAVAQEQNK 368

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
           P+S +C  F+  PQ L++V       L +  +  AI +A+  L G  RL++R SGTE LI
Sbjct: 369 PISDVCRKFQPVPQLLKNVRTTGGKPLENKRVKSAIDEAKERLGGQGRLVIRPSGTEPLI 428

Query: 421 RIMAEGDDLSRIKRIVDDLAKVI 443
           R+MAEGDD   ++++V+D+  VI
Sbjct: 429 RVMAEGDDRGLVEKVVNDIIDVI 451


>gi|294850943|ref|ZP_06791619.1| phosphoglucosamine mutase [Brucella sp. NVSL 07-0026]
 gi|294821586|gb|EFG38582.1| phosphoglucosamine mutase [Brucella sp. NVSL 07-0026]
          Length = 451

 Score =  584 bits (1505), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 270/443 (60%), Positives = 352/443 (79%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M R+FFGTDGIRG++N+FP+TP   M++G+AVGY+FR K +  RVVIGKDTR SGYMLEN
Sbjct: 1   MTRKFFGTDGIRGQANSFPMTPEIAMKVGMAVGYIFRRKGQASRVVIGKDTRRSGYMLEN 60

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +LVAGFTAAGMD F+LGPIP+PAVAML RSLRAD+GVMISASHNP+ DNGIKLFGPDG+K
Sbjct: 61  ALVAGFTAAGMDVFLLGPIPTPAVAMLCRSLRADIGVMISASHNPFYDNGIKLFGPDGFK 120

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +S  IE +IE ++E D+T +L+ +  +G AKRVDG   RYIE  KRTLPR+++L  LR+V
Sbjct: 121 LSDQIELQIEAMIEGDMTPFLASHGDVGRAKRVDGDIYRYIEFAKRTLPRNISLNRLRVV 180

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           VDCANGA YKVAP   WELGA+V+ I ++PNGININ DCGST+ + L +KVHEVRAD+GI
Sbjct: 181 VDCANGAGYKVAPAALWELGAEVITINNEPNGININEDCGSTHPIGLMKKVHEVRADVGI 240

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           ALDGD DRV++VDE G +++GDQ+MA+IA  W + + L G GIV TVMSN+GLERF+A  
Sbjct: 241 ALDGDADRVLLVDENGTVIDGDQLMAVIAESWAASNRLEGGGIVATVMSNLGLERFLADR 300

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
            L+L RT+VGDRY++E+M+ +GFNVGGEQSGHI+LSD+ +TGDGL++ALQ+L   ++ +K
Sbjct: 301 NLTLARTKVGDRYVVEHMREHGFNVGGEQSGHIVLSDFATTGDGLISALQILAVAQEQNK 360

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
           P+S +C  F+  PQ L++V       L +  +  AI +A+  L G  RL++R SGTE LI
Sbjct: 361 PISDVCRKFQPVPQLLKNVRTTGGKPLENKRVKSAIDEAKERLGGQGRLVIRPSGTEPLI 420

Query: 421 RIMAEGDDLSRIKRIVDDLAKVI 443
           R+MAEGDD   ++++V+D+  VI
Sbjct: 421 RVMAEGDDRGLVEKVVNDIIDVI 443


>gi|326409704|gb|ADZ66769.1| phosphoglucosamine mutase [Brucella melitensis M28]
          Length = 460

 Score =  584 bits (1505), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 269/443 (60%), Positives = 351/443 (79%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M R+FFGTDGIRG++N+FP+TP   M++G+AVGY+FR K +  R VIGKDTR SGYMLEN
Sbjct: 10  MTRKFFGTDGIRGQANSFPMTPEIAMKVGMAVGYIFRRKGQASRAVIGKDTRRSGYMLEN 69

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +LVAGFTAAGMD F+LGPIP+PAVAML RSLRAD+GVMISASHNP+ DNGIKLFGPDG+K
Sbjct: 70  ALVAGFTAAGMDVFLLGPIPTPAVAMLCRSLRADIGVMISASHNPFYDNGIKLFGPDGFK 129

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +S  IE +IE ++E D+T +L+ +  +G AKRVDG   RYIE  KRTLPR+++L GLR+V
Sbjct: 130 LSDQIELQIEAMIEGDMTPFLASHGDVGRAKRVDGDIYRYIEFAKRTLPRNISLNGLRVV 189

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           VDCANGA YKVAP   WELGA+V+ I ++PNGININ DCGST+ + L +KVH VRAD+GI
Sbjct: 190 VDCANGAGYKVAPAALWELGAEVITINNEPNGININEDCGSTHPIGLMKKVHGVRADVGI 249

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           ALDGD DRV++VDE G +++GDQ+MA+IA  W + + L G GIV TVMSN+GLERF+A  
Sbjct: 250 ALDGDADRVLLVDENGTVIDGDQLMAVIAESWAASNRLEGGGIVATVMSNLGLERFLADR 309

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
            L+L RT+VGDRY++E+M+ +GFNVGGEQSGHI+LSD+ +TGDGL++ALQ+L   ++ +K
Sbjct: 310 NLTLARTKVGDRYVVEHMREHGFNVGGEQSGHIVLSDFATTGDGLISALQILAVAQEQNK 369

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
           P+S +C  F+  PQ L++V       L +  +  AI +A+  L G  RL++R SGTE LI
Sbjct: 370 PISDVCRKFQPVPQLLKNVRTTGGKPLENKRVKSAIDEAKERLGGQGRLVIRPSGTEPLI 429

Query: 421 RIMAEGDDLSRIKRIVDDLAKVI 443
           R+MAEGDD   ++++V+D+  VI
Sbjct: 430 RVMAEGDDRGLVEKVVNDIIDVI 452


>gi|261214659|ref|ZP_05928940.1| phosphoglucosamine mutase [Brucella abortus bv. 3 str. Tulya]
 gi|260916266|gb|EEX83127.1| phosphoglucosamine mutase [Brucella abortus bv. 3 str. Tulya]
          Length = 451

 Score =  584 bits (1505), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 269/443 (60%), Positives = 351/443 (79%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M R+FFGTDGIRG++N+FP+TP   M++G+AVGY+FR K +  R VIGKDTR SGYMLE 
Sbjct: 1   MTRKFFGTDGIRGQANSFPMTPEIAMKVGMAVGYIFRRKGQASRAVIGKDTRRSGYMLEK 60

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +LVAGFTAAGMD F+LGPIP+PAVAML RSLRAD+GVMISASHNP+ DNGIKLFGPDG+K
Sbjct: 61  ALVAGFTAAGMDVFLLGPIPTPAVAMLCRSLRADIGVMISASHNPFYDNGIKLFGPDGFK 120

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +S  IE +IE ++E D+T +L+ +  +G AKRVDG   RYIE  KRTLPR+++L GLR+V
Sbjct: 121 LSDQIELQIEAMIEGDMTPFLASHGDVGRAKRVDGDIYRYIEFAKRTLPRNISLNGLRVV 180

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           VDCANGA YKVAP   WELGA+V+ I ++PNGININ DCGST+ + L +KVHEVRAD+GI
Sbjct: 181 VDCANGAGYKVAPAALWELGAEVITINNEPNGININEDCGSTHPIGLMKKVHEVRADVGI 240

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           ALDGD DRV++VDE G +++GDQ+MA+IA  W + + L G GIV TVMSN+GLERF+A  
Sbjct: 241 ALDGDADRVLLVDENGTVIDGDQLMAVIAESWAASNRLEGGGIVATVMSNLGLERFLADR 300

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
            L+L RT+VGDRY++E+M+ +GFNVGGEQSGHI+LSD+ +TGDGL++ALQ+L   ++ +K
Sbjct: 301 NLTLARTKVGDRYVVEHMREHGFNVGGEQSGHIVLSDFATTGDGLISALQILAVAQEQNK 360

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
           P+S +C  F+  PQ L++V       L +  +  AI +A+  L G  RL++R SGTE LI
Sbjct: 361 PISDVCRKFQPVPQLLKNVRTTGGKPLENKRVKSAIDEAKERLGGQGRLVIRPSGTEPLI 420

Query: 421 RIMAEGDDLSRIKRIVDDLAKVI 443
           R+MAEGDD   ++++V+D+  VI
Sbjct: 421 RVMAEGDDRGLVEKVVNDIIDVI 443


>gi|189024782|ref|YP_001935550.1| phosphoglucosamine mutase [Brucella abortus S19]
 gi|254689859|ref|ZP_05153113.1| Phosphoglucosamine mutase [Brucella abortus bv. 6 str. 870]
 gi|254730894|ref|ZP_05189472.1| Phosphoglucosamine mutase [Brucella abortus bv. 4 str. 292]
 gi|256258113|ref|ZP_05463649.1| Phosphoglucosamine mutase [Brucella abortus bv. 9 str. C68]
 gi|297248961|ref|ZP_06932669.1| phosphoglucosamine mutase [Brucella abortus bv. 5 str. B3196]
 gi|189020354|gb|ACD73076.1| Phosphoglucosamine mutase [Brucella abortus S19]
 gi|297174094|gb|EFH33451.1| phosphoglucosamine mutase [Brucella abortus bv. 5 str. B3196]
          Length = 459

 Score =  583 bits (1504), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 268/443 (60%), Positives = 351/443 (79%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M R+FFGTDGIRG++N+FP+TP   M++G+AVGY+FR K +  R V+GKDTR SGYMLE 
Sbjct: 9   MTRKFFGTDGIRGQANSFPMTPEIAMKVGMAVGYIFRRKGQASRAVVGKDTRRSGYMLEK 68

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +LVAGFTAAGMD F+LGPIP+PAVAML RSLRAD+GVMISASHNP+ DNGIKLFGPDG+K
Sbjct: 69  ALVAGFTAAGMDVFLLGPIPTPAVAMLCRSLRADIGVMISASHNPFYDNGIKLFGPDGFK 128

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +S  IE +IE ++E D+T +L+ +  +G AKRVDG   RYIE  KRTLPR+++L GLR+V
Sbjct: 129 LSDQIELQIEAMIEGDMTPFLASHGDVGRAKRVDGDIYRYIEFAKRTLPRNISLNGLRVV 188

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           VDCANGA YKVAP   WELGA+V+ I ++PNGININ DCGST+ + L +KVHEVRAD+GI
Sbjct: 189 VDCANGAGYKVAPAALWELGAEVITINNEPNGININEDCGSTHPIGLMKKVHEVRADVGI 248

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           ALDGD DRV++VDE G +++GDQ+MA+IA  W + + L G GIV TVMSN+GLERF+A  
Sbjct: 249 ALDGDADRVLLVDENGTVIDGDQLMAVIAESWAASNRLEGGGIVATVMSNLGLERFLADR 308

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
            L+L RT+VGDRY++E+M+ +GFNVGGEQSGHI+LSD+ +TGDGL++ALQ+L   ++ +K
Sbjct: 309 NLTLARTKVGDRYVVEHMREHGFNVGGEQSGHIVLSDFATTGDGLISALQILAVAQEQNK 368

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
           P+S +C  F+  PQ L++V       L +  +  AI +A+  L G  RL++R SGTE LI
Sbjct: 369 PISDVCRKFQPVPQLLKNVRTTGGKPLENKRVKSAIDEAKERLGGQGRLVIRPSGTEPLI 428

Query: 421 RIMAEGDDLSRIKRIVDDLAKVI 443
           R+MAEGDD   ++++V+D+  VI
Sbjct: 429 RVMAEGDDRGLVEKVVNDIIDVI 451


>gi|225853146|ref|YP_002733379.1| phosphoglucosamine mutase [Brucella melitensis ATCC 23457]
 gi|256045301|ref|ZP_05448195.1| phosphoglucosamine mutase [Brucella melitensis bv. 1 str. Rev.1]
 gi|256114259|ref|ZP_05455004.1| phosphoglucosamine mutase [Brucella melitensis bv. 3 str. Ether]
 gi|225641511|gb|ACO01425.1| phosphoglucosamine mutase [Brucella melitensis ATCC 23457]
          Length = 459

 Score =  583 bits (1504), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 269/443 (60%), Positives = 351/443 (79%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M R+FFGTDGIRG++N+FP+TP   M++G+AVGY+FR K +  R VIGKDTR SGYMLEN
Sbjct: 9   MTRKFFGTDGIRGQANSFPMTPEIAMKVGMAVGYIFRRKGQASRAVIGKDTRRSGYMLEN 68

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +LVAGFTAAGMD F+LGPIP+PAVAML RSLRAD+GVMISASHNP+ DNGIKLFGPDG+K
Sbjct: 69  ALVAGFTAAGMDVFLLGPIPTPAVAMLCRSLRADIGVMISASHNPFYDNGIKLFGPDGFK 128

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +S  IE +IE ++E D+T +L+ +  +G AKRVDG   RYIE  KRTLPR+++L GLR+V
Sbjct: 129 LSDQIELQIEAMIEGDMTPFLASHGDVGRAKRVDGDIYRYIEFAKRTLPRNISLNGLRVV 188

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           VDCANGA YKVAP   WELGA+V+ I ++PNGININ DCGST+ + L +KVH VRAD+GI
Sbjct: 189 VDCANGAGYKVAPAALWELGAEVITINNEPNGININEDCGSTHPIGLMKKVHGVRADVGI 248

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           ALDGD DRV++VDE G +++GDQ+MA+IA  W + + L G GIV TVMSN+GLERF+A  
Sbjct: 249 ALDGDADRVLLVDENGTVIDGDQLMAVIAESWAASNRLEGGGIVATVMSNLGLERFLADR 308

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
            L+L RT+VGDRY++E+M+ +GFNVGGEQSGHI+LSD+ +TGDGL++ALQ+L   ++ +K
Sbjct: 309 NLTLARTKVGDRYVVEHMREHGFNVGGEQSGHIVLSDFATTGDGLISALQILAVAQEQNK 368

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
           P+S +C  F+  PQ L++V       L +  +  AI +A+  L G  RL++R SGTE LI
Sbjct: 369 PISDVCRKFQPVPQLLKNVRTTGGKPLENKRVKSAIDEAKERLGGQGRLVIRPSGTEPLI 428

Query: 421 RIMAEGDDLSRIKRIVDDLAKVI 443
           R+MAEGDD   ++++V+D+  VI
Sbjct: 429 RVMAEGDDRGLVEKVVNDIIDVI 451


>gi|265991726|ref|ZP_06104283.1| phosphoglucosamine mutase [Brucella melitensis bv. 1 str. Rev.1]
 gi|265995563|ref|ZP_06108120.1| phosphoglucosamine mutase [Brucella melitensis bv. 3 str. Ether]
 gi|265999344|ref|ZP_05465894.2| phosphoglucosamine mutase [Brucella melitensis bv. 2 str. 63/9]
 gi|84029238|sp|Q8YIU8|GLMM_BRUME RecName: Full=Phosphoglucosamine mutase
 gi|262766847|gb|EEZ12465.1| phosphoglucosamine mutase [Brucella melitensis bv. 3 str. Ether]
 gi|263002682|gb|EEZ15085.1| phosphoglucosamine mutase [Brucella melitensis bv. 1 str. Rev.1]
 gi|263093361|gb|EEZ17430.1| phosphoglucosamine mutase [Brucella melitensis bv. 2 str. 63/9]
 gi|326539411|gb|ADZ87626.1| phosphoglucosamine mutase [Brucella melitensis M5-90]
          Length = 451

 Score =  583 bits (1503), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 269/443 (60%), Positives = 351/443 (79%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M R+FFGTDGIRG++N+FP+TP   M++G+AVGY+FR K +  R VIGKDTR SGYMLEN
Sbjct: 1   MTRKFFGTDGIRGQANSFPMTPEIAMKVGMAVGYIFRRKGQASRAVIGKDTRRSGYMLEN 60

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +LVAGFTAAGMD F+LGPIP+PAVAML RSLRAD+GVMISASHNP+ DNGIKLFGPDG+K
Sbjct: 61  ALVAGFTAAGMDVFLLGPIPTPAVAMLCRSLRADIGVMISASHNPFYDNGIKLFGPDGFK 120

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +S  IE +IE ++E D+T +L+ +  +G AKRVDG   RYIE  KRTLPR+++L GLR+V
Sbjct: 121 LSDQIELQIEAMIEGDMTPFLASHGDVGRAKRVDGDIYRYIEFAKRTLPRNISLNGLRVV 180

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           VDCANGA YKVAP   WELGA+V+ I ++PNGININ DCGST+ + L +KVH VRAD+GI
Sbjct: 181 VDCANGAGYKVAPAALWELGAEVITINNEPNGININEDCGSTHPIGLMKKVHGVRADVGI 240

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           ALDGD DRV++VDE G +++GDQ+MA+IA  W + + L G GIV TVMSN+GLERF+A  
Sbjct: 241 ALDGDADRVLLVDENGTVIDGDQLMAVIAESWAASNRLEGGGIVATVMSNLGLERFLADR 300

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
            L+L RT+VGDRY++E+M+ +GFNVGGEQSGHI+LSD+ +TGDGL++ALQ+L   ++ +K
Sbjct: 301 NLTLARTKVGDRYVVEHMREHGFNVGGEQSGHIVLSDFATTGDGLISALQILAVAQEQNK 360

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
           P+S +C  F+  PQ L++V       L +  +  AI +A+  L G  RL++R SGTE LI
Sbjct: 361 PISDVCRKFQPVPQLLKNVRTTGGKPLENKRVKSAIDEAKERLGGQGRLVIRPSGTEPLI 420

Query: 421 RIMAEGDDLSRIKRIVDDLAKVI 443
           R+MAEGDD   ++++V+D+  VI
Sbjct: 421 RVMAEGDDRGLVEKVVNDIIDVI 443


>gi|62290562|ref|YP_222355.1| phosphoglucosamine mutase [Brucella abortus bv. 1 str. 9-941]
 gi|82700478|ref|YP_415052.1| phosphoglucosamine mutase [Brucella melitensis biovar Abortus 2308]
 gi|260547193|ref|ZP_05822931.1| phosphoglucosamine mutase [Brucella abortus NCTC 8038]
 gi|260755390|ref|ZP_05867738.1| phosphoglucosamine mutase [Brucella abortus bv. 6 str. 870]
 gi|260758611|ref|ZP_05870959.1| phosphoglucosamine mutase [Brucella abortus bv. 4 str. 292]
 gi|260884406|ref|ZP_05896020.1| phosphoglucosamine mutase [Brucella abortus bv. 9 str. C68]
 gi|75496350|sp|Q57BJ0|GLMM_BRUAB RecName: Full=Phosphoglucosamine mutase
 gi|123547190|sp|Q2YQH8|GLMM_BRUA2 RecName: Full=Phosphoglucosamine mutase
 gi|62196694|gb|AAX74994.1| GlmM, phosphoglucosamine mutase [Brucella abortus bv. 1 str. 9-941]
 gi|82616579|emb|CAJ11658.1| Phosphoglucomutase/phosphomannomutase:Phosphoglucomutase/phosphoman
           nomutase C
           terminal:Phosphoglucomutase/phosphomannomutase [Brucella
           melitensis biovar Abortus 2308]
 gi|260095558|gb|EEW79436.1| phosphoglucosamine mutase [Brucella abortus NCTC 8038]
 gi|260668929|gb|EEX55869.1| phosphoglucosamine mutase [Brucella abortus bv. 4 str. 292]
 gi|260675498|gb|EEX62319.1| phosphoglucosamine mutase [Brucella abortus bv. 6 str. 870]
 gi|260873934|gb|EEX81003.1| phosphoglucosamine mutase [Brucella abortus bv. 9 str. C68]
          Length = 451

 Score =  583 bits (1503), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 268/443 (60%), Positives = 351/443 (79%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M R+FFGTDGIRG++N+FP+TP   M++G+AVGY+FR K +  R V+GKDTR SGYMLE 
Sbjct: 1   MTRKFFGTDGIRGQANSFPMTPEIAMKVGMAVGYIFRRKGQASRAVVGKDTRRSGYMLEK 60

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +LVAGFTAAGMD F+LGPIP+PAVAML RSLRAD+GVMISASHNP+ DNGIKLFGPDG+K
Sbjct: 61  ALVAGFTAAGMDVFLLGPIPTPAVAMLCRSLRADIGVMISASHNPFYDNGIKLFGPDGFK 120

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +S  IE +IE ++E D+T +L+ +  +G AKRVDG   RYIE  KRTLPR+++L GLR+V
Sbjct: 121 LSDQIELQIEAMIEGDMTPFLASHGDVGRAKRVDGDIYRYIEFAKRTLPRNISLNGLRVV 180

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           VDCANGA YKVAP   WELGA+V+ I ++PNGININ DCGST+ + L +KVHEVRAD+GI
Sbjct: 181 VDCANGAGYKVAPAALWELGAEVITINNEPNGININEDCGSTHPIGLMKKVHEVRADVGI 240

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           ALDGD DRV++VDE G +++GDQ+MA+IA  W + + L G GIV TVMSN+GLERF+A  
Sbjct: 241 ALDGDADRVLLVDENGTVIDGDQLMAVIAESWAASNRLEGGGIVATVMSNLGLERFLADR 300

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
            L+L RT+VGDRY++E+M+ +GFNVGGEQSGHI+LSD+ +TGDGL++ALQ+L   ++ +K
Sbjct: 301 NLTLARTKVGDRYVVEHMREHGFNVGGEQSGHIVLSDFATTGDGLISALQILAVAQEQNK 360

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
           P+S +C  F+  PQ L++V       L +  +  AI +A+  L G  RL++R SGTE LI
Sbjct: 361 PISDVCRKFQPVPQLLKNVRTTGGKPLENKRVKSAIDEAKERLGGQGRLVIRPSGTEPLI 420

Query: 421 RIMAEGDDLSRIKRIVDDLAKVI 443
           R+MAEGDD   ++++V+D+  VI
Sbjct: 421 RVMAEGDDRGLVEKVVNDIIDVI 443


>gi|17986627|ref|NP_539261.1| phosphoglucosamine mutase [Brucella melitensis bv. 1 str. 16M]
 gi|17982241|gb|AAL51525.1| phosphoglucosamine mutase / phosphoacetylglucosamine mutase /
           phosphomannomutase [Brucella melitensis bv. 1 str. 16M]
          Length = 475

 Score =  583 bits (1502), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 269/443 (60%), Positives = 351/443 (79%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M R+FFGTDGIRG++N+FP+TP   M++G+AVGY+FR K +  R VIGKDTR SGYMLEN
Sbjct: 25  MTRKFFGTDGIRGQANSFPMTPEIAMKVGMAVGYIFRRKGQASRAVIGKDTRRSGYMLEN 84

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +LVAGFTAAGMD F+LGPIP+PAVAML RSLRAD+GVMISASHNP+ DNGIKLFGPDG+K
Sbjct: 85  ALVAGFTAAGMDVFLLGPIPTPAVAMLCRSLRADIGVMISASHNPFYDNGIKLFGPDGFK 144

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +S  IE +IE ++E D+T +L+ +  +G AKRVDG   RYIE  KRTLPR+++L GLR+V
Sbjct: 145 LSDQIELQIEAMIEGDMTPFLASHGDVGRAKRVDGDIYRYIEFAKRTLPRNISLNGLRVV 204

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           VDCANGA YKVAP   WELGA+V+ I ++PNGININ DCGST+ + L +KVH VRAD+GI
Sbjct: 205 VDCANGAGYKVAPAALWELGAEVITINNEPNGININEDCGSTHPIGLMKKVHGVRADVGI 264

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           ALDGD DRV++VDE G +++GDQ+MA+IA  W + + L G GIV TVMSN+GLERF+A  
Sbjct: 265 ALDGDADRVLLVDENGTVIDGDQLMAVIAESWAASNRLEGGGIVATVMSNLGLERFLADR 324

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
            L+L RT+VGDRY++E+M+ +GFNVGGEQSGHI+LSD+ +TGDGL++ALQ+L   ++ +K
Sbjct: 325 NLTLARTKVGDRYVVEHMREHGFNVGGEQSGHIVLSDFATTGDGLISALQILAVAQEQNK 384

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
           P+S +C  F+  PQ L++V       L +  +  AI +A+  L G  RL++R SGTE LI
Sbjct: 385 PISDVCRKFQPVPQLLKNVRTTGGKPLENKRVKSAIDEAKERLGGQGRLVIRPSGTEPLI 444

Query: 421 RIMAEGDDLSRIKRIVDDLAKVI 443
           R+MAEGDD   ++++V+D+  VI
Sbjct: 445 RVMAEGDDRGLVEKVVNDIIDVI 467


>gi|319406241|emb|CBI79878.1| phosphoglucomutase/phosphomannomutasefamily protein MrsA
           [Bartonella sp. AR 15-3]
          Length = 453

 Score =  583 bits (1502), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 278/443 (62%), Positives = 349/443 (78%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M R++FGTDGIRGK+N FP+TP+F M+IG+AVG LFR K++  RVVIGKDTRLSGYMLEN
Sbjct: 1   MVRKYFGTDGIRGKANLFPMTPDFAMKIGMAVGVLFRTKEQSHRVVIGKDTRLSGYMLEN 60

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +LV+G TAAGMDAF+LGP+P+PAVAML RSLRAD+GVMISASHNP+ DNGIKLFGPDG+K
Sbjct: 61  ALVSGLTAAGMDAFLLGPVPTPAVAMLCRSLRADLGVMISASHNPFYDNGIKLFGPDGFK 120

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +S +IE +IE L+E DL   L+    IG AKRV+G   RYIE+ KRTLPRDV L  LRIV
Sbjct: 121 LSDEIEIKIEQLVETDLLHSLAESSEIGRAKRVEGDIYRYIEYAKRTLPRDVRLDSLRIV 180

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           VDCANGA+YK AP   WELGA+V  I ++P G NIN  CGST++ SL+RKVHEVRAD+GI
Sbjct: 181 VDCANGATYKAAPRALWELGAEVFAINNEPTGFNINQKCGSTDLTSLKRKVHEVRADVGI 240

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           ALDGDGDRVI+V+EK   V+GDQI+A+IA  W     L+ NG+VTT+MSN+GLERF+   
Sbjct: 241 ALDGDGDRVIMVNEKAQTVDGDQIIAVIAEHWYETQRLQNNGVVTTIMSNLGLERFLNSK 300

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           GL L RT VGDRY+++ M   G+NVGGE SGHI+LSD+G+TGDGLVAALQ+L  ++Q   
Sbjct: 301 GLDLIRTNVGDRYVVDAMCQKGYNVGGESSGHIVLSDFGTTGDGLVAALQILACMQQKQY 360

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
           P+S +C CFE  PQ L+++++K+ +IL  S +  AI  A+  L    RL+VR+SGTE LI
Sbjct: 361 PMSHLCQCFESVPQILKNIAIKNKNILQKSKVKTAIDRAQKRLGKDARLVVRSSGTEPLI 420

Query: 421 RIMAEGDDLSRIKRIVDDLAKVI 443
           RIMAEGD+   I+ IV +++ V+
Sbjct: 421 RIMAEGDNQEVIEEIVAEISDVL 443


>gi|237816068|ref|ZP_04595064.1| phosphoglucosamine mutase [Brucella abortus str. 2308 A]
 gi|237788731|gb|EEP62943.1| phosphoglucosamine mutase [Brucella abortus str. 2308 A]
          Length = 475

 Score =  583 bits (1502), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 268/443 (60%), Positives = 351/443 (79%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M R+FFGTDGIRG++N+FP+TP   M++G+AVGY+FR K +  R V+GKDTR SGYMLE 
Sbjct: 25  MTRKFFGTDGIRGQANSFPMTPEIAMKVGMAVGYIFRRKGQASRAVVGKDTRRSGYMLEK 84

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +LVAGFTAAGMD F+LGPIP+PAVAML RSLRAD+GVMISASHNP+ DNGIKLFGPDG+K
Sbjct: 85  ALVAGFTAAGMDVFLLGPIPTPAVAMLCRSLRADIGVMISASHNPFYDNGIKLFGPDGFK 144

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +S  IE +IE ++E D+T +L+ +  +G AKRVDG   RYIE  KRTLPR+++L GLR+V
Sbjct: 145 LSDQIELQIEAMIEGDMTPFLASHGDVGRAKRVDGDIYRYIEFAKRTLPRNISLNGLRVV 204

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           VDCANGA YKVAP   WELGA+V+ I ++PNGININ DCGST+ + L +KVHEVRAD+GI
Sbjct: 205 VDCANGAGYKVAPAALWELGAEVITINNEPNGININEDCGSTHPIGLMKKVHEVRADVGI 264

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           ALDGD DRV++VDE G +++GDQ+MA+IA  W + + L G GIV TVMSN+GLERF+A  
Sbjct: 265 ALDGDADRVLLVDENGTVIDGDQLMAVIAESWAASNRLEGGGIVATVMSNLGLERFLADR 324

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
            L+L RT+VGDRY++E+M+ +GFNVGGEQSGHI+LSD+ +TGDGL++ALQ+L   ++ +K
Sbjct: 325 NLTLARTKVGDRYVVEHMREHGFNVGGEQSGHIVLSDFATTGDGLISALQILAVAQEQNK 384

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
           P+S +C  F+  PQ L++V       L +  +  AI +A+  L G  RL++R SGTE LI
Sbjct: 385 PISDVCRKFQPVPQLLKNVRTTGGKPLENKRVKSAIDEAKERLGGQGRLVIRPSGTEPLI 444

Query: 421 RIMAEGDDLSRIKRIVDDLAKVI 443
           R+MAEGDD   ++++V+D+  VI
Sbjct: 445 RVMAEGDDRGLVEKVVNDIIDVI 467


>gi|256160406|ref|ZP_05458095.1| phosphoglucosamine mutase [Brucella ceti M490/95/1]
 gi|256255612|ref|ZP_05461148.1| phosphoglucosamine mutase [Brucella ceti B1/94]
 gi|261222815|ref|ZP_05937096.1| phosphoglucosamine mutase [Brucella ceti B1/94]
 gi|260921399|gb|EEX88052.1| phosphoglucosamine mutase [Brucella ceti B1/94]
          Length = 463

 Score =  582 bits (1501), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 271/447 (60%), Positives = 353/447 (78%), Gaps = 4/447 (0%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M R+FFGTDGIRG++N+FP+TP   M++G+AVGY+FR K +  RVVIGKDTR SGYMLEN
Sbjct: 9   MTRKFFGTDGIRGQANSFPMTPEIAMKVGMAVGYIFRRKGQASRVVIGKDTRRSGYMLEN 68

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +LVAGFTAAGMD F+LGPIP+PAVAML RSLRAD+GVMISASHNP+ DNGIKLFGPDG+K
Sbjct: 69  ALVAGFTAAGMDVFLLGPIPTPAVAMLCRSLRADIGVMISASHNPFYDNGIKLFGPDGFK 128

Query: 121 VS----TDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQG 176
           +S      IE +IE ++E D+T +L+ +  +G AKRVDG   RYIE  KRTLPR+++L G
Sbjct: 129 LSDQIELQIELQIEAMIEGDMTPFLASHGDVGRAKRVDGDIYRYIEFAKRTLPRNISLNG 188

Query: 177 LRIVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRA 236
           LR+VVDCANGA YKVAP   WELGA+V+ I ++PNGININ DCGST+ + L +KVHEVRA
Sbjct: 189 LRVVVDCANGAVYKVAPAALWELGAEVITINNEPNGININEDCGSTHPIGLMKKVHEVRA 248

Query: 237 DIGIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERF 296
           D+GIALDGD DRV++VDE G +++GDQ+MA+IA  W + + L G GIV TVMSN+GLERF
Sbjct: 249 DVGIALDGDADRVLLVDENGTVIDGDQLMAVIAESWAASNRLEGGGIVATVMSNLGLERF 308

Query: 297 IAGLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIK 356
           +A   L+L RT+VGDRY++E+M+ +GFNVGGEQSGHI+LSD+ +TGDGL++ALQ+L   +
Sbjct: 309 LADRNLTLARTKVGDRYVVEHMREHGFNVGGEQSGHIVLSDFATTGDGLISALQILAVAQ 368

Query: 357 QYDKPVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGT 416
           + +KP+S +C  F+  PQ L++V       L +  +  AI +A+  L G  RL++R SGT
Sbjct: 369 EQNKPISDVCRKFQPVPQLLKNVRTTGGKPLENKRVKSAIDEAKERLGGQGRLVIRPSGT 428

Query: 417 ESLIRIMAEGDDLSRIKRIVDDLAKVI 443
           E LIR+MAEGDD   ++++V+D+  VI
Sbjct: 429 EPLIRVMAEGDDRGLVEKVVNDIIDVI 455


>gi|240851212|ref|YP_002972615.1| phosphoglucomutase/phosphomannomutase family protein MrsA
           [Bartonella grahamii as4aup]
 gi|240268335|gb|ACS51923.1| phosphoglucomutase/phosphomannomutase family protein MrsA
           [Bartonella grahamii as4aup]
          Length = 457

 Score =  581 bits (1498), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 275/443 (62%), Positives = 350/443 (79%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M +++FGTDGIRGK+N+FP+TP+F M++G+AVG LFR + + RRVVIGKDTRLSGYMLEN
Sbjct: 1   MVQKYFGTDGIRGKANSFPMTPDFAMKVGMAVGVLFRSQHQSRRVVIGKDTRLSGYMLEN 60

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +LV+G TAAGM+AF+LGP+P+PAVAML RSLRAD+GVMISASHNP+ DNGIKLFGPDG+K
Sbjct: 61  ALVSGLTAAGMEAFLLGPVPTPAVAMLCRSLRADLGVMISASHNPFYDNGIKLFGPDGFK 120

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +S D+E +IE L++ DL+  L+    IG+AKRV+G   RYIE+ KRTLPRDV L  LRIV
Sbjct: 121 LSDDMEAKIEQLIDTDLSKSLASSAEIGYAKRVEGDIYRYIEYAKRTLPRDVRLDALRIV 180

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           VDCANGA+YK AP   WELGA+V  I D+PNG NIN  CGST++ SL+RKVHEVRAD+GI
Sbjct: 181 VDCANGAAYKAAPRALWELGAEVFAIHDEPNGTNINQKCGSTDLSSLKRKVHEVRADVGI 240

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           ALDGDGDRV+IVDEK   V+GDQ++A+IA  W     LR NG+VTT+MSN+GLERF+   
Sbjct: 241 ALDGDGDRVLIVDEKAQTVDGDQLIAVIAENWHKMGRLRCNGVVTTIMSNLGLERFLNSK 300

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           GL L RT VGDRY+++ M+  G+NVGGE SGHI+LSD+G+TGDGLVAALQ+L  +K+   
Sbjct: 301 GLHLVRTNVGDRYVVDAMRQKGYNVGGEASGHIVLSDFGTTGDGLVAALQILACMKESQS 360

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
           P+S +C  FE  PQ L++V++K+ ++L  + +  AI  AE  L    RL++RASGTE LI
Sbjct: 361 PMSQLCKRFEPVPQILKNVTIKNKNVLKKNPVKAAIDQAEKRLGKEARLVIRASGTEPLI 420

Query: 421 RIMAEGDDLSRIKRIVDDLAKVI 443
           R+MAEGD    +  +V +L  VI
Sbjct: 421 RLMAEGDAREVLDTVVTELMDVI 443


>gi|265998774|ref|ZP_06111331.1| phosphoglucosamine mutase [Brucella ceti M490/95/1]
 gi|262553463|gb|EEZ09232.1| phosphoglucosamine mutase [Brucella ceti M490/95/1]
          Length = 455

 Score =  581 bits (1498), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 271/447 (60%), Positives = 353/447 (78%), Gaps = 4/447 (0%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M R+FFGTDGIRG++N+FP+TP   M++G+AVGY+FR K +  RVVIGKDTR SGYMLEN
Sbjct: 1   MTRKFFGTDGIRGQANSFPMTPEIAMKVGMAVGYIFRRKGQASRVVIGKDTRRSGYMLEN 60

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +LVAGFTAAGMD F+LGPIP+PAVAML RSLRAD+GVMISASHNP+ DNGIKLFGPDG+K
Sbjct: 61  ALVAGFTAAGMDVFLLGPIPTPAVAMLCRSLRADIGVMISASHNPFYDNGIKLFGPDGFK 120

Query: 121 VS----TDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQG 176
           +S      IE +IE ++E D+T +L+ +  +G AKRVDG   RYIE  KRTLPR+++L G
Sbjct: 121 LSDQIELQIELQIEAMIEGDMTPFLASHGDVGRAKRVDGDIYRYIEFAKRTLPRNISLNG 180

Query: 177 LRIVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRA 236
           LR+VVDCANGA YKVAP   WELGA+V+ I ++PNGININ DCGST+ + L +KVHEVRA
Sbjct: 181 LRVVVDCANGAVYKVAPAALWELGAEVITINNEPNGININEDCGSTHPIGLMKKVHEVRA 240

Query: 237 DIGIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERF 296
           D+GIALDGD DRV++VDE G +++GDQ+MA+IA  W + + L G GIV TVMSN+GLERF
Sbjct: 241 DVGIALDGDADRVLLVDENGTVIDGDQLMAVIAESWAASNRLEGGGIVATVMSNLGLERF 300

Query: 297 IAGLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIK 356
           +A   L+L RT+VGDRY++E+M+ +GFNVGGEQSGHI+LSD+ +TGDGL++ALQ+L   +
Sbjct: 301 LADRNLTLARTKVGDRYVVEHMREHGFNVGGEQSGHIVLSDFATTGDGLISALQILAVAQ 360

Query: 357 QYDKPVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGT 416
           + +KP+S +C  F+  PQ L++V       L +  +  AI +A+  L G  RL++R SGT
Sbjct: 361 EQNKPISDVCRKFQPVPQLLKNVRTTGGKPLENKRVKSAIDEAKERLGGQGRLVIRPSGT 420

Query: 417 ESLIRIMAEGDDLSRIKRIVDDLAKVI 443
           E LIR+MAEGDD   ++++V+D+  VI
Sbjct: 421 EPLIRVMAEGDDRGLVEKVVNDIIDVI 447


>gi|163869121|ref|YP_001610360.1| phosphoglucosamine mutase [Bartonella tribocorum CIP 105476]
 gi|189040776|sp|A9IYI0|GLMM_BART1 RecName: Full=Phosphoglucosamine mutase
 gi|161018807|emb|CAK02365.1| phosphoglucomutase/phosphomannomutasefamily protein MrsA
           [Bartonella tribocorum CIP 105476]
          Length = 453

 Score =  580 bits (1496), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 275/448 (61%), Positives = 352/448 (78%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M +++FGTDGIRGK+N+FP+TP+F M++G+AVG LFR + + RRVVIGKDTRLSGYMLEN
Sbjct: 1   MVQKYFGTDGIRGKANSFPMTPDFAMKVGMAVGVLFRSQHQSRRVVIGKDTRLSGYMLEN 60

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +LV+G TAAGMD F+LGP+P+PAVAML RSLRAD+GVMISASHNP+ DNGIKLFGPDG+K
Sbjct: 61  ALVSGLTAAGMDVFLLGPVPTPAVAMLCRSLRADLGVMISASHNPFYDNGIKLFGPDGFK 120

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +S D+E +IE L++ DL+  L+    IG AKRV+G   RYIE+ KRTLPRDV L  +RIV
Sbjct: 121 LSDDMEAKIEQLIDTDLSKSLASSAEIGSAKRVEGDIYRYIEYAKRTLPRDVRLDAVRIV 180

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           VDCANGA+YK AP   WELGA+V  I D+PNG NIN  CGST++ SL+RKVHEVRAD+GI
Sbjct: 181 VDCANGAAYKAAPRALWELGAEVFAIHDEPNGTNINQKCGSTDLSSLKRKVHEVRADVGI 240

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           ALDGDGDRV+IVDEK   V+GDQ++A+IA  W     LR NG+VTT+MSN+GLERF+ G 
Sbjct: 241 ALDGDGDRVLIVDEKAQTVDGDQLIAVIAENWHKMGRLRCNGVVTTIMSNLGLERFLNGK 300

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           GL L RT+VGDRY+++ M+  G+NVGGE SGHI+LSD+G+TGDGLVAALQ+L  +K+   
Sbjct: 301 GLDLIRTKVGDRYVVDAMRQKGYNVGGEASGHIVLSDFGTTGDGLVAALQILACMKESQN 360

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
           P+S +C  FE  PQ L++V++K+ ++L  + +  AI  AE  L    RL++RASGTE +I
Sbjct: 361 PMSQLCQRFEPVPQILKNVTIKNKNVLKKNPVKTAIDQAEKRLGKEARLVIRASGTEPVI 420

Query: 421 RIMAEGDDLSRIKRIVDDLAKVIPMIDS 448
           R+MAEGD    +  +V +L  VI   D+
Sbjct: 421 RLMAEGDAREVLDTVVTELMDVITHHDT 448


>gi|260467073|ref|ZP_05813253.1| phosphoglucosamine mutase [Mesorhizobium opportunistum WSM2075]
 gi|259029182|gb|EEW30478.1| phosphoglucosamine mutase [Mesorhizobium opportunistum WSM2075]
          Length = 450

 Score =  580 bits (1494), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 280/444 (63%), Positives = 346/444 (77%), Gaps = 2/444 (0%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLF-RGKKKHRRVVIGKDTRLSGYMLE 59
           M   +FGTDGIRG++N FP+T    MR+G+A G  F RG  +HR VV+GKDTRLSGYM+E
Sbjct: 1   MAENYFGTDGIRGRANKFPMTAEIAMRVGMAAGLSFQRGNHRHR-VVLGKDTRLSGYMIE 59

Query: 60  NSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGY 119
           N++VAG  AAGMD F+LGPIP+PAVAML RSLRAD+GVMISASHNPY DNGIKLFGPDGY
Sbjct: 60  NAMVAGLCAAGMDVFLLGPIPTPAVAMLVRSLRADIGVMISASHNPYYDNGIKLFGPDGY 119

Query: 120 KVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRI 179
           K+S +IE+RIE++L+ D+   L+  D +G AKRVDGVHDRYIE  KRTLPR ++L GLRI
Sbjct: 120 KLSDEIEERIESMLDKDIELALADSDGLGRAKRVDGVHDRYIEFAKRTLPRSMSLSGLRI 179

Query: 180 VVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIG 239
           VVDCANGA+YKVAPE  WELGA+VV I  +PNG NIN +CGST+ + LQ+KVHEVRADIG
Sbjct: 180 VVDCANGAAYKVAPEALWELGAEVVAINVEPNGFNINKECGSTHPVGLQKKVHEVRADIG 239

Query: 240 IALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAG 299
           IALDGD DRV+IVDE GAIV+GDQIMALIA  W     L G G+V+TVMSN+GLERF+  
Sbjct: 240 IALDGDADRVVIVDENGAIVDGDQIMALIAESWHQSGRLAGGGVVSTVMSNLGLERFLGD 299

Query: 300 LGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYD 359
           + L L RT+VGDRY++E+M+ +G NVGGEQSGHI+LSD+ +TGDGLV+ALQVL  IK+  
Sbjct: 300 MKLQLHRTKVGDRYVVEHMRAHGLNVGGEQSGHIVLSDFSTTGDGLVSALQVLACIKRQG 359

Query: 360 KPVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESL 419
           +PVS +   FE  PQ L++V +     L  + +  AI DA   L    RL++R SGTE L
Sbjct: 360 RPVSELSKKFEPVPQLLKNVRIAGGKPLEEAPVKAAIEDARHRLGKAGRLVIRPSGTEPL 419

Query: 420 IRIMAEGDDLSRIKRIVDDLAKVI 443
           IR+MAEGDD   ++ +V+D+ +VI
Sbjct: 420 IRVMAEGDDPQLVEAVVNDIVEVI 443


>gi|153008555|ref|YP_001369770.1| phosphoglucosamine mutase [Ochrobactrum anthropi ATCC 49188]
 gi|151560443|gb|ABS13941.1| phosphoglucosamine mutase [Ochrobactrum anthropi ATCC 49188]
          Length = 459

 Score =  580 bits (1494), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 272/443 (61%), Positives = 349/443 (78%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M R++FGTDGIRG++N+FP+TP   M++G+AVG++FR K +  RVVIGKDTR SGYMLEN
Sbjct: 9   MTRKYFGTDGIRGQANSFPMTPEVAMKVGMAVGHIFRRKGQTSRVVIGKDTRRSGYMLEN 68

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +LVAGFTAAGMD F+LGPIP+PAVAML RSLRAD+GVMISASHNP+ DNGIKLFGPDG+K
Sbjct: 69  ALVAGFTAAGMDVFLLGPIPTPAVAMLCRSLRADIGVMISASHNPFYDNGIKLFGPDGFK 128

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +S +IE +IE +++ DLT YL+ +  +G AKRVDG   RYIE  KRTLPR++ L GLRIV
Sbjct: 129 LSDEIELKIEAMIDGDLTPYLASHGDVGRAKRVDGDIYRYIEFAKRTLPRNIDLNGLRIV 188

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           VDCANGA YKVAP   WELGA+V+ I ++PNGININ DCGST+ + L +KVHEVRAD+GI
Sbjct: 189 VDCANGAGYKVAPAALWELGAEVITINNEPNGININEDCGSTHPIGLMKKVHEVRADVGI 248

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           ALDGD DRV++VDE G +++GDQ+MA+IA  W +   L G GIV TVMSN+GLERF+A  
Sbjct: 249 ALDGDADRVLLVDENGTVIDGDQLMAVIAESWAASDRLEGGGIVATVMSNLGLERFLADR 308

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
            L+L RT+VGDRY++E+M+ +GFNVGGEQSGHI+LSDY +TGDGL++ALQ+L   ++  K
Sbjct: 309 HLTLARTKVGDRYVVEHMREHGFNVGGEQSGHIVLSDYATTGDGLISALQILAVAQEQGK 368

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
           P+S IC  F+  PQ L++V       L +  +  AI +A   L    RL++R SGTE LI
Sbjct: 369 PISEICRKFDPVPQLLKNVRTSGGKPLENKRVKSAIDEATERLGVQGRLVIRPSGTEPLI 428

Query: 421 RIMAEGDDLSRIKRIVDDLAKVI 443
           R+MAEGDD   ++++V+D+  VI
Sbjct: 429 RVMAEGDDRGLVEKVVNDIIDVI 451


>gi|172044121|sp|A6WY87|GLMM_OCHA4 RecName: Full=Phosphoglucosamine mutase
          Length = 451

 Score =  579 bits (1493), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 272/443 (61%), Positives = 349/443 (78%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M R++FGTDGIRG++N+FP+TP   M++G+AVG++FR K +  RVVIGKDTR SGYMLEN
Sbjct: 1   MTRKYFGTDGIRGQANSFPMTPEVAMKVGMAVGHIFRRKGQTSRVVIGKDTRRSGYMLEN 60

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +LVAGFTAAGMD F+LGPIP+PAVAML RSLRAD+GVMISASHNP+ DNGIKLFGPDG+K
Sbjct: 61  ALVAGFTAAGMDVFLLGPIPTPAVAMLCRSLRADIGVMISASHNPFYDNGIKLFGPDGFK 120

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +S +IE +IE +++ DLT YL+ +  +G AKRVDG   RYIE  KRTLPR++ L GLRIV
Sbjct: 121 LSDEIELKIEAMIDGDLTPYLASHGDVGRAKRVDGDIYRYIEFAKRTLPRNIDLNGLRIV 180

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           VDCANGA YKVAP   WELGA+V+ I ++PNGININ DCGST+ + L +KVHEVRAD+GI
Sbjct: 181 VDCANGAGYKVAPAALWELGAEVITINNEPNGININEDCGSTHPIGLMKKVHEVRADVGI 240

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           ALDGD DRV++VDE G +++GDQ+MA+IA  W +   L G GIV TVMSN+GLERF+A  
Sbjct: 241 ALDGDADRVLLVDENGTVIDGDQLMAVIAESWAASDRLEGGGIVATVMSNLGLERFLADR 300

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
            L+L RT+VGDRY++E+M+ +GFNVGGEQSGHI+LSDY +TGDGL++ALQ+L   ++  K
Sbjct: 301 HLTLARTKVGDRYVVEHMREHGFNVGGEQSGHIVLSDYATTGDGLISALQILAVAQEQGK 360

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
           P+S IC  F+  PQ L++V       L +  +  AI +A   L    RL++R SGTE LI
Sbjct: 361 PISEICRKFDPVPQLLKNVRTSGGKPLENKRVKSAIDEATERLGVQGRLVIRPSGTEPLI 420

Query: 421 RIMAEGDDLSRIKRIVDDLAKVI 443
           R+MAEGDD   ++++V+D+  VI
Sbjct: 421 RVMAEGDDRGLVEKVVNDIIDVI 443


>gi|13473323|ref|NP_104890.1| phosphoglucosamine mutase [Mesorhizobium loti MAFF303099]
 gi|81779257|sp|Q98F91|GLMM_RHILO RecName: Full=Phosphoglucosamine mutase
 gi|14024072|dbj|BAB50676.1| phosphoglucomutase/phosphomannomutase family protein; MrsA
           [Mesorhizobium loti MAFF303099]
          Length = 450

 Score =  578 bits (1490), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 279/444 (62%), Positives = 346/444 (77%), Gaps = 2/444 (0%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLF-RGKKKHRRVVIGKDTRLSGYMLE 59
           M   +FGTDGIRG++N FP+T    MR+G+A G  F RG  +HR VV+GKDTRLSGYM+E
Sbjct: 1   MAGNYFGTDGIRGRANKFPMTAEIAMRVGMAAGLSFQRGSHRHR-VVLGKDTRLSGYMIE 59

Query: 60  NSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGY 119
           N++VAG  AAGMD F+LGPIP+PAVAML RSLRAD+GVMISASHNPY DNGIKLFGPDGY
Sbjct: 60  NAMVAGLCAAGMDVFLLGPIPTPAVAMLVRSLRADIGVMISASHNPYYDNGIKLFGPDGY 119

Query: 120 KVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRI 179
           K+S +IE+RIE++L+ D+   L+  D +G AKRVDGVHDRYIE  KRTLPR ++L GLRI
Sbjct: 120 KLSDEIEERIESMLDKDVELTLADSDGLGRAKRVDGVHDRYIEFAKRTLPRSMSLSGLRI 179

Query: 180 VVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIG 239
           VVDCANGA+YKVAPE  WELGA+VV I  +PNG NIN +CGST+   LQ+KVHEVRADIG
Sbjct: 180 VVDCANGAAYKVAPEALWELGAEVVAINIEPNGFNINKECGSTHPAGLQKKVHEVRADIG 239

Query: 240 IALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAG 299
           IALDGD DRV+IVDE GAIV+GDQIMA+IA  W     L G G+V+TVMSN+GLERF+  
Sbjct: 240 IALDGDADRVVIVDENGAIVDGDQIMAMIAESWHQSGRLAGGGVVSTVMSNLGLERFLGD 299

Query: 300 LGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYD 359
           + L L RT+VGDRY++E+M+ +G NVGGEQSGHI+LSD+ +TGDGLV+ALQVL  IK+  
Sbjct: 300 MKLQLHRTKVGDRYVVEHMRAHGLNVGGEQSGHIVLSDFSTTGDGLVSALQVLACIKRQG 359

Query: 360 KPVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESL 419
           +PVS +   FE  PQ L++V +     L  + +  AI DA + L    RL++R SGTE L
Sbjct: 360 RPVSELSKKFEPVPQLLKNVRIAGGKPLEEAPVKAAIEDARNRLGKAGRLVIRPSGTEPL 419

Query: 420 IRIMAEGDDLSRIKRIVDDLAKVI 443
           IR+MAEGDD   ++ +V+D+ +VI
Sbjct: 420 IRVMAEGDDPQLVEAVVNDIVEVI 443


>gi|49474665|ref|YP_032707.1| phosphoglucomutase /phosphomannomutasefamily protein mrsA
           [Bartonella quintana str. Toulouse]
 gi|81646808|sp|Q6FYQ7|GLMM_BARQU RecName: Full=Phosphoglucosamine mutase
 gi|49240169|emb|CAF26633.1| Phosphoglucomutase /phosphomannomutasefamily protein mrsA
           [Bartonella quintana str. Toulouse]
          Length = 459

 Score =  577 bits (1486), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 270/448 (60%), Positives = 351/448 (78%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M +++FGTDGIRGK+N FP+TP+F M++G+AVG LFR +++ RRVVIGKDTRLSGYMLEN
Sbjct: 1   MAQKYFGTDGIRGKANVFPMTPDFAMKVGMAVGVLFRSQRQSRRVVIGKDTRLSGYMLEN 60

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +LV+GFTAAGM+AF+LGP+P+PAVAML RSLRAD+GVMISASHNP+ DNGIKLFGPDG+K
Sbjct: 61  ALVSGFTAAGMEAFLLGPVPTPAVAMLCRSLRADLGVMISASHNPFYDNGIKLFGPDGFK 120

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +S +IE +IE L++ DL+  L+    IG+AKRV+G   RYIE+ KRTLPRDV L  LRIV
Sbjct: 121 LSDEIEKKIEQLIDTDLSKSLASCAEIGYAKRVEGDIYRYIEYAKRTLPRDVRLDALRIV 180

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           VDCANGA+YK AP   WELGA+V  I D PNG NIN  CGST++ SL++KVHEVRAD+GI
Sbjct: 181 VDCANGAAYKAAPRALWELGAEVFAINDAPNGTNINQKCGSTDLASLKQKVHEVRADVGI 240

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           ALDGDGDRV+IVDEK   V+GDQ++A+IA  W     L+GNG+VTT+MSN+GLERF+   
Sbjct: 241 ALDGDGDRVLIVDEKAQTVDGDQLIAVIAEHWHKTGRLQGNGVVTTIMSNLGLERFLNRK 300

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           GL L RT VGDRY+++ M+  G+N+GGE SGHI+LSD+G+TGDGLVAALQ+L  +++   
Sbjct: 301 GLELVRTNVGDRYVVDAMRQKGYNIGGEASGHIVLSDFGTTGDGLVAALQILACMQESQS 360

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
            +S +C  FE  PQ L++V++K+ ++L  + +  AI  A   L    RL++RASGTE +I
Sbjct: 361 SMSHLCKRFEPVPQILKNVTIKNKNVLKKNQVKTAIDQATQRLGNEARLVIRASGTEPVI 420

Query: 421 RIMAEGDDLSRIKRIVDDLAKVIPMIDS 448
           RIM EGD+   +  +V ++  VI   D+
Sbjct: 421 RIMGEGDEREVLDAVVAEMVDVIAHHDA 448


>gi|319407715|emb|CBI81363.1| phosphoglucomutase/phosphomannomutasefamily protein MrsA
           [Bartonella sp. 1-1C]
          Length = 451

 Score =  577 bits (1486), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 272/448 (60%), Positives = 349/448 (77%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M R++FGTDGIRGK+N FP+TP+F M+IG+AVG LFR K++  RVVIGKDTRLSGYMLEN
Sbjct: 1   MARKYFGTDGIRGKANLFPMTPDFAMKIGMAVGVLFRTKEQSHRVVIGKDTRLSGYMLEN 60

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +LV+G TAAGMD F+LGP+P+PAVAML RSLRAD+GVMISASHNP+ DNGIKLFGPDG+K
Sbjct: 61  ALVSGLTAAGMDVFLLGPVPTPAVAMLCRSLRADLGVMISASHNPFYDNGIKLFGPDGFK 120

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +S +IE +IE L+E DL   L+    IG AKRV+G   RYIE+ KRTLPRDV L  LRIV
Sbjct: 121 LSDEIEIKIEQLVEKDLLHSLAEASEIGRAKRVEGDIYRYIEYAKRTLPRDVRLDSLRIV 180

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           VDCANGA+YK AP   WELGA+V  I ++P G+NIN  CGST++ SL+RKVHEVRAD+GI
Sbjct: 181 VDCANGATYKAAPRALWELGAEVFAINNEPTGLNINQKCGSTDLTSLKRKVHEVRADVGI 240

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           ALDGDGDRVI+VDEK   ++GDQI+A+IA  W     L+ NG+V ++MSN+GLERF+   
Sbjct: 241 ALDGDGDRVIMVDEKAQTIDGDQIIAVIAEHWYKTERLQRNGVVASIMSNLGLERFLNNK 300

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           GL L RT VGDRY+++ M+  G+NVGGE SGHI+LSD+G+TGDGLVAALQ+L  +++   
Sbjct: 301 GLELIRTNVGDRYVVDAMRQKGYNVGGEASGHIVLSDFGTTGDGLVAALQILACMQESQV 360

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
           P+S +C  FE  PQ L+++++K+  IL ++ +  AI  A+  L    RL++R SGTE LI
Sbjct: 361 PMSQLCQRFESVPQILKNIAIKNKKILQNTKVKTAINQAQKRLGKEVRLVIRPSGTEPLI 420

Query: 421 RIMAEGDDLSRIKRIVDDLAKVIPMIDS 448
           R+MAEGDD   I+ +V +++ V+   DS
Sbjct: 421 RVMAEGDDQKVIEEVVAEISTVLVQHDS 448


>gi|319781034|ref|YP_004140510.1| phosphoglucosamine mutase [Mesorhizobium ciceri biovar biserrulae
           WSM1271]
 gi|317166922|gb|ADV10460.1| phosphoglucosamine mutase [Mesorhizobium ciceri biovar biserrulae
           WSM1271]
          Length = 450

 Score =  576 bits (1484), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 279/444 (62%), Positives = 344/444 (77%), Gaps = 2/444 (0%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLF-RGKKKHRRVVIGKDTRLSGYMLE 59
           M   +FGTDGIRG++N FP+T    MR+G+A G  F RG  +HR VV+GKDTRLSGYM+E
Sbjct: 1   MAGNYFGTDGIRGRANKFPMTAEIAMRVGMAAGLSFQRGSHRHR-VVLGKDTRLSGYMIE 59

Query: 60  NSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGY 119
           N++VAG  AAGMD F+LGPIP+PAVAML RSLRAD+GVMISASHNPY DNGIKLFGPDGY
Sbjct: 60  NAMVAGLCAAGMDVFLLGPIPTPAVAMLVRSLRADIGVMISASHNPYYDNGIKLFGPDGY 119

Query: 120 KVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRI 179
           K+S +IE+RIE++L+ D+   L+  D +G AKRVDGVHDRYIE  KRTLPR ++L GLRI
Sbjct: 120 KLSDEIEERIESMLDRDIELALADSDGLGRAKRVDGVHDRYIEFAKRTLPRSMSLAGLRI 179

Query: 180 VVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIG 239
           VVDCANGA+YKVAPE  WELGA+VV I  +PNG NIN +CGST+   LQ+KVHEVRADIG
Sbjct: 180 VVDCANGAAYKVAPEALWELGAEVVAINVEPNGFNINKECGSTHPAGLQKKVHEVRADIG 239

Query: 240 IALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAG 299
           IALDGD DRV+IVDE GAIV+GDQIMALIA  W     L G G+V+TVMSN+GLERF+  
Sbjct: 240 IALDGDADRVVIVDENGAIVDGDQIMALIAESWHQSGRLAGGGVVSTVMSNLGLERFLGD 299

Query: 300 LGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYD 359
           + L L RT+VGDRY++E+M+ +G NVGGEQSGHI+LSD+ +TGDGLV+ALQVL  IK+  
Sbjct: 300 MKLQLHRTKVGDRYVVEHMRAHGLNVGGEQSGHIVLSDFSTTGDGLVSALQVLACIKRQG 359

Query: 360 KPVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESL 419
           +PVS +   FE  PQ L++V +     L  + +  AI DA S L    RL++R SGTE L
Sbjct: 360 RPVSELSKKFEPVPQLLKNVHISGGKPLEEAPVKAAIEDARSRLGKTGRLVIRPSGTEPL 419

Query: 420 IRIMAEGDDLSRIKRIVDDLAKVI 443
           IR+MAEGDD   ++ +V+ +  +I
Sbjct: 420 IRVMAEGDDPQLVESVVNGIVDII 443


>gi|319899360|ref|YP_004159457.1| phosphoglucomutase/phosphomannomutasefamily protein MrsA
           [Bartonella clarridgeiae 73]
 gi|319403328|emb|CBI76887.1| phosphoglucomutase/phosphomannomutasefamily protein MrsA
           [Bartonella clarridgeiae 73]
          Length = 455

 Score =  575 bits (1483), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 275/448 (61%), Positives = 350/448 (78%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M R++FGTDGIRG++N FP+TP+F M+IG+AVG LFR K++  RVVIGKDTRLSGYMLEN
Sbjct: 1   MARKYFGTDGIRGRANFFPMTPDFAMKIGMAVGVLFRTKEQSHRVVIGKDTRLSGYMLEN 60

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +LV+G TAAGMDAF+LGP+P+PAVAML RSLRAD+GVMISASHNP+ DNGIKLFGPDG+K
Sbjct: 61  ALVSGLTAAGMDAFLLGPVPTPAVAMLCRSLRADLGVMISASHNPFYDNGIKLFGPDGFK 120

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +S +IE++IE L+E DL+  L+    IG AKRV+G   RYIE+ KRTLPRDV L  LRIV
Sbjct: 121 LSDEIENKIEQLIETDLSHSLAEPAEIGRAKRVEGDIYRYIEYAKRTLPRDVRLDSLRIV 180

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           VDCANGA+YK AP   WELGA+V  I ++P G+NIN  CGST++ SL+RKVHEVRAD+GI
Sbjct: 181 VDCANGATYKAAPRALWELGAEVFAINNEPMGLNINQKCGSTDLTSLKRKVHEVRADVGI 240

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           ALDGDGDRV++VDEK   ++GDQI+A+IA  W     LR  G+VTT+MSN+GLERF+   
Sbjct: 241 ALDGDGDRVLMVDEKAQTIDGDQIIAVIAEHWYKTERLRSKGVVTTIMSNLGLERFLNSK 300

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           GL L RT VGDRY+++ M+  G+NVGGE SGHI+LSD+G+TGDGLVAALQ+L  +++   
Sbjct: 301 GLDLIRTNVGDRYVVDAMRQKGYNVGGESSGHIVLSDFGTTGDGLVAALQILACMQENQY 360

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
            +S +C  FE  PQ L+++++KD +IL  S +  AI  A+  L    RL++R SGTE LI
Sbjct: 361 SMSYLCQRFEVVPQVLKNIAIKDKNILQKSKVKTAIDHAQKRLGKEGRLVIRPSGTEPLI 420

Query: 421 RIMAEGDDLSRIKRIVDDLAKVIPMIDS 448
           RIM EGDD   I+ IV +++ V+   DS
Sbjct: 421 RIMVEGDDQKVIEEIVAEISDVLVQHDS 448


>gi|319409311|emb|CBI82955.1| phosphoglucomutase/phosphomannomutasefamily protein MrsA
           [Bartonella schoenbuchensis R1]
          Length = 449

 Score =  575 bits (1482), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 272/443 (61%), Positives = 346/443 (78%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M +++FGTDGIRGK+N FP+TP+F M++G+AVG LFR + +  RVVIGKDTRLSGYMLEN
Sbjct: 1   MAQKYFGTDGIRGKANCFPMTPDFAMKVGMAVGVLFRSQGQPCRVVIGKDTRLSGYMLEN 60

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +LV+GFTAAGM+AF+LGP+P+PAVAML RSLRAD+GVMISASHNPY DNGIKLFGPDG+K
Sbjct: 61  ALVSGFTAAGMEAFLLGPVPTPAVAMLCRSLRADIGVMISASHNPYYDNGIKLFGPDGFK 120

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +S  IE +IE LLE DL+  L+    IG AKRV+G   RYIE+ KRTLPRDV L  LRIV
Sbjct: 121 LSDKIEAKIEQLLEKDLSHSLANCAEIGRAKRVEGDIYRYIEYAKRTLPRDVRLDSLRIV 180

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           VDCANGA+YK AP   WELGA+V+ I ++PNG NIN +CGST++ SL+ KVHEVRAD+GI
Sbjct: 181 VDCANGAAYKAAPLALWELGAEVIAINNEPNGFNINQECGSTDLTSLKEKVHEVRADVGI 240

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           ALDGDGDRV++VDEK   V+GDQ++A++A  W     L+ NG+VTT+M+N+GLERF+   
Sbjct: 241 ALDGDGDRVLMVDEKAQTVDGDQLIAVLAEHWHKTERLQRNGVVTTIMANLGLERFLNAK 300

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           GL L RT+VGDRY++E M+  G+NVGGE  GHI+LSD+G+TGDGLV ALQ+L  +K+   
Sbjct: 301 GLDLVRTKVGDRYVVEAMREKGYNVGGENCGHIVLSDFGTTGDGLVVALQILACMKESQL 360

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
            +S +C  FE  PQ L+++++KD ++LN S +  AI      L    RL++RASGTE LI
Sbjct: 361 SMSELCKRFEPVPQILKNITIKDKNVLNKSPVKAAIDQVTEGLGKETRLVIRASGTEPLI 420

Query: 421 RIMAEGDDLSRIKRIVDDLAKVI 443
           R+M EGDD   I+ I  D+A VI
Sbjct: 421 RVMVEGDDTKAIETIAADIADVI 443


>gi|319404752|emb|CBI78354.1| phosphoglucomutase/phosphomannomutasefamily protein MrsA
           [Bartonella rochalimae ATCC BAA-1498]
          Length = 451

 Score =  573 bits (1476), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 273/448 (60%), Positives = 347/448 (77%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M R++FGTDGIRGK+N FP+TP+F M+IG+AVG LFR K++  RVVIGKDTRLSGYMLEN
Sbjct: 1   MARKYFGTDGIRGKANLFPMTPDFAMKIGMAVGVLFRTKEQSHRVVIGKDTRLSGYMLEN 60

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +LV+G TAAGMDAF+LGP+P+PAVAML RSLRAD+GVMISASHNP+ DNGIKLFGPDG+K
Sbjct: 61  ALVSGLTAAGMDAFLLGPVPTPAVAMLCRSLRADLGVMISASHNPFYDNGIKLFGPDGFK 120

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +S +IE +IE L+E DL   L+    IG AKRV+G   RYIE+ KRTLPRDV L  LRIV
Sbjct: 121 LSDEIEIKIEQLVEKDLVHSLAEASEIGRAKRVEGDIYRYIEYAKRTLPRDVRLDSLRIV 180

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           VDCANGA+YK AP   WELGA+V  I ++P G+NIN  CGST++ SL+RKVHEVRAD+GI
Sbjct: 181 VDCANGATYKAAPRALWELGAEVFAINNEPTGLNINQKCGSTDLTSLKRKVHEVRADVGI 240

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           ALDGDGDRVI+VDEK   ++GDQI+A+IA  W     L+ NG+V ++MSN+GLERF+   
Sbjct: 241 ALDGDGDRVIMVDEKAQTIDGDQIIAVIAEHWYKTERLQRNGVVASIMSNLGLERFLNNK 300

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           GL L RT VGDRY+++ M+  G+NVGGE SGHI+LSD+G+TGDGLVAALQ+L  +++   
Sbjct: 301 GLELIRTNVGDRYVVDAMRQKGYNVGGESSGHIVLSDFGTTGDGLVAALQILACMQESQI 360

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
           P+S +C  FE  PQ L+++S+K+  IL +S +  AI   +  L    RL++R SGTE  I
Sbjct: 361 PMSQLCQRFETVPQILKNISIKNKKILQNSKVKTAIDQVQKRLGKEVRLVIRPSGTEPFI 420

Query: 421 RIMAEGDDLSRIKRIVDDLAKVIPMIDS 448
           R+MAEGDD   I+  V +++ V+   DS
Sbjct: 421 RVMAEGDDQKVIEDGVAEISTVLIQYDS 448


>gi|121602671|ref|YP_988509.1| phosphoglucosamine mutase [Bartonella bacilliformis KC583]
 gi|158513073|sp|A1URA6|GLMM_BARBK RecName: Full=Phosphoglucosamine mutase
 gi|120614848|gb|ABM45449.1| phosphoglucosamine mutase [Bartonella bacilliformis KC583]
          Length = 450

 Score =  573 bits (1476), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 278/448 (62%), Positives = 347/448 (77%), Gaps = 1/448 (0%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M R++FGTDGIRGK+N FP+TP+F M++GIAVG LFR K   RRVVIGKDTRLS YMLEN
Sbjct: 1   MARKYFGTDGIRGKANIFPMTPDFAMKVGIAVGVLFRSKATSRRVVIGKDTRLSCYMLEN 60

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +LVAGFTAAGMDAF+LGPIP+PAVAML RSLRAD+GVMISASHN + DNGIKLFGPDG+K
Sbjct: 61  ALVAGFTAAGMDAFLLGPIPTPAVAMLCRSLRADIGVMISASHNAFYDNGIKLFGPDGFK 120

Query: 121 VSTDIEDRIETLLEDDLTSY-LSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRI 179
           +S + E +IE LL+ D++   L+  + IG AKRV+G   RYIE+ KRTLPRDV L  LRI
Sbjct: 121 LSDEKETKIEALLDSDISELPLANCEEIGRAKRVEGDIYRYIEYAKRTLPRDVRLDALRI 180

Query: 180 VVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIG 239
           VVDCANGA+YK AP   WELGA+V+ I D+PNG NIN +CGST++ SL+ KVHEVRAD+G
Sbjct: 181 VVDCANGATYKAAPRALWELGAEVIAINDEPNGFNINQECGSTDLTSLRNKVHEVRADVG 240

Query: 240 IALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAG 299
           IALDGDGDRV++VDEKG +++GDQ++A+IA  W     L   GIVTTVMSN+GLERF++ 
Sbjct: 241 IALDGDGDRVLMVDEKGQMIDGDQLIAVIAEHWHKTGRLHHKGIVTTVMSNLGLERFLSE 300

Query: 300 LGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYD 359
            GL L RT+VGDRY+++ M+   +N+GGE SGHIILSD+ +TGDGLVAALQVL  +K+  
Sbjct: 301 KGLKLIRTDVGDRYVVDMMRQKKYNIGGESSGHIILSDFCTTGDGLVAALQVLACMKESQ 360

Query: 360 KPVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESL 419
           +P+S +C  FE  PQ L++  V + ++L  S +  A+  A   L    RL+VRASGTE +
Sbjct: 361 QPMSQLCKRFEPVPQILKNKVVHNKNVLQKSEVQAALTKASEHLGKEGRLLVRASGTEPV 420

Query: 420 IRIMAEGDDLSRIKRIVDDLAKVIPMID 447
           IR+MAEGDD   +  IVDDL  +I   D
Sbjct: 421 IRVMAEGDDRKAMTAIVDDLITLIARHD 448


>gi|49476133|ref|YP_034174.1| phosphoglucomutase /phosphomannomutasefamily protein mrsa
           [Bartonella henselae str. Houston-1]
 gi|81648447|sp|Q6G5P7|GLMM_BARHE RecName: Full=Phosphoglucosamine mutase
 gi|49238941|emb|CAF28237.1| Phosphoglucomutase /phosphomannomutasefamily protein mrsa
           [Bartonella henselae str. Houston-1]
          Length = 459

 Score =  572 bits (1475), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 267/448 (59%), Positives = 350/448 (78%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M +++FGTDGIRGK+N FP+TP+F M++G+AVG LFR + + RRVVIGKDTRLSGYMLEN
Sbjct: 1   MPQKYFGTDGIRGKANVFPMTPDFAMKVGMAVGILFRSQNQSRRVVIGKDTRLSGYMLEN 60

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +LV+GFTAAGM+AF+LGP+P+PAVAML RSLRAD+GVMISASHNP+ DNGIKLFGPDG+K
Sbjct: 61  ALVSGFTAAGMEAFLLGPVPTPAVAMLCRSLRADLGVMISASHNPFYDNGIKLFGPDGFK 120

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +S +IE++IE L++ DL+  L+    IG+AKRV+G   RYIE+ KRTLPRDV L  LRIV
Sbjct: 121 LSDEIEEKIEQLIDTDLSKSLASCAEIGYAKRVEGDIYRYIEYAKRTLPRDVRLDNLRIV 180

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           VDCANGA+YK AP   WELGA+V  I D PNG NIN  CGST++ SL++KVHEVRAD+GI
Sbjct: 181 VDCANGAAYKAAPRALWELGAEVFAINDTPNGTNINHKCGSTDLASLKQKVHEVRADVGI 240

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           ALDGDGDRV++VDEK   V+GDQ++A+IA  W  +  L+  G+VTT+MSN+GLERF+   
Sbjct: 241 ALDGDGDRVLLVDEKAQTVDGDQLIAVIAEHWHKNGRLQSKGVVTTIMSNLGLERFLNSK 300

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           GL L RT+VGDRY+++ M+  G+NVGGE SGHI+LSD+G+TGDGLVAALQ+L  +++   
Sbjct: 301 GLDLVRTKVGDRYVVDAMRKKGYNVGGEASGHIVLSDFGTTGDGLVAALQILACMQEIQI 360

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
           P+S +C  FE  PQ  ++V +K+ ++L  + +  AI  A   L    RL++RASGTE +I
Sbjct: 361 PMSHLCQRFEPVPQIFKNVMIKNKNVLKKNPVKTAIEQATQRLGKKARLVIRASGTEPVI 420

Query: 421 RIMAEGDDLSRIKRIVDDLAKVIPMIDS 448
           RIM EGD+   +  +V ++  +I   D+
Sbjct: 421 RIMGEGDEREMLDAVVTEMVDIITHHDT 448


>gi|328542549|ref|YP_004302658.1| phosphoglucosamine mutase [polymorphum gilvum SL003B-26A1]
 gi|326412295|gb|ADZ69358.1| Phosphoglucosamine mutase [Polymorphum gilvum SL003B-26A1]
          Length = 454

 Score =  569 bits (1467), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 268/441 (60%), Positives = 344/441 (78%)

Query: 3   RRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSL 62
           RR+FGTDGIRG +N  P+T    +++G+A G +FR      RVVIGKDTRLSGYMLEN+L
Sbjct: 9   RRYFGTDGIRGTANIHPMTAEVALKVGMAAGLMFRNGGYRNRVVIGKDTRLSGYMLENAL 68

Query: 63  VAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVS 122
           VAGFT+ G+D F+LGP+P+PAVAMLTRSLRAD+GVMISASHNP+ DNGIK FGPDGYK+S
Sbjct: 69  VAGFTSVGLDVFLLGPMPTPAVAMLTRSLRADLGVMISASHNPFGDNGIKFFGPDGYKLS 128

Query: 123 TDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVVD 182
            +IE +IE L++ DLTS LS    +G AKR+DG   RYIE  KRTLPR+++L+GLR+V+D
Sbjct: 129 DEIELQIEGLIDSDLTSRLSASTDLGRAKRIDGAQQRYIEFAKRTLPREMSLEGLRVVID 188

Query: 183 CANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIAL 242
           CANGA+YKVAPE  WELGA+VV +G  P+G NIN DCGST+  ++  KVHEVRADIGIAL
Sbjct: 189 CANGAAYKVAPEALWELGAEVVSLGVAPDGFNINRDCGSTSTEAVVAKVHEVRADIGIAL 248

Query: 243 DGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLGL 302
           DGD DRVII+DE+G  V+GDQ+MA++A  W S   L   GIV TVMSN+GLER++ GLGL
Sbjct: 249 DGDADRVIIIDEQGRTVDGDQLMAVVAESWQSSGRLSAPGIVATVMSNLGLERYLGGLGL 308

Query: 303 SLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKPV 362
           SL RT+VGDRY++E+M+  G+NVGGEQSGHI+LSD+ +TGDGL+AALQVL  +++ ++ V
Sbjct: 309 SLARTKVGDRYVVEHMRAEGYNVGGEQSGHIVLSDFATTGDGLIAALQVLACVREQNRSV 368

Query: 363 STICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLIRI 422
           S +C  FE  PQ L++V     + L +  +  AI D  S L    RL++RASGTE LIR+
Sbjct: 369 SEVCRKFEPVPQVLKNVRYAGGTPLETDRVRLAIDDGRSRLGKDGRLVIRASGTEPLIRV 428

Query: 423 MAEGDDLSRIKRIVDDLAKVI 443
           MAEGDD + + ++V+D+A V+
Sbjct: 429 MAEGDDAALVNQVVNDIADVV 449


>gi|307944551|ref|ZP_07659891.1| phosphoglucosamine mutase [Roseibium sp. TrichSKD4]
 gi|307772300|gb|EFO31521.1| phosphoglucosamine mutase [Roseibium sp. TrichSKD4]
          Length = 447

 Score =  568 bits (1464), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 264/441 (59%), Positives = 346/441 (78%)

Query: 3   RRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSL 62
           R++FGTDGIRG++N  P+T    +++G+A G  F+      RVVIGKDTRLSGY +EN+L
Sbjct: 2   RKYFGTDGIRGRANVPPMTAEAALKVGMAAGLTFKNGGHKHRVVIGKDTRLSGYTIENAL 61

Query: 63  VAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVS 122
           VAGFT+ GMD F+LGP+P+PAVAMLTRSLR+DVGVMISASHNP+QDNGIK FGPDG+K+S
Sbjct: 62  VAGFTSVGMDVFLLGPMPTPAVAMLTRSLRSDVGVMISASHNPFQDNGIKFFGPDGFKLS 121

Query: 123 TDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVVD 182
            ++E +IE L++ DL SYL     +G AKR+D    RY+E  KRTLPR ++L+GLR+VVD
Sbjct: 122 DEVEMQIEKLMDSDLNSYLPDASELGRAKRIDSAQHRYVEFAKRTLPRAMSLEGLRVVVD 181

Query: 183 CANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIAL 242
           CANGA+YKVAPE  WELGA+V+ +G +PNG NIN +CGST   +L RKV EVRADIGIAL
Sbjct: 182 CANGAAYKVAPEALWELGAEVISLGVEPNGTNINKECGSTYPEALSRKVQEVRADIGIAL 241

Query: 243 DGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLGL 302
           DGD DRVIIVDE GA+++GDQ+MA+IA+ W   + L GNGIV TVMSN+GLER++  LGL
Sbjct: 242 DGDADRVIIVDENGAVIDGDQLMAVIAQFWYKRNRLAGNGIVATVMSNLGLERYLESLGL 301

Query: 303 SLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKPV 362
            L RT+VGDRY++E+M+++GFN+GGEQSGHI+LSD+ +TGDGL+AALQVL  IK  D+PV
Sbjct: 302 GLARTKVGDRYVVEHMRSHGFNIGGEQSGHIVLSDFTTTGDGLIAALQVLACIKDQDRPV 361

Query: 363 STICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLIRI 422
           S +C  F+  PQ L++V       L   S+  AI++ E+ L    RL++RASGTE LIR+
Sbjct: 362 SEVCKRFDPVPQLLKNVRYSGGKPLELDSVKAAISEGEARLGKEGRLVIRASGTEPLIRV 421

Query: 423 MAEGDDLSRIKRIVDDLAKVI 443
           MAEGDD + ++ +V++++ V+
Sbjct: 422 MAEGDDAALVREVVNEISDVV 442


>gi|304393348|ref|ZP_07375276.1| phosphoglucosamine mutase [Ahrensia sp. R2A130]
 gi|303294355|gb|EFL88727.1| phosphoglucosamine mutase [Ahrensia sp. R2A130]
          Length = 450

 Score =  563 bits (1451), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 268/442 (60%), Positives = 340/442 (76%)

Query: 2   KRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENS 61
           KR++FGTDGIRG +N  P+T    M++G+A G  F+      RVV+GKDTRLSGYM+EN+
Sbjct: 4   KRKYFGTDGIRGYANRSPMTAETAMKVGMAAGVAFKQGNHRHRVVVGKDTRLSGYMIENA 63

Query: 62  LVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKV 121
           LVAGFTAAGMD F LGP+P+PAVAMLTRS+RAD+GVMISASHN Y DNGIKLFGPDG+K+
Sbjct: 64  LVAGFTAAGMDVFQLGPVPTPAVAMLTRSMRADIGVMISASHNAYHDNGIKLFGPDGFKL 123

Query: 122 STDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVV 181
           S +IE  IE L+++DLT  L+    IG A RVDGV DRYIE  KRTLPR+++L GLR+V+
Sbjct: 124 SDEIELEIERLIDEDLTPQLAGGPDIGRASRVDGVDDRYIEFAKRTLPRNLSLSGLRVVI 183

Query: 182 DCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIA 241
           DCANGA+YKVAP+V WELGA+VV IG  PNG NIN +CGST+  +L RKV+EVRADIGIA
Sbjct: 184 DCANGAAYKVAPKVLWELGAEVVEIGTSPNGTNINSECGSTSTGALVRKVNEVRADIGIA 243

Query: 242 LDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLG 301
           LDGD DRVIIVDEK  +V+GDQ+MAL+A  +    LL G GIV T+MSN+GLER +   G
Sbjct: 244 LDGDADRVIIVDEKSNVVDGDQLMALVAGSYRKKELLTGGGIVATIMSNLGLERCMQAQG 303

Query: 302 LSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKP 361
           L+L RT VGDRY++E+M+ +G+NVGGEQSGHI++SD+ +TGDGLVAALQVL  +++ DK 
Sbjct: 304 LNLARTAVGDRYVVEHMRKHGYNVGGEQSGHIVMSDHSTTGDGLVAALQVLAVVQESDKQ 363

Query: 362 VSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLIR 421
           VS +C+CF   PQ L++V   +   L   ++V +I D    L    RL++R SGTE LIR
Sbjct: 364 VSEVCNCFTPVPQVLKNVRYSEGEPLKDKAVVASIDDGRHRLANQGRLVIRKSGTEPLIR 423

Query: 422 IMAEGDDLSRIKRIVDDLAKVI 443
           +MAEGDD   ++ +VDD+   +
Sbjct: 424 VMAEGDDAGLVRNVVDDICDTL 445


>gi|114707943|ref|ZP_01440835.1| phosphoglucomutase/phosphomannomutase family protein MrsA
           [Fulvimarina pelagi HTCC2506]
 gi|114536572|gb|EAU39704.1| phosphoglucomutase/phosphomannomutase family protein MrsA
           [Fulvimarina pelagi HTCC2506]
          Length = 448

 Score =  559 bits (1440), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 269/444 (60%), Positives = 338/444 (76%), Gaps = 2/444 (0%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLF-RGKKKHRRVVIGKDTRLSGYMLE 59
           M RR+FGTDGIRGK+N FP+TP   +R+G+A G +F RG+ +HR VVIGKDTR S YMLE
Sbjct: 1   MARRYFGTDGIRGKANRFPMTPEVALRVGMAAGLVFHRGEHRHR-VVIGKDTRRSSYMLE 59

Query: 60  NSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGY 119
           N++VAGFTAAGMD F+LGP+P+PAVAMLTRSLRAD+GVMISASHNP++DNGIKLFGPDGY
Sbjct: 60  NAMVAGFTAAGMDVFLLGPMPTPAVAMLTRSLRADIGVMISASHNPFEDNGIKLFGPDGY 119

Query: 120 KVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRI 179
           K+S  IE +IE LLE+DLT+ +     +G A R+DGVHDRYIE  KRTLPR+++  GLRI
Sbjct: 120 KLSDQIETQIEALLEEDLTNRMPTGAGMGRATRIDGVHDRYIEFAKRTLPREISFDGLRI 179

Query: 180 VVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIG 239
            +DCANGA Y VAP+V WELG DVV IG  P+G NIN DCGST+  +L  KV+EVRADIG
Sbjct: 180 AIDCANGAGYDVAPKVLWELGGDVVEIGTSPDGTNINRDCGSTSPNALIAKVNEVRADIG 239

Query: 240 IALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAG 299
           IALDGD DRV++VDE+G IV+GDQ+MA+IA  W     L   GIV T+MSN+GLERF+  
Sbjct: 240 IALDGDADRVLVVDERGEIVDGDQLMAVIAESWNDDGRLAAGGIVATIMSNLGLERFLEA 299

Query: 300 LGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYD 359
             L L RT+VGDRY++E+M+ +G+NVGGEQSGHI+LSDYG+TGDGL++ALQVL  +KQ  
Sbjct: 300 QNLLLARTKVGDRYVVEHMREHGYNVGGEQSGHIVLSDYGTTGDGLISALQVLAVVKQRG 359

Query: 360 KPVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESL 419
             VS +C  F+  PQFL++V       L    +   I    + L    RL++R SGTE L
Sbjct: 360 GKVSDVCRRFQPVPQFLKNVRFGGGMPLEKDEVKTVIETGRNRLGNSGRLVIRPSGTEPL 419

Query: 420 IRIMAEGDDLSRIKRIVDDLAKVI 443
           IR+MAEGDD   ++ +VD++   +
Sbjct: 420 IRVMAEGDDPQMVEDVVDNICDAL 443


>gi|254473100|ref|ZP_05086498.1| phosphoglucosamine mutase [Pseudovibrio sp. JE062]
 gi|211957821|gb|EEA93023.1| phosphoglucosamine mutase [Pseudovibrio sp. JE062]
          Length = 449

 Score =  557 bits (1436), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 259/443 (58%), Positives = 337/443 (76%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M R++FGTDG+RG +N +P+T    +++G+A G +FR  K   RVVIGKDTRLSGYM EN
Sbjct: 1   MSRKYFGTDGMRGTANKWPMTAEVALKVGMAAGEVFRRGKYRHRVVIGKDTRLSGYMFEN 60

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +LVAGFTA GMD F+LGP+P+PAVAMLTRSLRAD+GVMISASHNP++DNGIK FGPDG+K
Sbjct: 61  ALVAGFTAMGMDVFVLGPMPTPAVAMLTRSLRADIGVMISASHNPFEDNGIKFFGPDGFK 120

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +S ++E +IE L++ D++  L   +++G A R+D + DRYIE  KRTLPRD+ L G+RIV
Sbjct: 121 LSDEVELQIERLIDSDMSRNLPAPETLGRATRIDSMKDRYIEFAKRTLPRDLNLNGMRIV 180

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           +DCANGA+YKVAPE+ WELGA+V  +G  P+G NIN DCGST   +L +KVHEVRADIGI
Sbjct: 181 IDCANGAAYKVAPEILWELGAEVFPLGVDPDGFNINKDCGSTAPEALAKKVHEVRADIGI 240

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           ALDGD DRVIIVDE   +V+GDQ+MA+IA  W +   L   GIV TVMSN+GLER++ G+
Sbjct: 241 ALDGDADRVIIVDENSKVVDGDQLMAVIAESWKAAGRLSAPGIVATVMSNLGLERYLKGI 300

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           GLSL+RT+VGDRY++E M+  GFNVGGEQSGHI++SD+G+TGDGLVAALQ+L  +K+ +K
Sbjct: 301 GLSLERTKVGDRYVVERMREGGFNVGGEQSGHIVMSDFGTTGDGLVAALQILACVKKMNK 360

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
           PVS +C+ F   PQ L++V       L   ++   I   E +L    RL++RASGTE LI
Sbjct: 361 PVSEVCNRFVPVPQILKNVRYGSGKPLEDKAVKAVIKAGEEKLGKQGRLVIRASGTEPLI 420

Query: 421 RIMAEGDDLSRIKRIVDDLAKVI 443
           R+M E DD   +  +VD +   +
Sbjct: 421 RVMGEADDAKLLNEVVDSIVDAV 443


>gi|90418981|ref|ZP_01226892.1| phosphoglucomutase/phosphomannomutase [Aurantimonas manganoxydans
           SI85-9A1]
 gi|90337061|gb|EAS50766.1| phosphoglucomutase/phosphomannomutase [Aurantimonas manganoxydans
           SI85-9A1]
          Length = 449

 Score =  552 bits (1422), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 265/440 (60%), Positives = 339/440 (77%), Gaps = 2/440 (0%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLF-RGKKKHRRVVIGKDTRLSGYMLE 59
           M RR+FGTDGIRG +N  P+T    MR+G+A G +F RG  +HR VVIGKDTR S YM+E
Sbjct: 2   MSRRYFGTDGIRGTANRHPMTAEVAMRVGMAAGLVFQRGSYRHR-VVIGKDTRRSSYMIE 60

Query: 60  NSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGY 119
           N++VAGFTAAG+D F+LGP+P+PAVAMLTRSLRAD+GVMISASHNP++DNGIKLFGPDGY
Sbjct: 61  NAMVAGFTAAGVDVFLLGPMPTPAVAMLTRSLRADIGVMISASHNPFEDNGIKLFGPDGY 120

Query: 120 KVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRI 179
           K+S ++E RIE LL++DLT  L+  D +G AKR+DGVHDRYIE  KRTLPR+++L+G+R+
Sbjct: 121 KLSDELELRIEALLDEDLTPRLATGDGLGRAKRIDGVHDRYIEAAKRTLPRELSLEGVRV 180

Query: 180 VVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIG 239
            +DCANGA+Y+VAP+V WELGA++V +G  P+G NIN +CGST   +L  KV EVRADIG
Sbjct: 181 AIDCANGAAYRVAPDVLWELGAEIVKLGVDPDGTNINRNCGSTAPAALIEKVKEVRADIG 240

Query: 240 IALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAG 299
           IALDGD DRV+IVDE+G +V+GDQ+MA+IA  W     L   GIV TVMSN+GLERF++ 
Sbjct: 241 IALDGDADRVLIVDERGEVVDGDQLMAVIAESWAEDGRLAAGGIVATVMSNLGLERFLSD 300

Query: 300 LGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYD 359
             L L RT VGDRY++E+M+ +G+NVGGEQSGHI+LSD+G+TGDGLVAALQVL  +++  
Sbjct: 301 HDLQLARTAVGDRYVVEHMRQHGYNVGGEQSGHIVLSDFGTTGDGLVAALQVLAVVQRKG 360

Query: 360 KPVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESL 419
             VS +C  FE  PQ L++      + L    +  AI+     L    RL++RASGTE L
Sbjct: 361 GTVSEVCRRFEPVPQILKNFRYSGGAPLERQRVQDAISAGRDRLGEGGRLVIRASGTEPL 420

Query: 420 IRIMAEGDDLSRIKRIVDDL 439
           IR+MAEGDD   +  +VDD+
Sbjct: 421 IRVMAEGDDRGLVNAVVDDI 440


>gi|220924417|ref|YP_002499719.1| phosphoglucosamine mutase [Methylobacterium nodulans ORS 2060]
 gi|254798585|sp|B8ID24|GLMM_METNO RecName: Full=Phosphoglucosamine mutase
 gi|219949024|gb|ACL59416.1| phosphoglucosamine mutase [Methylobacterium nodulans ORS 2060]
          Length = 446

 Score =  550 bits (1417), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 262/427 (61%), Positives = 333/427 (77%), Gaps = 3/427 (0%)

Query: 3   RRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLF-RGKKKHRRVVIGKDTRLSGYMLENS 61
           R++FGTDGIRG++N   ITP   +++G A G LF RG+ +HR VVIGKDTRLSGYM+E +
Sbjct: 2   RKYFGTDGIRGRANGV-ITPELALKVGQAAGLLFQRGEYRHR-VVIGKDTRLSGYMIETA 59

Query: 62  LVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKV 121
           LVAGFT+ GMD  +LGP+P+PAVAMLTRS+RAD+GVMISASHNPY+DNGIKLFGPDG+K+
Sbjct: 60  LVAGFTSVGMDVLLLGPMPTPAVAMLTRSMRADLGVMISASHNPYEDNGIKLFGPDGFKL 119

Query: 122 STDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVV 181
           S ++E  IE L++ DL   LS    +G AKR++ VH RYIE  KRTLPR++TL GLR+VV
Sbjct: 120 SDEVEHEIERLIDSDLQKRLSASADLGRAKRIESVHARYIEFAKRTLPRNITLDGLRVVV 179

Query: 182 DCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIA 241
           DCANGA+Y+VAPE  WELGA+V+ IG +P+G NIN D GST   +L RKV E+RADIGIA
Sbjct: 180 DCANGAAYRVAPETLWELGAEVIAIGTEPDGFNINRDVGSTAPDALVRKVRELRADIGIA 239

Query: 242 LDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLG 301
           LDGD DRV++VDEKG  V+GDQ+MA++AR W     L   GIV T+MSN+GLER++ GLG
Sbjct: 240 LDGDADRVLVVDEKGQRVDGDQLMAVVARSWKEDERLTQPGIVATIMSNLGLERYLGGLG 299

Query: 302 LSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKP 361
           LSL RT VGDRY++E+M+ +G+N+GGEQSGHII+SDY +TGDGLVAALQ+L  +++  +P
Sbjct: 300 LSLVRTAVGDRYVLEHMREHGYNLGGEQSGHIIMSDYATTGDGLVAALQLLTVVQRQKRP 359

Query: 362 VSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLIR 421
           VS +CHCF+  PQ L++V       L   S+V AI  A   L    RL++R SGTE +IR
Sbjct: 360 VSEVCHCFDPLPQVLKNVRYGAGEPLRKDSVVTAIEGARQRLGNAGRLVIRPSGTEPVIR 419

Query: 422 IMAEGDD 428
           +MAEGDD
Sbjct: 420 VMAEGDD 426


>gi|209886276|ref|YP_002290133.1| phosphoglucosamine mutase [Oligotropha carboxidovorans OM5]
 gi|226723902|sp|B6JIL2|GLMM_OLICO RecName: Full=Phosphoglucosamine mutase
 gi|209874472|gb|ACI94268.1| phosphoglucosamine mutase [Oligotropha carboxidovorans OM5]
          Length = 448

 Score =  549 bits (1414), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 258/438 (58%), Positives = 343/438 (78%), Gaps = 3/438 (0%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLF-RGKKKHRRVVIGKDTRLSGYMLE 59
           M R++FGTDGIRG++N   ITP   +++G A G +F RG+ +HR VVIGKDTRLSGYM+E
Sbjct: 1   MARKYFGTDGIRGRANGV-ITPELALKVGQAAGLVFQRGEYRHR-VVIGKDTRLSGYMIE 58

Query: 60  NSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGY 119
            ++VAGFT+ GMD  +LGPIP+PAVAMLT+S+RAD+GVMISASHNP+ DNGIKLFGP GY
Sbjct: 59  TAMVAGFTSVGMDVLLLGPIPTPAVAMLTKSMRADLGVMISASHNPFADNGIKLFGPSGY 118

Query: 120 KVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRI 179
           K+S ++E +IE L+++++   L+    +G A+R+DGVHDRYIE  KRTLPR+++L+GLR+
Sbjct: 119 KLSDEVELQIEELMDENIDRRLAQSTQLGRARRIDGVHDRYIEFAKRTLPRELSLEGLRV 178

Query: 180 VVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIG 239
           VVDCANGA+YKV PE  WELGADV+ IG +P+G+NIN +CGST+  +L  KV E+RADIG
Sbjct: 179 VVDCANGAAYKVVPEALWELGADVIAIGAEPDGMNINKECGSTSPDALAHKVREMRADIG 238

Query: 240 IALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAG 299
           IALDGD DRV+++DE+G +++GDQ++A+IA+ W     L   GIVTTVMSN+GLERF+AG
Sbjct: 239 IALDGDADRVLMIDERGHLIDGDQLLAVIAQSWKEDGRLAKPGIVTTVMSNLGLERFLAG 298

Query: 300 LGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYD 359
            GLS+ RT VGDRY++E M   G+N+GGE SGHII+SD+ +TGDG VAALQVL  +++  
Sbjct: 299 EGLSMVRTPVGDRYVLEQMMAQGYNLGGEPSGHIIMSDFTTTGDGFVAALQVLAVVQKLG 358

Query: 360 KPVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESL 419
           +PVS +CH FE  PQ L++V  +    L +  +   IADAE +L G  RL+VR+SGTE +
Sbjct: 359 RPVSEVCHRFEPLPQILKNVRYRSGKPLENPKVQSTIADAEKKLNGCGRLLVRSSGTEPV 418

Query: 420 IRIMAEGDDLSRIKRIVD 437
           IR+M EGDD  R++  VD
Sbjct: 419 IRVMGEGDDRDRVEEAVD 436


>gi|170741256|ref|YP_001769911.1| phosphoglucosamine mutase [Methylobacterium sp. 4-46]
 gi|205830888|sp|B0ULF6|GLMM_METS4 RecName: Full=Phosphoglucosamine mutase
 gi|168195530|gb|ACA17477.1| phosphoglucosamine mutase [Methylobacterium sp. 4-46]
          Length = 446

 Score =  548 bits (1412), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 261/427 (61%), Positives = 331/427 (77%), Gaps = 3/427 (0%)

Query: 3   RRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLF-RGKKKHRRVVIGKDTRLSGYMLENS 61
           R++FGTDGIRG++N   ITP   +++G A G LF RG  +HR VVIGKDTRLSGYM+E +
Sbjct: 2   RKYFGTDGIRGRANGV-ITPELALKVGQAAGLLFQRGDHRHR-VVIGKDTRLSGYMIETA 59

Query: 62  LVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKV 121
           LVAGFT+ GMD  +LGP+P+PAVAMLTRS+RAD+GVMISASHNPY+DNGIKLFGPDG+K+
Sbjct: 60  LVAGFTSVGMDVLLLGPMPTPAVAMLTRSMRADIGVMISASHNPYEDNGIKLFGPDGFKL 119

Query: 122 STDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVV 181
           S ++E  IE LL+ DL   LS    +G AKR++ VH RYIE  KRTLPR +TL+GLR+VV
Sbjct: 120 SDEVEHEIERLLDADLQKRLSGSADLGRAKRIESVHARYIEFAKRTLPRSITLEGLRVVV 179

Query: 182 DCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIA 241
           DCANGA+Y+VAPE  WELGA+V+ IG +P+G NIN D GST   +L RKV E+RADIGIA
Sbjct: 180 DCANGAAYRVAPETLWELGAEVIAIGTEPDGFNINRDVGSTAPDALVRKVRELRADIGIA 239

Query: 242 LDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLG 301
           LDGD DRV++VDEKG  V+GDQ+MA++AR W     L   GIV T+MSN+GLER++  LG
Sbjct: 240 LDGDADRVLVVDEKGQRVDGDQLMAVVARSWKEDQRLTQPGIVATIMSNLGLERYLGELG 299

Query: 302 LSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKP 361
           L L RT VGDRY++EYM+ +G+N+GGEQSGHII+SDY +TGDGLVAALQ+L  +++  +P
Sbjct: 300 LGLVRTAVGDRYVLEYMREHGYNLGGEQSGHIIMSDYATTGDGLVAALQLLTVVQRQQRP 359

Query: 362 VSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLIR 421
           VS +CHCF+  PQ L++V  +    L   S+V AI  A   L    RL++R SGTE +IR
Sbjct: 360 VSEVCHCFDPLPQVLKNVRYRAGEPLRQDSVVTAIEGARQRLGNAGRLVIRPSGTEPVIR 419

Query: 422 IMAEGDD 428
           +MAEGD+
Sbjct: 420 VMAEGDN 426


>gi|205830898|sp|A7IIG5|GLMM_XANP2 RecName: Full=Phosphoglucosamine mutase
          Length = 447

 Score =  547 bits (1409), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 267/447 (59%), Positives = 341/447 (76%), Gaps = 3/447 (0%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLF-RGKKKHRRVVIGKDTRLSGYMLE 59
           M RR+FGTDG+RG++N   +T +  +R+G+A G +F RG+ +HR VVIGKDTRLSGYM+E
Sbjct: 1   MSRRYFGTDGVRGRANA-TLTADLALRVGMAAGLIFQRGEYRHR-VVIGKDTRLSGYMIE 58

Query: 60  NSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGY 119
           N+LVAGFT+ GMD  +LGP+P+PAV MLTRS+RAD+GVMISASHNP+ DNGIKLFGPDG+
Sbjct: 59  NALVAGFTSVGMDVLLLGPVPTPAVGMLTRSMRADLGVMISASHNPFDDNGIKLFGPDGF 118

Query: 120 KVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRI 179
           K+S ++E  IE L+++D+   L+    IG AKR++GVH RYIE+ KRTLPRD T  G+R+
Sbjct: 119 KLSDEVEREIEELIDEDIAKRLAKPAEIGRAKRLEGVHARYIEYAKRTLPRDQTFDGIRV 178

Query: 180 VVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIG 239
           VVDCANGA YKVAPE  WELGADVV IG +P+G+NIN D GST+  +L  KV EVRADIG
Sbjct: 179 VVDCANGAGYKVAPEALWELGADVVSIGVEPDGMNINRDVGSTSPAALSAKVREVRADIG 238

Query: 240 IALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAG 299
           IALDGD DRVIIVDEKG +V+GDQ+MA++A  +     L  +G+V TVMSN+GLER +AG
Sbjct: 239 IALDGDADRVIIVDEKGHVVDGDQLMAVVAESFKEDGRLARSGLVATVMSNLGLERHLAG 298

Query: 300 LGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYD 359
            G+SL RT VGDRY++E M+ +G+NVGGEQSGHIILSDY +TGDGLVAALQVL  + +  
Sbjct: 299 EGISLARTAVGDRYVLERMRADGYNVGGEQSGHIILSDYSTTGDGLVAALQVLAVVARRG 358

Query: 360 KPVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESL 419
           KPVS +CH F+  PQ L++V       L    +   IADAE  L    RL++R SGTE +
Sbjct: 359 KPVSEVCHRFDPLPQILKNVRYASGRPLEDEKVKIVIADAERRLANHGRLLIRPSGTEPV 418

Query: 420 IRIMAEGDDLSRIKRIVDDLAKVIPMI 446
           IR+M EGDD   ++ +VDD+  V+  +
Sbjct: 419 IRVMGEGDDRDLVENVVDDVIDVLQKV 445


>gi|299134296|ref|ZP_07027489.1| phosphoglucosamine mutase [Afipia sp. 1NLS2]
 gi|298591043|gb|EFI51245.1| phosphoglucosamine mutase [Afipia sp. 1NLS2]
          Length = 448

 Score =  546 bits (1406), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 258/438 (58%), Positives = 342/438 (78%), Gaps = 3/438 (0%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLF-RGKKKHRRVVIGKDTRLSGYMLE 59
           M R++FGTDGIRG++N   ITP   +++G A G +F RG+ +HR VVIGKDTRLSGYM+E
Sbjct: 1   MVRKYFGTDGIRGRANGL-ITPELALKVGQAAGLVFQRGEYRHR-VVIGKDTRLSGYMIE 58

Query: 60  NSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGY 119
            ++VAGFT+ GMD  +LGPIP+PAVAMLT+S+RAD+GVMISASHN + DNGIKLFGP G+
Sbjct: 59  TAMVAGFTSVGMDVLLLGPIPTPAVAMLTKSMRADLGVMISASHNLFDDNGIKLFGPSGF 118

Query: 120 KVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRI 179
           K+S ++E +IE L+++++   L+    +G A+R+DGVHDRYIE  KRTLPRD++L+GLR+
Sbjct: 119 KLSDEVELQIEELMDENIDKRLAQSAHLGRARRIDGVHDRYIEFAKRTLPRDLSLEGLRV 178

Query: 180 VVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIG 239
           VVDCANGA+YKV PE  WELGADV+ IG +P+G NIN +CGST+  +L RKV E+RAD+G
Sbjct: 179 VVDCANGAAYKVVPEALWELGADVITIGAEPDGFNINKECGSTSPEALSRKVREMRADVG 238

Query: 240 IALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAG 299
           IALDGD DRV+++DE+G +V+GDQ++A+IA+ W     L   GIV TVMSN+GLERF+AG
Sbjct: 239 IALDGDADRVLVIDERGHLVDGDQLLAVIAQSWKEDGRLAKPGIVATVMSNLGLERFLAG 298

Query: 300 LGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYD 359
            GLS+ RT VGDRY++E M   G+N+GGE SGHII+SD+ +TGDG VAALQVL  +++  
Sbjct: 299 EGLSMVRTPVGDRYVLEQMLAQGYNLGGEPSGHIIMSDFTTTGDGFVAALQVLAVVQKLG 358

Query: 360 KPVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESL 419
           +PVS +CH FE  PQ L++V  +    L +  +  AIADAE +L G  RL+VR+SGTE +
Sbjct: 359 RPVSEVCHRFEALPQILKNVRYRTGKPLENPQVKSAIADAEKKLNGNGRLLVRSSGTEPV 418

Query: 420 IRIMAEGDDLSRIKRIVD 437
           IR+M EGDD  R++  VD
Sbjct: 419 IRVMGEGDDRDRVEEAVD 436


>gi|163854234|ref|YP_001642277.1| phosphoglucosamine mutase [Methylobacterium extorquens PA1]
 gi|218533180|ref|YP_002423996.1| phosphoglucosamine mutase [Methylobacterium chloromethanicum CM4]
 gi|240141695|ref|YP_002966175.1| phosphoglucosamine mutase [Methylobacterium extorquens AM1]
 gi|254564203|ref|YP_003071298.1| phosphoglucosamine mutase [Methylobacterium extorquens DM4]
 gi|226723578|sp|A9W9G7|GLMM_METEP RecName: Full=Phosphoglucosamine mutase
 gi|254798584|sp|B7KWJ1|GLMM_METC4 RecName: Full=Phosphoglucosamine mutase
 gi|163665839|gb|ABY33206.1| phosphoglucosamine mutase [Methylobacterium extorquens PA1]
 gi|218525483|gb|ACK86068.1| phosphoglucosamine mutase [Methylobacterium chloromethanicum CM4]
 gi|240011672|gb|ACS42898.1| phosphoglucosamine mutase [Methylobacterium extorquens AM1]
 gi|254271481|emb|CAX27496.1| phosphoglucosamine mutase [Methylobacterium extorquens DM4]
          Length = 446

 Score =  546 bits (1406), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 260/427 (60%), Positives = 334/427 (78%), Gaps = 3/427 (0%)

Query: 3   RRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLF-RGKKKHRRVVIGKDTRLSGYMLENS 61
           R+ FGTDGIRG++N   ITP   +++G A G +F RG  +HR VVIGKDTRLSGYM+E +
Sbjct: 2   RKHFGTDGIRGRANVV-ITPELALKVGQAAGVIFQRGDHRHR-VVIGKDTRLSGYMIETA 59

Query: 62  LVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKV 121
           LVAGFT+ GMD  +LGP+P+PAVAMLTRS+RAD+GVMISASHNPY+DNGIKLFGPDG+K+
Sbjct: 60  LVAGFTSVGMDVLLLGPMPTPAVAMLTRSMRADIGVMISASHNPYEDNGIKLFGPDGFKL 119

Query: 122 STDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVV 181
           + D+E  IE+L++ D+ + LS    +G AKR++ VH RYIE  KRTLPR VTL GLR+VV
Sbjct: 120 NDDLELEIESLIDGDMRNRLSASRDLGRAKRIESVHARYIEFAKRTLPRHVTLDGLRVVV 179

Query: 182 DCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIA 241
           DCANGA+Y+VAPE  WELGA+V+ IG +P+G NIN D GST   +L +KV E+RAD+GIA
Sbjct: 180 DCANGAAYRVAPETLWELGAEVISIGVEPDGFNINHDVGSTAPETLVQKVRELRADVGIA 239

Query: 242 LDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLG 301
           LDGD DRV+IVDEKG  V+GDQ+MA +AR W     L   G+V T+MSN+GLER+I  +G
Sbjct: 240 LDGDADRVLIVDEKGQKVDGDQLMAAVARSWQEDERLTQPGLVATIMSNLGLERYINSIG 299

Query: 302 LSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKP 361
           L+L RT VGDRY++E+M+ +G+N+GGEQSGHII+SDY +TGDGLVAALQ+L  +K+ + P
Sbjct: 300 LTLARTAVGDRYVLEHMRQHGYNLGGEQSGHIIMSDYATTGDGLVAALQLLSVVKRRNLP 359

Query: 362 VSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLIR 421
           VS +CHCFE  PQ L++V  +    L + S+V AIA A+  L    RL++R SGTE +IR
Sbjct: 360 VSEVCHCFEPLPQILKNVRFRSGEPLRADSVVTAIAHAKDRLGQSGRLVIRPSGTEPVIR 419

Query: 422 IMAEGDD 428
           +MAEGDD
Sbjct: 420 VMAEGDD 426


>gi|154246507|ref|YP_001417465.1| phosphoglucosamine mutase [Xanthobacter autotrophicus Py2]
 gi|154160592|gb|ABS67808.1| phosphoglucosamine mutase [Xanthobacter autotrophicus Py2]
          Length = 466

 Score =  545 bits (1405), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 267/447 (59%), Positives = 341/447 (76%), Gaps = 3/447 (0%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLF-RGKKKHRRVVIGKDTRLSGYMLE 59
           M RR+FGTDG+RG++N   +T +  +R+G+A G +F RG+ +HR VVIGKDTRLSGYM+E
Sbjct: 20  MSRRYFGTDGVRGRANA-TLTADLALRVGMAAGLIFQRGEYRHR-VVIGKDTRLSGYMIE 77

Query: 60  NSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGY 119
           N+LVAGFT+ GMD  +LGP+P+PAV MLTRS+RAD+GVMISASHNP+ DNGIKLFGPDG+
Sbjct: 78  NALVAGFTSVGMDVLLLGPVPTPAVGMLTRSMRADLGVMISASHNPFDDNGIKLFGPDGF 137

Query: 120 KVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRI 179
           K+S ++E  IE L+++D+   L+    IG AKR++GVH RYIE+ KRTLPRD T  G+R+
Sbjct: 138 KLSDEVEREIEELIDEDIAKRLAKPAEIGRAKRLEGVHARYIEYAKRTLPRDQTFDGIRV 197

Query: 180 VVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIG 239
           VVDCANGA YKVAPE  WELGADVV IG +P+G+NIN D GST+  +L  KV EVRADIG
Sbjct: 198 VVDCANGAGYKVAPEALWELGADVVSIGVEPDGMNINRDVGSTSPAALSAKVREVRADIG 257

Query: 240 IALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAG 299
           IALDGD DRVIIVDEKG +V+GDQ+MA++A  +     L  +G+V TVMSN+GLER +AG
Sbjct: 258 IALDGDADRVIIVDEKGHVVDGDQLMAVVAESFKEDGRLARSGLVATVMSNLGLERHLAG 317

Query: 300 LGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYD 359
            G+SL RT VGDRY++E M+ +G+NVGGEQSGHIILSDY +TGDGLVAALQVL  + +  
Sbjct: 318 EGISLARTAVGDRYVLERMRADGYNVGGEQSGHIILSDYSTTGDGLVAALQVLAVVARRG 377

Query: 360 KPVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESL 419
           KPVS +CH F+  PQ L++V       L    +   IADAE  L    RL++R SGTE +
Sbjct: 378 KPVSEVCHRFDPLPQILKNVRYASGRPLEDEKVKIVIADAERRLANHGRLLIRPSGTEPV 437

Query: 420 IRIMAEGDDLSRIKRIVDDLAKVIPMI 446
           IR+M EGDD   ++ +VDD+  V+  +
Sbjct: 438 IRVMGEGDDRDLVENVVDDVIDVLQKV 464


>gi|188584566|ref|YP_001928011.1| phosphoglucosamine mutase [Methylobacterium populi BJ001]
 gi|205830887|sp|B1ZBR8|GLMM_METPB RecName: Full=Phosphoglucosamine mutase
 gi|179348064|gb|ACB83476.1| phosphoglucosamine mutase [Methylobacterium populi BJ001]
          Length = 446

 Score =  545 bits (1405), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 261/427 (61%), Positives = 334/427 (78%), Gaps = 3/427 (0%)

Query: 3   RRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLF-RGKKKHRRVVIGKDTRLSGYMLENS 61
           R+ FGTDGIRG++N   ITP   +++G A G +F RG  +HR VVIGKDTRLSGYM+E +
Sbjct: 2   RKHFGTDGIRGRANGI-ITPELALKVGQAAGVIFQRGDHRHR-VVIGKDTRLSGYMIETA 59

Query: 62  LVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKV 121
           LVAGFT+ GMD  +LGP+P+PAVAMLTRS+RAD+GVMISASHNP++DNGIKLFGPDG+K+
Sbjct: 60  LVAGFTSVGMDVLLLGPMPTPAVAMLTRSMRADIGVMISASHNPFEDNGIKLFGPDGFKL 119

Query: 122 STDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVV 181
           + ++E  IE+L++ D+   L+    +G AKR++ VH RYIE  KRTLPR VTL GLR+VV
Sbjct: 120 NDELELEIESLIDGDMRRRLAGSRDLGRAKRIESVHARYIEFAKRTLPRHVTLDGLRVVV 179

Query: 182 DCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIA 241
           DCANGA+Y+VAPE  WELGA+V+ IG +P+G NIN D GST   SL +KV E+RAD+GIA
Sbjct: 180 DCANGAAYRVAPETLWELGAEVIAIGVEPDGFNINRDVGSTAPESLVQKVRELRADVGIA 239

Query: 242 LDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLG 301
           LDGD DRV+IVDEKG  V+GDQ+MA +AR W     L   G+V T+MSN+GLERFI GLG
Sbjct: 240 LDGDADRVLIVDEKGQKVDGDQLMAAVARSWKEDERLTQPGLVATIMSNLGLERFINGLG 299

Query: 302 LSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKP 361
           L+L RT VGDRY++E+M+ +G+N+GGEQSGHII+SDY +TGDGLVAALQ+L  +K+ + P
Sbjct: 300 LTLARTAVGDRYVLEHMREHGYNLGGEQSGHIIMSDYATTGDGLVAALQLLSVVKRRNLP 359

Query: 362 VSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLIR 421
           VS +CHCFE  PQ L++V  +    L + S+V AIA A+  L    RL++R SGTE +IR
Sbjct: 360 VSEVCHCFEPLPQILKNVRFRSGEPLRADSVVTAIAHAKDRLGQSGRLVIRPSGTEPVIR 419

Query: 422 IMAEGDD 428
           +MAEGDD
Sbjct: 420 VMAEGDD 426


>gi|146342781|ref|YP_001207829.1| phosphoglucosamine mutase [Bradyrhizobium sp. ORS278]
 gi|158514230|sp|A4Z0D8|GLMM_BRASO RecName: Full=Phosphoglucosamine mutase
 gi|146195587|emb|CAL79614.1| phosphoglucosamine mutase [Bradyrhizobium sp. ORS278]
          Length = 449

 Score =  545 bits (1404), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 262/444 (59%), Positives = 343/444 (77%), Gaps = 3/444 (0%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLF-RGKKKHRRVVIGKDTRLSGYMLE 59
           M R +FGTDGIRG++N   ITP   +++G A G LF RG+ +HR VVIGKDTRLSGYM+E
Sbjct: 1   MSRNYFGTDGIRGRANGL-ITPELALKVGQAAGLLFQRGEHRHR-VVIGKDTRLSGYMIE 58

Query: 60  NSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGY 119
            ++VAGFT+ GMD  ++GP+P+PAVAMLT+S+RAD+GVMISASHN ++DNGIKLFGP G+
Sbjct: 59  YAMVAGFTSVGMDVLLVGPMPTPAVAMLTKSMRADLGVMISASHNLFEDNGIKLFGPQGF 118

Query: 120 KVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRI 179
           K+S D+E +IE LL++ L   L+   S+G A+R+DGVHDRYIE  KRTLPRD++L GLR+
Sbjct: 119 KLSDDVEKQIEQLLDESLDKKLAQSASLGRARRIDGVHDRYIEFAKRTLPRDLSLDGLRV 178

Query: 180 VVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIG 239
           VVDCANGA+YKV PE  WELGADV+ IG +P+G NIN +CGST+  +L RKV E+RADIG
Sbjct: 179 VVDCANGAAYKVVPEALWELGADVISIGVEPDGFNINKECGSTSPEALCRKVREMRADIG 238

Query: 240 IALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAG 299
           IALDGD DRVI+VDE+G IV+GDQ++A+IA+ W     L   GIV TVMSN+GLERF+ G
Sbjct: 239 IALDGDADRVILVDERGHIVDGDQLLAVIAQSWKEDGRLSRPGIVATVMSNLGLERFLQG 298

Query: 300 LGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYD 359
            GL L RT VGDRY++E M  +G+N+GGEQSGHIILSDY +TGDG VAALQVL  +++  
Sbjct: 299 QGLELVRTPVGDRYVLERMLADGYNLGGEQSGHIILSDYATTGDGFVAALQVLATVQKLR 358

Query: 360 KPVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESL 419
           +PVS +CH F+  PQ L++V  +    L++ ++  AI   +  L G  RL+VR+SGTE +
Sbjct: 359 RPVSEVCHKFDPLPQILKNVRYRSGKPLDTDAVKSAIDTGQKRLNGHGRLLVRSSGTEPV 418

Query: 420 IRIMAEGDDLSRIKRIVDDLAKVI 443
           IR+M EGDD + ++ +VDD+   +
Sbjct: 419 IRVMGEGDDRNLVEEVVDDIVTAV 442


>gi|170750726|ref|YP_001756986.1| phosphoglucosamine mutase [Methylobacterium radiotolerans JCM 2831]
 gi|226723898|sp|B1M3G3|GLMM_METRJ RecName: Full=Phosphoglucosamine mutase
 gi|170657248|gb|ACB26303.1| phosphoglucosamine mutase [Methylobacterium radiotolerans JCM 2831]
          Length = 447

 Score =  545 bits (1403), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 260/429 (60%), Positives = 332/429 (77%), Gaps = 3/429 (0%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLF-RGKKKHRRVVIGKDTRLSGYMLE 59
           M R++FGTDGIRG++N   ITP   +++G A G +F RG  +HR VVIGKDTRLSGYM+E
Sbjct: 1   MVRKYFGTDGIRGRANGV-ITPELALKVGQAAGLVFQRGDHRHR-VVIGKDTRLSGYMIE 58

Query: 60  NSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGY 119
            +LVAGFT+ GMD  +LGP+P+PAVAMLTRS+RAD+GVMISASHNP++DNGIKLFGPDG+
Sbjct: 59  TALVAGFTSVGMDVLLLGPVPTPAVAMLTRSMRADLGVMISASHNPFEDNGIKLFGPDGF 118

Query: 120 KVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRI 179
           K++  IE  IE L++ D+   LS  + +G AKR++ VH RYIE  KRTLPR VTL GLR+
Sbjct: 119 KLNDAIEHEIEGLIDADMHKRLSGSNDLGRAKRIESVHARYIEFAKRTLPRQVTLDGLRV 178

Query: 180 VVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIG 239
           VVDCANGA+Y+VAPE  WELGA+V+ IG +P+G NIN D GST   +L   V E RADIG
Sbjct: 179 VVDCANGAAYRVAPETLWELGAEVIAIGTEPDGFNINRDVGSTAPAALIDMVRERRADIG 238

Query: 240 IALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAG 299
           IALDGD DRV+IVDEKG +V+GDQ+MA++AR W     L   G+V T+MSN+GLERF+ G
Sbjct: 239 IALDGDADRVLIVDEKGQVVDGDQLMAVVARSWKEDERLTQPGVVATIMSNLGLERFLGG 298

Query: 300 LGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYD 359
           LGLSL RT VGDRY++E+M+ +G+N+GGEQSGHII+SDY +TGDGLVAALQ+L  +++ +
Sbjct: 299 LGLSLARTAVGDRYVLEHMRAHGYNLGGEQSGHIIMSDYTTTGDGLVAALQLLSVVQRQN 358

Query: 360 KPVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESL 419
           +PVS +CHCF+  PQ L++V  +    L   S+V AI  A   L    RL++R SGTE +
Sbjct: 359 RPVSEVCHCFDPLPQILKNVRYRSGEPLREDSVVSAIEHARERLGNAGRLVIRPSGTEPV 418

Query: 420 IRIMAEGDD 428
           IR+MAEGDD
Sbjct: 419 IRVMAEGDD 427


>gi|298292989|ref|YP_003694928.1| phosphoglucosamine mutase [Starkeya novella DSM 506]
 gi|296929500|gb|ADH90309.1| phosphoglucosamine mutase [Starkeya novella DSM 506]
          Length = 447

 Score =  544 bits (1402), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 263/439 (59%), Positives = 339/439 (77%), Gaps = 3/439 (0%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLF-RGKKKHRRVVIGKDTRLSGYMLE 59
           M R+ FGTDGIRG++N   ITP   +R+G+A G +F RG  +HR VVIGKDTRLSGYM+E
Sbjct: 1   MGRKLFGTDGIRGRANG-TITPELALRVGMAAGLVFQRGDYRHR-VVIGKDTRLSGYMIE 58

Query: 60  NSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGY 119
           N+LVAGFT+ GMD  +LGP+P+PAVAMLT S+RAD+GVMISASHNPY DNGIKLFGPDGY
Sbjct: 59  NALVAGFTSVGMDVLLLGPVPTPAVAMLTHSMRADIGVMISASHNPYDDNGIKLFGPDGY 118

Query: 120 KVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRI 179
           K+S ++E RIE L+  D+++ L+   S+G AKR++ VH RYIE+ KRTLPR  +  GLR+
Sbjct: 119 KLSDELEARIEELIAGDMSTKLASPASMGRAKRIESVHARYIEYAKRTLPRTQSFDGLRV 178

Query: 180 VVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIG 239
           VVDCANGA+Y+VAPE  WELG +V+ IGDKP+G NIN + GST   +L  KV EVRADIG
Sbjct: 179 VVDCANGAAYRVAPEALWELGCEVITIGDKPDGFNINHEVGSTAPEALMAKVREVRADIG 238

Query: 240 IALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAG 299
           IALDGD DRV+IVDEKG +V+GDQ+MA++A  +     L  +GIV TVMSN+ LER +  
Sbjct: 239 IALDGDADRVLIVDEKGRLVDGDQLMAVVAESFKEDGRLARDGIVATVMSNLALERHLNS 298

Query: 300 LGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYD 359
           +GL+L RT VGDRY++E+M+ NGFNVGGEQSGH+ILSDY +TGDGLVAALQVL  +++  
Sbjct: 299 VGLTLDRTPVGDRYVLEHMRANGFNVGGEQSGHLILSDYSTTGDGLVAALQVLAVVQRRQ 358

Query: 360 KPVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESL 419
           +PVS +CH F+  PQ L++V  K+   L    +++AIA AE +L    RL++R SGTE +
Sbjct: 359 RPVSEVCHRFDALPQILKNVRYKNGRPLEDDGVIKAIAAAELKLNSHGRLLIRPSGTEPV 418

Query: 420 IRIMAEGDDLSRIKRIVDD 438
           IR+M EGDD   ++ +V+D
Sbjct: 419 IRVMGEGDDRDLVEAVVND 437


>gi|148253341|ref|YP_001237926.1| phosphoglucosamine mutase [Bradyrhizobium sp. BTAi1]
 gi|158513271|sp|A5ECX6|GLMM_BRASB RecName: Full=Phosphoglucosamine mutase
 gi|146405514|gb|ABQ34020.1| phosphoglucosamine mutase [Bradyrhizobium sp. BTAi1]
          Length = 449

 Score =  544 bits (1402), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 262/444 (59%), Positives = 342/444 (77%), Gaps = 3/444 (0%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLF-RGKKKHRRVVIGKDTRLSGYMLE 59
           M R +FGTDGIRG++N   ITP   +++G A G LF RG+ +HR VVIGKDTRLSGYM+E
Sbjct: 1   MSRNYFGTDGIRGRANGL-ITPELALKVGQAAGLLFQRGEHRHR-VVIGKDTRLSGYMIE 58

Query: 60  NSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGY 119
            ++VAGFT+ GMD  ++GP+P+PAVAMLT+S+RAD+GVMISASHN ++DNGIKLFGP G+
Sbjct: 59  YAMVAGFTSVGMDVLLVGPMPTPAVAMLTKSMRADLGVMISASHNLFEDNGIKLFGPQGF 118

Query: 120 KVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRI 179
           K+S D+E +IE LL++ L   L+   S+G A+R+DGVHDRYIE  KRTLPRD++L GLR+
Sbjct: 119 KLSDDVEKQIEQLLDESLDKKLAQSASLGRARRIDGVHDRYIEFAKRTLPRDLSLDGLRV 178

Query: 180 VVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIG 239
           VVDCANGA+YKV PE  WELGADV+ IG +P+G NIN +CGST+  +L RKV E+RADIG
Sbjct: 179 VVDCANGAAYKVVPEALWELGADVISIGVEPDGFNINKECGSTSPEALCRKVREMRADIG 238

Query: 240 IALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAG 299
           IALDGD DRVI+VDE+G IV+GDQ++A+IA+ W     L   GIV TVMSN+GLERF+ G
Sbjct: 239 IALDGDADRVILVDERGHIVDGDQLLAVIAQSWKEDGRLARPGIVATVMSNLGLERFLQG 298

Query: 300 LGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYD 359
            GL L RT VGDRY++E M  +G+N+GGEQSGHIILSDY +TGDG VAALQVL  +++  
Sbjct: 299 QGLELVRTPVGDRYVLERMLADGYNLGGEQSGHIILSDYATTGDGFVAALQVLATVQRLR 358

Query: 360 KPVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESL 419
           +PVS +CH F+  PQ L++V  +    L++ ++  AI   +  L G  RL+VR+SGTE +
Sbjct: 359 RPVSEVCHKFDPLPQILKNVRYRSGKPLDADAVKSAIDTGQKRLNGHGRLLVRSSGTEPV 418

Query: 420 IRIMAEGDDLSRIKRIVDDLAKVI 443
           IR+M EGDD   ++ +VDD+   +
Sbjct: 419 IRVMGEGDDRDLVEEVVDDIVTAV 442


>gi|158422599|ref|YP_001523891.1| phosphoglucosamine mutase [Azorhizobium caulinodans ORS 571]
 gi|172047840|sp|A8HUR7|GLMM_AZOC5 RecName: Full=Phosphoglucosamine mutase
 gi|158329488|dbj|BAF86973.1| phosphoglucosamine mutase [Azorhizobium caulinodans ORS 571]
          Length = 447

 Score =  542 bits (1397), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 257/443 (58%), Positives = 341/443 (76%), Gaps = 1/443 (0%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M R++FGTDG+RG++N   +T +  +R+G+A G  FR  +   RVVIGKDTRLSGYM+EN
Sbjct: 1   MARKYFGTDGVRGRANA-TLTADLALRVGMAAGLAFRRGEHRHRVVIGKDTRLSGYMIEN 59

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +LVAGFT+ GMD  +LGP+P+PAV MLTRS+RAD+GVMISASHNP+ DNGIKLFGPDG+K
Sbjct: 60  ALVAGFTSVGMDVLLLGPMPTPAVGMLTRSMRADLGVMISASHNPFDDNGIKLFGPDGFK 119

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +S  IE  IE L+++DL+  L+    IG A+RV+GVH RYIE+ KRTLPRD + +GLR+V
Sbjct: 120 LSDQIEHEIEELIDEDLSKKLAQPMDIGRARRVEGVHARYIEYAKRTLPRDQSFEGLRVV 179

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           VDCANGA+Y+VAP+  WELGA+V+ +G +P+G+NIN D GST+  +L  KV EVRAD+GI
Sbjct: 180 VDCANGAAYRVAPDALWELGAEVISMGVEPDGLNINRDVGSTSPAALSAKVREVRADVGI 239

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           ALDGD DRVIIVDEKG +V+GDQIMA++A  +     L  +GIV TVMSN+GLER++   
Sbjct: 240 ALDGDADRVIIVDEKGHVVDGDQIMAVVAHSFKEDGRLSRDGIVATVMSNLGLERYLKDE 299

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           GL+L RT VGDRY++E M+++G+NVGGEQSGHIILSDY +TGDGL+AALQVL  + + ++
Sbjct: 300 GLTLARTSVGDRYVLERMRSDGYNVGGEQSGHIILSDYSTTGDGLLAALQVLAVVARSER 359

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
           PVS +CH F+  PQ L++V       L   ++  AIADAE  L    RL++R SGTE +I
Sbjct: 360 PVSEVCHRFDPLPQVLKNVRYSSGKPLEHENVQSAIADAERRLANHGRLLIRPSGTEPVI 419

Query: 421 RIMAEGDDLSRIKRIVDDLAKVI 443
           R+M EGDD   ++ +VD++ + +
Sbjct: 420 RVMGEGDDFELVEGVVDEVIEAL 442


>gi|154252578|ref|YP_001413402.1| phosphoglucosamine mutase [Parvibaculum lavamentivorans DS-1]
 gi|171769605|sp|A7HV12|GLMM_PARL1 RecName: Full=Phosphoglucosamine mutase
 gi|154156528|gb|ABS63745.1| phosphoglucosamine mutase [Parvibaculum lavamentivorans DS-1]
          Length = 448

 Score =  542 bits (1396), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 259/443 (58%), Positives = 329/443 (74%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M R++FGTDGIRG +NT  +T    +R+G+A G +FR  +   RVVIGKDTRLSGYMLE 
Sbjct: 1   MPRKYFGTDGIRGTANTGHMTAETALRVGMAAGRVFRRGEHRHRVVIGKDTRLSGYMLEP 60

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +L AGFT+ GMD F+ GP+P+PAVAMLTRSLRAD+GVMISASHN ++DNGIKLFGPDG+K
Sbjct: 61  ALTAGFTSMGMDVFLFGPLPTPAVAMLTRSLRADLGVMISASHNSFEDNGIKLFGPDGFK 120

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +S ++E  IE  +++ L   L+    +G AKR++    RYIEHVK T P+  TL+GLRIV
Sbjct: 121 LSDEVELAIEHHMDNGLADNLAGSRGLGRAKRIEDAQARYIEHVKHTFPKQQTLEGLRIV 180

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           +DCANGA+YKVAPEV WELGA+VV +G +PNG NIN DCGST    +   V E RADIGI
Sbjct: 181 IDCANGAAYKVAPEVLWELGAEVVTVGTEPNGFNINEDCGSTAPERMCAAVLERRADIGI 240

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           ALDGD DRVII DE+G +++GDQIM L+AR W     L   GIV TVMSN+GLER++  L
Sbjct: 241 ALDGDADRVIIADERGKVIDGDQIMGLVARHWKEMGTLSAPGIVATVMSNLGLERYLGSL 300

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           GL L RT+VGDRY++E+M+ +G+NVGGEQSGHI+L D+ +TGDGL+AALQVL  +K  DK
Sbjct: 301 GLDLVRTQVGDRYVVEHMREHGYNVGGEQSGHIVLKDFSTTGDGLIAALQVLAVLKAGDK 360

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
           PVS ICH F+  PQ L+++  K    L    + +AI + ES L    RL++R SGTE LI
Sbjct: 361 PVSEICHLFDPLPQLLKNIRFKRGEPLKDKDVQEAIREGESRLGKTGRLVIRKSGTEPLI 420

Query: 421 RIMAEGDDLSRIKRIVDDLAKVI 443
           R+M EGDD   +  +V+D+A VI
Sbjct: 421 RVMGEGDDEKLVTSVVNDIAAVI 443


>gi|84029237|sp|Q89DN1|GLMM_BRAJA RecName: Full=Phosphoglucosamine mutase
          Length = 447

 Score =  541 bits (1395), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 261/444 (58%), Positives = 341/444 (76%), Gaps = 3/444 (0%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLF-RGKKKHRRVVIGKDTRLSGYMLE 59
           M R++FGTDGIRG++N   ITP   +++G A G  F RG  +HR VVIGKDTRLSGYM+E
Sbjct: 1   MSRKYFGTDGIRGRANGL-ITPELALKVGQAAGLAFQRGDHRHR-VVIGKDTRLSGYMIE 58

Query: 60  NSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGY 119
            ++VAGFT+ GMD  ++GP+P+PAVAMLT+S+RAD+GVMISASHN ++DNGIKLFGP G+
Sbjct: 59  YAMVAGFTSVGMDVLLVGPMPTPAVAMLTKSMRADLGVMISASHNLFEDNGIKLFGPQGF 118

Query: 120 KVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRI 179
           K+S D+E +IE LL++ +   L+   S+G A+R+DGVHDRYIE  KRTLPRD++L GLR+
Sbjct: 119 KLSDDVEKQIEQLLDEPIDKRLAQSASLGRARRIDGVHDRYIEFAKRTLPRDLSLDGLRV 178

Query: 180 VVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIG 239
           VVDCANGA+YKV PE  WELGADVV IG +P+G NIN DCGST+  +L +KV E+RADIG
Sbjct: 179 VVDCANGAAYKVVPEALWELGADVVPIGVEPDGFNINKDCGSTSPEALSKKVREMRADIG 238

Query: 240 IALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAG 299
           IALDGD DRVI+VDE+G +V+GDQ++A+IA+ W     L   GIV TVMSN+GLERF+ G
Sbjct: 239 IALDGDADRVILVDERGHVVDGDQLLAVIAQSWKEDGRLSRPGIVATVMSNLGLERFLKG 298

Query: 300 LGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYD 359
            GL L RT VGDRY++E M + G+N+GGEQSGHIILSDY +TGDG VAALQVL  +++  
Sbjct: 299 QGLDLVRTPVGDRYVLEQMLSGGYNLGGEQSGHIILSDYATTGDGFVAALQVLAVVQKSR 358

Query: 360 KPVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESL 419
           +PVS +CH F+  PQ L++V  K    L+ S +  AI+D E  L G  RL++R+SGTE +
Sbjct: 359 RPVSEVCHRFDPLPQILKNVRHKGGKPLDDSDVKSAISDGEKRLNGHGRLLIRSSGTEPV 418

Query: 420 IRIMAEGDDLSRIKRIVDDLAKVI 443
           IR+M EG+D   ++ +VD +   +
Sbjct: 419 IRVMGEGEDRILVEDVVDTIVSAL 442


>gi|90425588|ref|YP_533958.1| phosphoglucosamine mutase [Rhodopseudomonas palustris BisB18]
 gi|122475316|sp|Q20YZ7|GLMM_RHOPB RecName: Full=Phosphoglucosamine mutase
 gi|90107602|gb|ABD89639.1| phosphoglucosamine mutase [Rhodopseudomonas palustris BisB18]
          Length = 450

 Score =  541 bits (1395), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 261/444 (58%), Positives = 336/444 (75%), Gaps = 3/444 (0%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLF-RGKKKHRRVVIGKDTRLSGYMLE 59
           M RR+FGTDGIRG++N   ITP   M++G A G +F RG+ +HR VVIGKDTRLSGYM+E
Sbjct: 1   MSRRYFGTDGIRGRANGL-ITPELAMKVGQAAGLVFQRGEYRHR-VVIGKDTRLSGYMIE 58

Query: 60  NSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGY 119
            +LVAGFT+ GMD  +LGP+P+PAVAMLT+S+RAD+GVMISASHN ++DNGIKLFGP G+
Sbjct: 59  TALVAGFTSVGMDVLLLGPMPTPAVAMLTKSMRADLGVMISASHNLFEDNGIKLFGPLGF 118

Query: 120 KVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRI 179
           K+S D+E +IE LL++ L   L+   S+G A+R+DGVHDRYIE  KRTLPRD++L GLR+
Sbjct: 119 KLSDDVEKQIEQLLDESLDKKLAESASLGRARRIDGVHDRYIEFAKRTLPRDLSLDGLRV 178

Query: 180 VVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIG 239
           V+DCA+GA+YKV PE  WELGADV+ IG +P+G NIN +CGST   +L RKV E+RADIG
Sbjct: 179 VIDCAHGAAYKVVPEALWELGADVIAIGVEPDGFNINKECGSTAPEALSRKVREMRADIG 238

Query: 240 IALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAG 299
           IALDGD DRVI+VDE+G +V+GDQ++A+IA+ W     L   GIV TVMSN+GLERF+  
Sbjct: 239 IALDGDADRVILVDERGHVVDGDQLLAVIAQSWKEDGRLSKPGIVATVMSNLGLERFLQS 298

Query: 300 LGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYD 359
            G+ + RT VGDRY++E M   G+NVGGE SGHIILSDY +TGDG VAALQVL  +++  
Sbjct: 299 NGIEMVRTPVGDRYVLEQMLKQGYNVGGEPSGHIILSDYATTGDGFVAALQVLAVVQKLG 358

Query: 360 KPVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESL 419
           +PVS +CH FE  PQ L++V  +    L    +  AI  AE  L G  RL+VR+SGTE +
Sbjct: 359 RPVSEVCHLFEPLPQVLKNVRYRAGKPLEDDEVKSAIHAAEKRLNGHGRLLVRSSGTEPV 418

Query: 420 IRIMAEGDDLSRIKRIVDDLAKVI 443
           IR+M EGDD   ++ +VD +   +
Sbjct: 419 IRVMGEGDDREMVEEVVDTICSAL 442


>gi|39937378|ref|NP_949654.1| phosphoglucosamine mutase [Rhodopseudomonas palustris CGA009]
 gi|81619312|sp|Q6N1T6|GLMM_RHOPA RecName: Full=Phosphoglucosamine mutase
 gi|39651236|emb|CAE29759.1| phosphoglucomutase/phosphomannomutase family protein MrsA
           [Rhodopseudomonas palustris CGA009]
          Length = 450

 Score =  541 bits (1395), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 258/444 (58%), Positives = 341/444 (76%), Gaps = 3/444 (0%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLF-RGKKKHRRVVIGKDTRLSGYMLE 59
           M RR+FGTDGIRG++N   ITP   +++G A G  F RG+ +HR VVIGKDTRLSGYM+E
Sbjct: 1   MSRRYFGTDGIRGRANGL-ITPELALKVGQAAGLAFQRGEHRHR-VVIGKDTRLSGYMIE 58

Query: 60  NSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGY 119
           N+LVAGFT+ GMD  ++GP+P+PAVAMLT+S+RAD+GVMISASHN ++DNGIKLFGP GY
Sbjct: 59  NALVAGFTSVGMDVLLVGPMPTPAVAMLTKSMRADLGVMISASHNLFEDNGIKLFGPLGY 118

Query: 120 KVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRI 179
           K+S D+E +IE +L++ L   L+   S+G A+R+DGVHDRYIE  KRTLPR+++L+GLR+
Sbjct: 119 KLSDDVEKQIELMLDESLDKKLAQSASLGRARRIDGVHDRYIEFAKRTLPRELSLEGLRV 178

Query: 180 VVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIG 239
           V+DCANGA+YKV PE  WELGADV+ IG +P+G NIN +CGST   +L  KV E+RADIG
Sbjct: 179 VIDCANGAAYKVVPEALWELGADVISIGVEPDGFNINKECGSTAPQALCAKVREMRADIG 238

Query: 240 IALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAG 299
           IALDGD DRVI+VDE+G +V+GDQ++A+I + W     L   G+V TVMSN+GLERF+AG
Sbjct: 239 IALDGDADRVILVDERGHVVDGDQLLAVIGQSWKEDGRLAKPGVVATVMSNLGLERFLAG 298

Query: 300 LGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYD 359
            G++L RT VGDRY++E M  +G+NVGGE SGHIILSD+ +TGDG VAALQVL  +++  
Sbjct: 299 EGIALLRTPVGDRYVLEQMLKDGYNVGGESSGHIILSDFNTTGDGFVAALQVLAMVQKLG 358

Query: 360 KPVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESL 419
           +PVS +CH F+  PQ L++V  +    L+ S ++ AI D E  L G  RL++R SGTE +
Sbjct: 359 RPVSEVCHRFDPLPQILKNVRYRSGRPLDDSGVISAIQDGEKRLNGHGRLLIRPSGTEPV 418

Query: 420 IRIMAEGDDLSRIKRIVDDLAKVI 443
           IR+M EGDD   ++ +VD +   +
Sbjct: 419 IRVMGEGDDHDVVEEVVDSIVDAL 442


>gi|115526162|ref|YP_783073.1| phosphoglucosamine mutase [Rhodopseudomonas palustris BisA53]
 gi|122294962|sp|Q07IZ1|GLMM_RHOP5 RecName: Full=Phosphoglucosamine mutase
 gi|115520109|gb|ABJ08093.1| phosphoglucosamine mutase [Rhodopseudomonas palustris BisA53]
          Length = 450

 Score =  541 bits (1395), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 259/444 (58%), Positives = 339/444 (76%), Gaps = 3/444 (0%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLF-RGKKKHRRVVIGKDTRLSGYMLE 59
           M R++FGTDGIRG++N   ITP   M++G A G +F RG+ +HR VVIGKDTRLSGYM+E
Sbjct: 1   MSRKYFGTDGIRGRANGL-ITPELAMKVGQAAGLVFQRGEYRHR-VVIGKDTRLSGYMIE 58

Query: 60  NSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGY 119
            +LVAGFT+ GMD  +LGP+P+PAVAMLT+S+RAD+GVMISASHN ++DNGIKLFGP G+
Sbjct: 59  TALVAGFTSVGMDVLLLGPMPTPAVAMLTKSMRADLGVMISASHNLFEDNGIKLFGPLGF 118

Query: 120 KVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRI 179
           K+S ++E +IE LL++ L   L+   S+G A+R+DGVHDRYIE  KRTLPRD++L GLR+
Sbjct: 119 KLSDEVERQIEQLLDECLDKRLAASASLGRARRIDGVHDRYIEFAKRTLPRDLSLDGLRV 178

Query: 180 VVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIG 239
           V+DCANGA+YKV PE  WELGADV+ IG +P+G NIN +CGST   +L RKV E+RADIG
Sbjct: 179 VIDCANGAAYKVVPEALWELGADVISIGVEPDGFNINKECGSTAPEALSRKVREMRADIG 238

Query: 240 IALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAG 299
           IALDGD DRVI+VDE+G +V+GDQ++A+IA+ W     L   GIV TVMSN+GLERF+ G
Sbjct: 239 IALDGDADRVILVDERGHVVDGDQLLAVIAQSWQEDGRLSKPGIVATVMSNLGLERFLEG 298

Query: 300 LGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYD 359
            G+ + RT VGDRY++E M   G+N+GGE SGHIILSDY +TGDG VAALQVL  +++  
Sbjct: 299 HGIEMVRTPVGDRYVLEQMMTGGYNLGGEPSGHIILSDYATTGDGFVAALQVLAVVQKLG 358

Query: 360 KPVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESL 419
           +PVS +CH F+  PQ L++V  +    L+ + +  AI D E  L G  RL++R SGTE +
Sbjct: 359 RPVSEVCHKFDPLPQILKNVRFRAGKPLDDADVKSAIRDGEQRLNGHGRLLIRPSGTEPV 418

Query: 420 IRIMAEGDDLSRIKRIVDDLAKVI 443
           IR+MAEGDD   ++ +VD +   +
Sbjct: 419 IRVMAEGDDRDVVEEVVDSICSAL 442


>gi|27382519|ref|NP_774048.1| phosphoglucosamine mutase [Bradyrhizobium japonicum USDA 110]
 gi|27355691|dbj|BAC52673.1| phosphoglucomutase/phosphomannomutase [Bradyrhizobium japonicum
           USDA 110]
          Length = 451

 Score =  541 bits (1394), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 261/444 (58%), Positives = 341/444 (76%), Gaps = 3/444 (0%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLF-RGKKKHRRVVIGKDTRLSGYMLE 59
           M R++FGTDGIRG++N   ITP   +++G A G  F RG  +HR VVIGKDTRLSGYM+E
Sbjct: 5   MSRKYFGTDGIRGRANGL-ITPELALKVGQAAGLAFQRGDHRHR-VVIGKDTRLSGYMIE 62

Query: 60  NSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGY 119
            ++VAGFT+ GMD  ++GP+P+PAVAMLT+S+RAD+GVMISASHN ++DNGIKLFGP G+
Sbjct: 63  YAMVAGFTSVGMDVLLVGPMPTPAVAMLTKSMRADLGVMISASHNLFEDNGIKLFGPQGF 122

Query: 120 KVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRI 179
           K+S D+E +IE LL++ +   L+   S+G A+R+DGVHDRYIE  KRTLPRD++L GLR+
Sbjct: 123 KLSDDVEKQIEQLLDEPIDKRLAQSASLGRARRIDGVHDRYIEFAKRTLPRDLSLDGLRV 182

Query: 180 VVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIG 239
           VVDCANGA+YKV PE  WELGADVV IG +P+G NIN DCGST+  +L +KV E+RADIG
Sbjct: 183 VVDCANGAAYKVVPEALWELGADVVPIGVEPDGFNINKDCGSTSPEALSKKVREMRADIG 242

Query: 240 IALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAG 299
           IALDGD DRVI+VDE+G +V+GDQ++A+IA+ W     L   GIV TVMSN+GLERF+ G
Sbjct: 243 IALDGDADRVILVDERGHVVDGDQLLAVIAQSWKEDGRLSRPGIVATVMSNLGLERFLKG 302

Query: 300 LGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYD 359
            GL L RT VGDRY++E M + G+N+GGEQSGHIILSDY +TGDG VAALQVL  +++  
Sbjct: 303 QGLDLVRTPVGDRYVLEQMLSGGYNLGGEQSGHIILSDYATTGDGFVAALQVLAVVQKSR 362

Query: 360 KPVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESL 419
           +PVS +CH F+  PQ L++V  K    L+ S +  AI+D E  L G  RL++R+SGTE +
Sbjct: 363 RPVSEVCHRFDPLPQILKNVRHKGGKPLDDSDVKSAISDGEKRLNGHGRLLIRSSGTEPV 422

Query: 420 IRIMAEGDDLSRIKRIVDDLAKVI 443
           IR+M EG+D   ++ +VD +   +
Sbjct: 423 IRVMGEGEDRILVEDVVDTIVSAL 446


>gi|86748432|ref|YP_484928.1| phosphoglucosamine mutase [Rhodopseudomonas palustris HaA2]
 gi|123099006|sp|Q2J0J3|GLMM_RHOP2 RecName: Full=Phosphoglucosamine mutase
 gi|86571460|gb|ABD06017.1| phosphoglucosamine mutase [Rhodopseudomonas palustris HaA2]
          Length = 450

 Score =  540 bits (1392), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 259/444 (58%), Positives = 342/444 (77%), Gaps = 3/444 (0%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLF-RGKKKHRRVVIGKDTRLSGYMLE 59
           M RR+FGTDGIRG++N   ITP   +++G A G +F RG  +HR VVIGKDTRLSGYM+E
Sbjct: 1   MSRRYFGTDGIRGRANGL-ITPELALKVGQAAGLVFQRGDHRHR-VVIGKDTRLSGYMIE 58

Query: 60  NSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGY 119
           N++VAGFT+ GMD  ++GP+P+PAVAMLT+S+RAD+GVMISASHN ++DNGIKLFGP G+
Sbjct: 59  NAMVAGFTSVGMDVLLVGPMPTPAVAMLTKSMRADLGVMISASHNMFEDNGIKLFGPLGF 118

Query: 120 KVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRI 179
           K+S D+E +IE LL++ +   LS   S+G A+R+DGVHDRYIE  KRTLPRD++L GLR+
Sbjct: 119 KLSDDVEKQIEQLLDEPMDKKLSESASLGRARRIDGVHDRYIEFAKRTLPRDLSLDGLRV 178

Query: 180 VVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIG 239
           VVDCANGA+YKV PE  WELGADV+ IG +P+G NIN +CGST+  +L RKV E+RADIG
Sbjct: 179 VVDCANGAAYKVVPEALWELGADVISIGVEPDGFNINKECGSTSPEALCRKVREMRADIG 238

Query: 240 IALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAG 299
           IALDGD DRVI+VDE+G +++GDQ++A+IA+ W     L   GIV TVMSN+GLERF+A 
Sbjct: 239 IALDGDADRVIMVDERGHVIDGDQLLAVIAQSWKEDGRLARPGIVATVMSNLGLERFLAS 298

Query: 300 LGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYD 359
            G+ L RT VGDRY++E M  +G+NVGGE SGHIILSDY +TGDG VAALQ+L  +++  
Sbjct: 299 EGIELVRTSVGDRYVLEAMLRDGYNVGGEASGHIILSDYATTGDGFVAALQILAVVQKLG 358

Query: 360 KPVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESL 419
           +PVS +CH F+  PQ L++V  +    L+ + +  AI+DAE  L G  RL++R SGTE +
Sbjct: 359 RPVSEVCHRFDPLPQILKNVRYRAGRPLDDAGVQSAISDAEKRLNGHGRLLIRPSGTEPV 418

Query: 420 IRIMAEGDDLSRIKRIVDDLAKVI 443
           IR+M EG+D   ++ +VD +   +
Sbjct: 419 IRVMGEGEDRIMVEEVVDTIVDAL 442


>gi|316935834|ref|YP_004110816.1| phosphoglucosamine mutase [Rhodopseudomonas palustris DX-1]
 gi|315603548|gb|ADU46083.1| phosphoglucosamine mutase [Rhodopseudomonas palustris DX-1]
          Length = 450

 Score =  539 bits (1388), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 257/444 (57%), Positives = 340/444 (76%), Gaps = 3/444 (0%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLF-RGKKKHRRVVIGKDTRLSGYMLE 59
           M RR+FGTDGIRG++N   ITP   +++G A G  F RG+ +HR VVIGKDTRLSGYM+E
Sbjct: 1   MSRRYFGTDGIRGRANGL-ITPELALKVGQAAGLAFQRGEHRHR-VVIGKDTRLSGYMIE 58

Query: 60  NSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGY 119
           N+LVAGFT+ GMD  ++GP+P+PAVAMLT+S+RAD+GVMISASHN ++DNGIKLFGP GY
Sbjct: 59  NALVAGFTSVGMDVLLVGPMPTPAVAMLTKSMRADLGVMISASHNLFEDNGIKLFGPLGY 118

Query: 120 KVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRI 179
           K+S D+E +IE +L+D L   L+   S+G A+R+DGVHDRYIE  KRTLPR+++L+GLR+
Sbjct: 119 KLSDDVEKQIELMLDDSLDKKLAQSASLGRARRIDGVHDRYIEFAKRTLPRELSLEGLRV 178

Query: 180 VVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIG 239
           V+DCANGA+Y+V PE  WELGADV+ IG +P+G NIN +CGST   +L  KV E+RADIG
Sbjct: 179 VIDCANGAAYRVVPEALWELGADVISIGVEPDGFNINKECGSTAPQALCAKVREMRADIG 238

Query: 240 IALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAG 299
           IALDGD DRVI+VDE+G +V+GDQ++A+I + W     L   G+V TVMSN+GLERF+A 
Sbjct: 239 IALDGDADRVILVDERGHVVDGDQLLAVIGQSWKEDGRLAKPGVVATVMSNLGLERFLAS 298

Query: 300 LGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYD 359
            G++L RT VGDRY++E M  +G+NVGGE SGHIILSD+ +TGDG VAALQVL  +++  
Sbjct: 299 EGIALLRTPVGDRYVLEQMLKDGYNVGGESSGHIILSDFNTTGDGFVAALQVLAMVQKLG 358

Query: 360 KPVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESL 419
           +PVS +CH F+  PQ L++V  +    L+ S ++ AI D E  L G  RL++R SGTE +
Sbjct: 359 RPVSEVCHRFDPLPQILKNVRYRSGRPLDDSGVIAAIEDGEKRLNGHGRLLIRPSGTEPV 418

Query: 420 IRIMAEGDDLSRIKRIVDDLAKVI 443
           IR+M EGDD   ++ +VD +   +
Sbjct: 419 IRVMGEGDDHDVVEEVVDSIVDAL 442


>gi|192293158|ref|YP_001993763.1| phosphoglucosamine mutase [Rhodopseudomonas palustris TIE-1]
 gi|226723911|sp|B3Q6Y9|GLMM_RHOPT RecName: Full=Phosphoglucosamine mutase
 gi|192286907|gb|ACF03288.1| phosphoglucosamine mutase [Rhodopseudomonas palustris TIE-1]
          Length = 450

 Score =  538 bits (1387), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 257/444 (57%), Positives = 340/444 (76%), Gaps = 3/444 (0%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLF-RGKKKHRRVVIGKDTRLSGYMLE 59
           M RR+FGTDGIRG++N   ITP   +++G A G  F RG+ +HR VVIGKDTRLSGYM+E
Sbjct: 1   MSRRYFGTDGIRGRANGL-ITPELALKVGQAAGLAFQRGEHRHR-VVIGKDTRLSGYMIE 58

Query: 60  NSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGY 119
           N+LVAGFT+ GMD  ++GP+P+PAVAMLT+S+RAD+GVMISASHN ++DNGIKLFGP GY
Sbjct: 59  NALVAGFTSVGMDVLLVGPMPTPAVAMLTKSMRADLGVMISASHNLFEDNGIKLFGPLGY 118

Query: 120 KVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRI 179
           K+S D+E +IE +L++ L   L+   S+G A+R+DGVHDRYIE  KRTLPR+++L+GLR+
Sbjct: 119 KLSDDVEKQIELMLDESLDKKLAQSASLGRARRIDGVHDRYIEFAKRTLPRELSLEGLRV 178

Query: 180 VVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIG 239
           V+DCANGA+YKV PE  WELGADV+ IG +P+G NIN +CGST   +L  KV E+RADIG
Sbjct: 179 VIDCANGAAYKVVPEALWELGADVISIGVEPDGFNINKECGSTAPQALCAKVREMRADIG 238

Query: 240 IALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAG 299
           IALDGD DRVI+VDE+G +V+GDQ++A+I + W     L   G+V TVMSN+GLERF+AG
Sbjct: 239 IALDGDADRVILVDERGHVVDGDQLLAVIGQSWKEDGRLAKPGVVATVMSNLGLERFLAG 298

Query: 300 LGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYD 359
            G++L RT VGDRY++E M  +G+NVGGE SGHIILSD+ +TGDG VAALQVL  +++  
Sbjct: 299 EGIALLRTPVGDRYVLEQMLKDGYNVGGESSGHIILSDFNTTGDGFVAALQVLAMVQKLG 358

Query: 360 KPVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESL 419
           +PVS +C  F+  PQ L++V  +    L+ S ++ AI D E  L G  RL++R SGTE +
Sbjct: 359 RPVSEVCRRFDPLPQILKNVRYRSGRPLDDSGVISAIQDGEKRLNGHGRLLIRPSGTEPV 418

Query: 420 IRIMAEGDDLSRIKRIVDDLAKVI 443
           IR+M EGDD   ++ +VD +   +
Sbjct: 419 IRVMGEGDDRDVVEEVVDSIVDAL 442


>gi|85715280|ref|ZP_01046263.1| phosphoglucosamine mutase [Nitrobacter sp. Nb-311A]
 gi|85697926|gb|EAQ35800.1| phosphoglucosamine mutase [Nitrobacter sp. Nb-311A]
          Length = 448

 Score =  536 bits (1381), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 257/444 (57%), Positives = 342/444 (77%), Gaps = 3/444 (0%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLF-RGKKKHRRVVIGKDTRLSGYMLE 59
           M R++FGTDGIRG++N   ITP   M++G A G +F RG+ +HR VVIGKDTRLSGYM+E
Sbjct: 1   MSRKYFGTDGIRGRANGL-ITPELAMKVGQAAGLVFQRGEYRHR-VVIGKDTRLSGYMIE 58

Query: 60  NSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGY 119
            +LVAGFT+ GMD  +LGP+P+PAVAMLT+S+RAD+GVMISASHN ++DNGIK+FGP G+
Sbjct: 59  YALVAGFTSVGMDVLLLGPMPTPAVAMLTKSMRADLGVMISASHNLFEDNGIKMFGPRGF 118

Query: 120 KVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRI 179
           K+S ++E +IE LL+++L   L+   ++G A+R+DGVHDRYIE  KRTLPR+++L+GLR+
Sbjct: 119 KLSDEVEKKIEQLLDENLDKKLAQSANLGRARRIDGVHDRYIEFAKRTLPRELSLEGLRV 178

Query: 180 VVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIG 239
           VVDCA+GA+YKV PE  WELGADV+ IG +P+G+NIN +CGST   +L RKV E+R DIG
Sbjct: 179 VVDCAHGAAYKVVPEALWELGADVIPIGVEPDGLNINKECGSTAPEALCRKVREMRGDIG 238

Query: 240 IALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAG 299
           IALDGD DRVIIVDE+G +V+GDQ++A+IA  W     L   GIV TVMSN+GLERF+ G
Sbjct: 239 IALDGDADRVIIVDERGHVVDGDQLLAVIAESWKEDGRLTRPGIVATVMSNLGLERFLQG 298

Query: 300 LGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYD 359
             LSL RT VGDRY++E M  +G+N+GGEQSGHIILSDY +TGDG V+ALQVL  +++  
Sbjct: 299 HELSLVRTPVGDRYVLEQMLKHGYNLGGEQSGHIILSDYATTGDGFVSALQVLAVVQKLG 358

Query: 360 KPVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESL 419
           +PVS +CH FE  PQ L++   ++ + L+ + +  AI   E  L G  RL+VR+SGTE +
Sbjct: 359 RPVSEVCHKFEPMPQILKNFRYRNGTPLDRAEVRSAITAGEKRLNGHGRLLVRSSGTEPV 418

Query: 420 IRIMAEGDDLSRIKRIVDDLAKVI 443
           IR+M EGDD   ++ +VD +   +
Sbjct: 419 IRVMGEGDDRILVEEVVDTIVSAL 442


>gi|75677154|ref|YP_319575.1| phosphoglucosamine mutase [Nitrobacter winogradskyi Nb-255]
 gi|84029245|sp|Q3SNB8|GLMM_NITWN RecName: Full=Phosphoglucosamine mutase
 gi|74422024|gb|ABA06223.1| phosphoglucosamine mutase [Nitrobacter winogradskyi Nb-255]
          Length = 448

 Score =  536 bits (1380), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 258/444 (58%), Positives = 339/444 (76%), Gaps = 3/444 (0%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLF-RGKKKHRRVVIGKDTRLSGYMLE 59
           M RR+FGTDGIRG++N   ITP   M++G A G +F RG+ +HR VVIGKDTRLSGYM+E
Sbjct: 1   MSRRYFGTDGIRGRANGL-ITPELAMKVGQAAGLVFQRGEHRHR-VVIGKDTRLSGYMIE 58

Query: 60  NSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGY 119
            +LVAGFT+ GMD  +LGP+P+PAVAMLT+S+RAD+GVMISASHN ++DNGIK+FGP G+
Sbjct: 59  YALVAGFTSVGMDVLLLGPMPTPAVAMLTKSMRADLGVMISASHNLFEDNGIKMFGPRGF 118

Query: 120 KVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRI 179
           K+S ++E +IE LL+++L   L+   ++G A+R+DGVHDRYIE  KRTLPR+++L+GLR+
Sbjct: 119 KLSDEVEKKIEKLLDENLDKKLAQSRNLGRARRIDGVHDRYIEFAKRTLPRELSLEGLRV 178

Query: 180 VVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIG 239
           VVDCA+GA+YKV PE  WELGADVV IG +P+G+NIN +CGST   +L RKV E+R DIG
Sbjct: 179 VVDCAHGAAYKVVPEALWELGADVVPIGVEPDGLNINKECGSTAPEALCRKVREMRGDIG 238

Query: 240 IALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAG 299
           IALDGD DRVIIVDE+G +V+GDQ++A+IA  W     L   GIV TVMSN+GLERF+  
Sbjct: 239 IALDGDADRVIIVDERGHVVDGDQLLAVIAESWKEDGRLTKPGIVATVMSNLGLERFLKD 298

Query: 300 LGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYD 359
             LSL RT VGDRY++E M   G+N+GGEQSGHIILSDY +TGDG V+ALQVL  +++  
Sbjct: 299 RDLSLVRTPVGDRYVLEQMLKQGYNLGGEQSGHIILSDYATTGDGFVSALQVLAVVQKLG 358

Query: 360 KPVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESL 419
           +PVS +CH FE  PQ L++   ++   L+ + +  AI   E  L G  RL+VR+SGTE +
Sbjct: 359 RPVSQVCHKFEPLPQILKNFRYRNGKPLDRAEVKSAITAGEKRLNGHGRLLVRSSGTEPV 418

Query: 420 IRIMAEGDDLSRIKRIVDDLAKVI 443
           IR+M EGDD   ++ +VD +   +
Sbjct: 419 IRVMGEGDDRILVEEVVDTIVSAL 442


>gi|91978377|ref|YP_571036.1| phosphoglucosamine mutase [Rhodopseudomonas palustris BisB5]
 gi|123748797|sp|Q131V4|GLMM_RHOPS RecName: Full=Phosphoglucosamine mutase
 gi|91684833|gb|ABE41135.1| phosphoglucosamine mutase [Rhodopseudomonas palustris BisB5]
          Length = 450

 Score =  535 bits (1379), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 257/429 (59%), Positives = 333/429 (77%), Gaps = 3/429 (0%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLF-RGKKKHRRVVIGKDTRLSGYMLE 59
           M RR+FGTDGIRG++N   ITP   +++G A G +F RG  +HR VVIGKDTRLSGYM+E
Sbjct: 1   MSRRYFGTDGIRGRANGL-ITPELALKVGQAAGLVFQRGDHRHR-VVIGKDTRLSGYMIE 58

Query: 60  NSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGY 119
           N++VAGFT+ GMD  ++GP+P+PAVAMLT+S+RAD+GVMISASHN ++DNGIKLFGP G+
Sbjct: 59  NAMVAGFTSVGMDVLLVGPMPTPAVAMLTKSMRADLGVMISASHNMFEDNGIKLFGPLGF 118

Query: 120 KVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRI 179
           K+S D+E +IE LL++ L   L+   S+G A+R+DGVHDRYIE  KRTLPRD++L GLR+
Sbjct: 119 KLSDDVEKQIELLLDESLDKKLAASASLGRARRIDGVHDRYIEFAKRTLPRDLSLDGLRV 178

Query: 180 VVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIG 239
           VVDCANGA+YKV PE  WELGADV+ IG +P+G NIN +CGST   +L RKV E+RADIG
Sbjct: 179 VVDCANGAAYKVVPEALWELGADVISIGVEPDGFNINKECGSTAPEALCRKVREMRADIG 238

Query: 240 IALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAG 299
           IALDGD DRVI+VDE+G +V+GDQ++A+IA+ W     L   G+V TVMSN+GLERF+A 
Sbjct: 239 IALDGDADRVIMVDERGHVVDGDQLLAVIAQSWKEDGRLAKPGVVATVMSNLGLERFLAA 298

Query: 300 LGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYD 359
            G+ L RT VGDRY++E M   G+NVGGE SGHIILSDY +TGDG VAALQVL  +++  
Sbjct: 299 EGIDLVRTSVGDRYVLEQMMKGGYNVGGEASGHIILSDYNTTGDGFVAALQVLAVVQKLR 358

Query: 360 KPVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESL 419
           +PVS +CH F+  PQ L++V  ++   L+ + +  AI   E+ L G  RL++RASGTE +
Sbjct: 359 RPVSEVCHRFDPLPQILKNVRYRNGRPLDDAGVQSAIHAGETRLNGHGRLLIRASGTEPV 418

Query: 420 IRIMAEGDD 428
           IR+M EG+D
Sbjct: 419 IRVMGEGED 427


>gi|323138987|ref|ZP_08074047.1| phosphoglucosamine mutase [Methylocystis sp. ATCC 49242]
 gi|322395741|gb|EFX98282.1| phosphoglucosamine mutase [Methylocystis sp. ATCC 49242]
          Length = 448

 Score =  535 bits (1378), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 258/444 (58%), Positives = 337/444 (75%), Gaps = 4/444 (0%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLF-RGKKKHRRVVIGKDTRLSGYMLE 59
           M R +FGTDGIRG +N   ITP   +++G A G +F RG+ +HR VVIGKDTRLSGYM+E
Sbjct: 1   MTRTYFGTDGIRGLANV-KITPELALKVGQAAGLIFHRGEGRHR-VVIGKDTRLSGYMIE 58

Query: 60  NSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGY 119
            +LVAGFT+ GMD  +LGP+P+PAVAMLTRS+RADVGVMISASHN Y+DNGIKLFGPDG+
Sbjct: 59  YALVAGFTSVGMDPLLLGPMPTPAVAMLTRSMRADVGVMISASHNSYEDNGIKLFGPDGH 118

Query: 120 KVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRI 179
           K+S  IE  IE L++ DLT  L+    +G A+R+D V  RYIE  KRTLPR+++ +GLR+
Sbjct: 119 KLSDSIEMEIEKLIDGDLTRKLAGPTELGRARRIDDVRARYIEFAKRTLPRNMSFEGLRV 178

Query: 180 VVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIG 239
           V+DCANGA+YKVAPE  WELGA+V+ IG +P+G NIN D GST+  +L+ KV E+RAD+G
Sbjct: 179 VIDCANGAAYKVAPEALWELGAEVIAIGVEPDGFNINRDVGSTSPQALREKVRELRADVG 238

Query: 240 IALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAG 299
           IALDGD DRVI+VDE+G +++GDQ+MA++A  W    LL   G+V T+MSN+GLER ++ 
Sbjct: 239 IALDGDADRVIMVDERGQVIDGDQLMAVVAESWRDQGLLAKPGLVATIMSNLGLERHLSS 298

Query: 300 LGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYD 359
           LGL+L+RT VGDRY++E M+  G+NVGGEQSGH+ILSD+ +TGDGLV A+QVL  +K+  
Sbjct: 299 LGLTLERTAVGDRYVIERMRQAGYNVGGEQSGHVILSDFSTTGDGLVTAMQVLAEVKRQQ 358

Query: 360 KPVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESL 419
           + VS +CHCFE  PQ L++V  +  + L   S+V AI  A   L G  RLIVRASGTE +
Sbjct: 359 RRVSDVCHCFEPLPQVLKNVRAQKRT-LEKDSVVMAIDSARERLNGSGRLIVRASGTEPV 417

Query: 420 IRIMAEGDDLSRIKRIVDDLAKVI 443
           IR+M EGDD   ++ +V  +   +
Sbjct: 418 IRVMGEGDDPDLVETLVSQVCNAL 441


>gi|92116692|ref|YP_576421.1| phosphoglucosamine mutase [Nitrobacter hamburgensis X14]
 gi|122418355|sp|Q1QP86|GLMM_NITHX RecName: Full=Phosphoglucosamine mutase
 gi|91799586|gb|ABE61961.1| phosphoglucosamine mutase [Nitrobacter hamburgensis X14]
          Length = 448

 Score =  532 bits (1370), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 258/444 (58%), Positives = 335/444 (75%), Gaps = 3/444 (0%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLF-RGKKKHRRVVIGKDTRLSGYMLE 59
           M R++FGTDGIRG++N   ITP   M++G A G +F RG+ +HR VVIGKDTRLSGYM+E
Sbjct: 1   MSRKYFGTDGIRGRANGL-ITPELAMKVGQAAGLVFQRGEYRHR-VVIGKDTRLSGYMIE 58

Query: 60  NSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGY 119
            +LVAGFT+ GMD  +LGP+P+PAVAMLT+S+RAD+GVMISASHN ++DNGIK+FGP G+
Sbjct: 59  YALVAGFTSVGMDVLLLGPMPTPAVAMLTKSMRADLGVMISASHNLFEDNGIKMFGPRGF 118

Query: 120 KVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRI 179
           K+S  +E +IE LL+++L   L+    +G A+R+DGVHDRYIE  KRTLPR+++L GLR+
Sbjct: 119 KLSDAVEKQIEQLLDENLDKKLAQSTGLGRARRIDGVHDRYIEFAKRTLPRELSLDGLRV 178

Query: 180 VVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIG 239
           VVDCANGA+Y+V PE  WELGADVV I  +P+G NIN +CGST   +L RKV E+RADIG
Sbjct: 179 VVDCANGAAYRVVPEALWELGADVVPISVEPDGFNINKECGSTAPEALCRKVREMRADIG 238

Query: 240 IALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAG 299
           IALDGD DRVIIVDE+G +V+GDQ++A+IA  W     L   GIV TVMSN+GLERF+ G
Sbjct: 239 IALDGDADRVIIVDERGHVVDGDQLLAVIAESWKEDGRLTKPGIVATVMSNLGLERFLEG 298

Query: 300 LGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYD 359
             LSL RT VGDRY++E M   G+N+GGEQSGHIILSDY +TGDG V+ALQVL  +++  
Sbjct: 299 QELSLVRTPVGDRYVLEQMLKQGYNLGGEQSGHIILSDYATTGDGFVSALQVLAVVQKLG 358

Query: 360 KPVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESL 419
           +PVS +CH FE  PQ L++   +    L+ + +  AI   E  L G  RL+VR+SGTE +
Sbjct: 359 RPVSEVCHKFEPLPQILKNYRYRSGKPLDRAEVKSAITAGEKRLNGHGRLLVRSSGTEPV 418

Query: 420 IRIMAEGDDLSRIKRIVDDLAKVI 443
           IR+M EGDD   ++ +VD +   +
Sbjct: 419 IRVMGEGDDRILVEDVVDTIVSAL 442


>gi|296446364|ref|ZP_06888309.1| phosphoglucosamine mutase [Methylosinus trichosporium OB3b]
 gi|296256137|gb|EFH03219.1| phosphoglucosamine mutase [Methylosinus trichosporium OB3b]
          Length = 449

 Score =  529 bits (1362), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 253/445 (56%), Positives = 331/445 (74%), Gaps = 4/445 (0%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFR--GKKKHRRVVIGKDTRLSGYML 58
           M R +FGTDGIRG++N   ITP   M++G A G +F   G+++HR VVIGKDTRLSGYM+
Sbjct: 1   MTRSYFGTDGIRGRANQ-KITPELAMKVGQAAGLIFNRDGERRHR-VVIGKDTRLSGYMI 58

Query: 59  ENSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDG 118
           E +LVAGFT+ GMD  +LGP+P+PAVAMLTRS+RAD+GVMISASHN Y+DNGIKLFGPD 
Sbjct: 59  EYALVAGFTSVGMDVLLLGPMPTPAVAMLTRSMRADLGVMISASHNLYEDNGIKLFGPDA 118

Query: 119 YKVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLR 178
           YK+S + E  IE L+E DLTS L+    +G AKR++ V  RYIE+ KRTLPR+++ +GLR
Sbjct: 119 YKLSDETELEIEKLIERDLTSRLAGPQELGRAKRIEDVRARYIEYAKRTLPRNMSFEGLR 178

Query: 179 IVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADI 238
           +V+DCANGA+YKVAPE  WELGA+V+ IGD P+G NIN   GST    L+ KV E+RAD+
Sbjct: 179 VVLDCANGAAYKVAPEALWELGAEVITIGDAPDGFNINRAVGSTAPQKLKEKVRELRADV 238

Query: 239 GIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIA 298
           GIALDGD DRVI+VDE G +V+GDQ+MA++AR W     L   G+V T+MSN+GLER++ 
Sbjct: 239 GIALDGDADRVIMVDELGHVVDGDQLMAVVARSWRDEGWLAKPGVVATIMSNLGLERYLG 298

Query: 299 GLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQY 358
            LGL+L+RT VGDRY++E M+  G+NVGGEQSGH+ILSDY +TGDGLV A+Q L  +K+ 
Sbjct: 299 SLGLTLERTAVGDRYVIERMRERGYNVGGEQSGHVILSDYSTTGDGLVTAMQALAAVKKL 358

Query: 359 DKPVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTES 418
            + VS +C  FE  PQ L++V V     L   ++V+AI      L G  RL++R SGTE 
Sbjct: 359 GRRVSEVCRVFEPLPQVLKNVRVSGRLALEQDAVVRAIEAGRQRLDGAGRLVIRPSGTEP 418

Query: 419 LIRIMAEGDDLSRIKRIVDDLAKVI 443
           +IR+M EG++   +  +VDD+   +
Sbjct: 419 VIRVMGEGENPDLVTSVVDDICDAL 443


>gi|217976963|ref|YP_002361110.1| phosphoglucosamine mutase [Methylocella silvestris BL2]
 gi|254798586|sp|B8ER03|GLMM_METSB RecName: Full=Phosphoglucosamine mutase
 gi|217502339|gb|ACK49748.1| phosphoglucosamine mutase [Methylocella silvestris BL2]
          Length = 449

 Score =  528 bits (1360), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 260/444 (58%), Positives = 335/444 (75%), Gaps = 3/444 (0%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLF-RGKKKHRRVVIGKDTRLSGYMLE 59
           M R+ FGTDGIRG++N+  ITP   M++  A G LF RG+ +HR  VIGKDTRLS YM+E
Sbjct: 1   MPRKHFGTDGIRGQANSV-ITPELAMKVAQATGVLFQRGEHRHR-AVIGKDTRLSSYMIE 58

Query: 60  NSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGY 119
            ++VAGF + G+DA +LGP+P+PAVAMLT S+RADVGVMISASHN Y+DNGIKLFGPDG+
Sbjct: 59  YAMVAGFASVGVDALLLGPMPTPAVAMLTHSMRADVGVMISASHNSYEDNGIKLFGPDGF 118

Query: 120 KVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRI 179
           K+S ++E +IET+L+      LS    +G A RV+G   RYIE  KRTL R ++L+GLRI
Sbjct: 119 KLSDEVETKIETMLDAGFALKLSKPADLGRAMRVEGDRARYIEFAKRTLTRSLSLEGLRI 178

Query: 180 VVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIG 239
           VVDCANGA+YKVAPE  WELGA+V+ IG +P+G NIN   GST+  +L +KV E+RADIG
Sbjct: 179 VVDCANGAAYKVAPEALWELGAEVISIGVEPDGFNINRGVGSTSPQALVKKVREMRADIG 238

Query: 240 IALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAG 299
           IALDGD DRV+IVDE G IV+GDQ+MA+IA  W     L   GIV TVMSN+GLER++  
Sbjct: 239 IALDGDADRVLIVDETGKIVDGDQLMAVIAASWKEDGRLSRPGIVATVMSNLGLERYLES 298

Query: 300 LGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYD 359
           +GL+L RT VGDRY++E+M++ G+N+GGEQSGHIILSD+ +TGDGLVAALQ+L  +K+ +
Sbjct: 299 IGLTLARTAVGDRYVLEHMRSEGYNLGGEQSGHIILSDFCTTGDGLVAALQLLAVVKRLE 358

Query: 360 KPVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESL 419
           KPVS +C  FE  PQ LRSV V     L  +S+ +AI  A   L    RL++RASGTE +
Sbjct: 359 KPVSQVCRRFEPSPQVLRSVRVAAGKPLEDASVARAIDLARKRLAASGRLVIRASGTEPV 418

Query: 420 IRIMAEGDDLSRIKRIVDDLAKVI 443
           IR+M EGDDL  ++ IV++L  ++
Sbjct: 419 IRVMGEGDDLDLVESIVNELCDIV 442


>gi|300023917|ref|YP_003756528.1| phosphoglucosamine mutase [Hyphomicrobium denitrificans ATCC 51888]
 gi|299525738|gb|ADJ24207.1| phosphoglucosamine mutase [Hyphomicrobium denitrificans ATCC 51888]
          Length = 449

 Score =  526 bits (1356), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 254/439 (57%), Positives = 326/439 (74%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M RR+FGTDGIRG++N  P+T    +++G+A G +FR      RVVIGKDTRLSGYMLE 
Sbjct: 1   MSRRYFGTDGIRGQANRHPMTSEIALKVGMAAGTMFRSGNHRHRVVIGKDTRLSGYMLEA 60

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +L++GFT+ GMD F+LGP+P+PAVAMLTRSLRAD+GVM+SASHNP  DNGIKLF  DGYK
Sbjct: 61  ALMSGFTSVGMDVFLLGPMPTPAVAMLTRSLRADLGVMLSASHNPSSDNGIKLFDADGYK 120

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +S ++E +IE L++ D  + L+  + IG A RV+   +RYIE  KRT+P+ + L GLRIV
Sbjct: 121 LSDEMERQIEDLIDTDSKTLLAPAEQIGRATRVESAQERYIEFAKRTMPKHLRLAGLRIV 180

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           +DCANGA+YKVAPE  WELGA+V+ IG +PNG NINL+CGST    L  KV E RADIGI
Sbjct: 181 IDCANGAAYKVAPEALWELGAEVIKIGVEPNGQNINLNCGSTAPDLLVEKVKEFRADIGI 240

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
            LDGD DRV+IVDEKG IVNGDQ+MA+IA  W     L   GIV TVMSN+GLER++  +
Sbjct: 241 GLDGDADRVVIVDEKGRIVNGDQLMAVIADSWQRSGQLTAGGIVATVMSNLGLERYLKSI 300

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           GL++ RT VGDRY+ E+M+ +GFNVGGEQSGHI+LSD+ +TGDGLV+ALQ+L  +    K
Sbjct: 301 GLTMARTPVGDRYVTEHMRKHGFNVGGEQSGHIVLSDFTTTGDGLVSALQILACVVATGK 360

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
            VS +C  F   PQ LR+V       L+ + +V+AI  A+++L    RL++R SGTE +I
Sbjct: 361 TVSEVCDRFHPLPQILRNVRYASGKPLDDNRVVKAIEGAKAKLGENGRLVIRPSGTEPVI 420

Query: 421 RIMAEGDDLSRIKRIVDDL 439
           R+MAEGDD   +  IV D+
Sbjct: 421 RVMAEGDDEQVVSSIVGDI 439


>gi|182680530|ref|YP_001834676.1| phosphoglucosamine mutase [Beijerinckia indica subsp. indica ATCC
           9039]
 gi|226722712|sp|B2IGB3|GLMM_BEII9 RecName: Full=Phosphoglucosamine mutase
 gi|182636413|gb|ACB97187.1| phosphoglucosamine mutase [Beijerinckia indica subsp. indica ATCC
           9039]
          Length = 451

 Score =  525 bits (1353), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 256/444 (57%), Positives = 330/444 (74%), Gaps = 3/444 (0%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLF-RGKKKHRRVVIGKDTRLSGYMLE 59
           M R+ FGTDGIRG++N   ITP   M++  A G LF RG+++HR  VIGKDTRLSGYM+E
Sbjct: 1   MARKHFGTDGIRGRANA-AITPELAMKVAQATGVLFQRGEQRHR-AVIGKDTRLSGYMIE 58

Query: 60  NSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGY 119
            ++VAGFT+ GMD  +LGP+P+PAVAMLT S+RADVGVMISASHNPY+DNGIKLFGPDG+
Sbjct: 59  YAMVAGFTSVGMDVLLLGPMPTPAVAMLTPSMRADVGVMISASHNPYEDNGIKLFGPDGF 118

Query: 120 KVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRI 179
           K+S ++E  IE  L+ D+   LS    +G AKRV+G   RYIE  KRTL R ++L+GLRI
Sbjct: 119 KLSDEMEAEIEAKLDRDVALKLSKPADLGRAKRVEGAQARYIEFTKRTLTRSLSLEGLRI 178

Query: 180 VVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIG 239
           V+DCANGA YKVAPE  WELGA+V  IG +P+G NIN D GST   +L +KVHEVRADIG
Sbjct: 179 VIDCANGAGYKVAPEALWELGAEVFAIGTEPDGFNINRDVGSTAPAALVKKVHEVRADIG 238

Query: 240 IALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAG 299
           IALDGD DRVIIVDE G +++GDQ+MA IA  W     L   GIV T+MSN+GLER++  
Sbjct: 239 IALDGDADRVIIVDENGKVIDGDQLMAAIAAGWQEEGRLARPGIVATLMSNLGLERYLES 298

Query: 300 LGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYD 359
           +GL+L RT VGDR+++E+M+ +G+N+GGEQSGHIILSDY +TGDGLVAALQVL  +K+  
Sbjct: 299 IGLTLARTAVGDRHVLEHMRAHGYNLGGEQSGHIILSDYCTTGDGLVAALQVLALVKRLG 358

Query: 360 KPVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESL 419
           KPVS +C  F+  PQ L++V V     L    + + I +   +L    RL++R SGTE +
Sbjct: 359 KPVSQVCRRFDPVPQILKNVRVNAAQSLEQDHVKRVIEEGHRKLGKNGRLVIRPSGTEPV 418

Query: 420 IRIMAEGDDLSRIKRIVDDLAKVI 443
           +R+M EGD+   ++ IVDD+ + +
Sbjct: 419 VRVMGEGDNRDLVETIVDDICEAL 442


>gi|254698008|ref|ZP_05159836.1| Phosphoglucosamine mutase [Brucella abortus bv. 2 str. 86/8/59]
          Length = 415

 Score =  525 bits (1352), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 245/407 (60%), Positives = 319/407 (78%)

Query: 37  RGKKKHRRVVIGKDTRLSGYMLENSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVG 96
           R K +  R V+GKDTR SGYMLE +LVAGFTAAGMD F+LGPIP+PAVAML RSLRAD+G
Sbjct: 1   RRKGQASRAVVGKDTRRSGYMLEKALVAGFTAAGMDVFLLGPIPTPAVAMLCRSLRADIG 60

Query: 97  VMISASHNPYQDNGIKLFGPDGYKVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGV 156
           VMISASHNP+ DNGIKLFGPDG+K+S  IE +IE ++E D+T +L+ +  +G AKRVDG 
Sbjct: 61  VMISASHNPFYDNGIKLFGPDGFKLSDQIELQIEAMIEGDMTPFLASHGDVGRAKRVDGD 120

Query: 157 HDRYIEHVKRTLPRDVTLQGLRIVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININ 216
             RYIE  KRTLPR+++L GLR+VVDCANGA YKVAP   WELGA+V+ I ++PNGININ
Sbjct: 121 IYRYIEFAKRTLPRNISLNGLRVVVDCANGAGYKVAPAALWELGAEVITINNEPNGININ 180

Query: 217 LDCGSTNVLSLQRKVHEVRADIGIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHS 276
            DCGST+ + L +KVHEVRAD+GIALDGD DRV++VDE G +++GDQ+MA+IA  W + +
Sbjct: 181 EDCGSTHPIGLMKKVHEVRADVGIALDGDADRVLLVDENGTVIDGDQLMAVIAESWAASN 240

Query: 277 LLRGNGIVTTVMSNIGLERFIAGLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILS 336
            L G GIV TVMSN+GLERF+A   L+L RT+VGDRY++E+M+ +GFNVGGEQSGHI+LS
Sbjct: 241 RLEGGGIVATVMSNLGLERFLADRNLTLARTKVGDRYVVEHMREHGFNVGGEQSGHIVLS 300

Query: 337 DYGSTGDGLVAALQVLRYIKQYDKPVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAI 396
           D+ +TGDGL++ALQ+L   ++ +KP+S +C  F+  PQ L++V       L +  +  AI
Sbjct: 301 DFATTGDGLISALQILAVAQEQNKPISDVCRKFQPVPQLLKNVRTTGGKPLENKRVKSAI 360

Query: 397 ADAESELRGIDRLIVRASGTESLIRIMAEGDDLSRIKRIVDDLAKVI 443
            +A+  L G  RL++R SGTE LIR+MAEGDD   ++++V+D+  VI
Sbjct: 361 DEAKERLGGQGRLVIRPSGTEPLIRVMAEGDDRGLVEKVVNDIIDVI 407


>gi|307294542|ref|ZP_07574384.1| phosphoglucosamine mutase [Sphingobium chlorophenolicum L-1]
 gi|306879016|gb|EFN10234.1| phosphoglucosamine mutase [Sphingobium chlorophenolicum L-1]
          Length = 446

 Score =  523 bits (1348), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 263/446 (58%), Positives = 327/446 (73%), Gaps = 8/446 (1%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLF-RGKKKHRRVVIGKDTRLSGYMLE 59
           M R++FGTDGIRG++N +P+T    M++G+A G  F RG  +HR VVIGKDTRLSGYM+E
Sbjct: 1   MSRKYFGTDGIRGRTNQWPMTAELAMKVGMAAGKHFQRGTHRHR-VVIGKDTRLSGYMVE 59

Query: 60  NSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGY 119
           N+LVAGFTA GMD    GPIP+PAVA+L  S+RAD+GVMISASHNPY DNGIKLFGPDGY
Sbjct: 60  NALVAGFTAVGMDVVQFGPIPTPAVALLAHSMRADLGVMISASHNPYFDNGIKLFGPDGY 119

Query: 120 KVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRI 179
           K+S + E +IE +LE D+   L+    IG A+RV+    RYI  VK + P D+ L GL+I
Sbjct: 120 KLSDEDEMKIEAMLEQDIP--LAASQDIGRARRVEDARGRYIHAVKSSFPADLRLDGLKI 177

Query: 180 VVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIG 239
           VVDCANGA+Y+VAP   WELGA+VV IG  PNGININ  CGST+   LQ  V    ADIG
Sbjct: 178 VVDCANGAAYQVAPSALWELGAEVVAIGVTPNGININDRCGSTSPQLLQESVVSAGADIG 237

Query: 240 IALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAG 299
           IALDGD DR+I+VDE GAIV+GDQIMALIA  +     LRG G+V TVMSN+GLERF++G
Sbjct: 238 IALDGDADRLIVVDEHGAIVDGDQIMALIAGNFAKAGTLRGGGLVATVMSNLGLERFLSG 297

Query: 300 LGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYD 359
            G++L+RT+VGDRY++E M+  GFNVGGEQSGH+ILSDY +TGDG VAALQVL  + +  
Sbjct: 298 QGMALERTKVGDRYVLERMREGGFNVGGEQSGHMILSDYATTGDGTVAALQVLAALVRSG 357

Query: 360 KPVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESL 419
           KP S + H F+  PQ L++V       L    + + IA AE+EL G  RL++R SGTE +
Sbjct: 358 KPASEVLHQFDPVPQLLKNVRFSGGKPLEHEDVKRVIAQAEAELNGSGRLVIRPSGTEPV 417

Query: 420 IRIMAEGDDLSRIK----RIVDDLAK 441
           IR+MAEGD   ++K    RI D +AK
Sbjct: 418 IRVMAEGDREDQVKDVVERICDAVAK 443


>gi|326389131|ref|ZP_08210711.1| phosphoglucosamine mutase [Novosphingobium nitrogenifigens DSM
           19370]
 gi|326206362|gb|EGD57199.1| phosphoglucosamine mutase [Novosphingobium nitrogenifigens DSM
           19370]
          Length = 445

 Score =  523 bits (1348), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 254/444 (57%), Positives = 331/444 (74%), Gaps = 4/444 (0%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVG-YLFRGKKKHRRVVIGKDTRLSGYMLE 59
           M R++FGTDGIRG++N   +T    M++G A G Y  RG+ +HR VVIGKDTRLSGYMLE
Sbjct: 1   MGRKYFGTDGIRGRTNAGVMTAATAMKVGQAAGTYFQRGEHRHR-VVIGKDTRLSGYMLE 59

Query: 60  NSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGY 119
           N++ AGFT+ GMD  +LGP+P+PAVAMLTR +RADVGVMISASHNP++DNGIKLFGPDG+
Sbjct: 60  NAMTAGFTSVGMDVVLLGPMPTPAVAMLTREMRADVGVMISASHNPFEDNGIKLFGPDGF 119

Query: 120 KVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRI 179
           K+S + E  IE +LE+DL   L+  D++G A+R++    RYI  +K +LP DV L GLRI
Sbjct: 120 KLSDEDELAIEAMLEEDLP--LAAADAVGRARRIEDARGRYIHAIKASLPHDVRLDGLRI 177

Query: 180 VVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIG 239
           V+DCANGA+Y+VAP   WELGA+V+ IG +PNG NINL  GST++ +++ KV EVRADIG
Sbjct: 178 VLDCANGAAYQVAPSALWELGAEVIAIGVEPNGKNINLGVGSTHLDAIKDKVREVRADIG 237

Query: 240 IALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAG 299
           IALDGD DR+I+VDEKG  V+GDQIMALI     +   LRG G+V TVMSN+GLERF+  
Sbjct: 238 IALDGDADRLIVVDEKGHTVDGDQIMALIGSRLAAQGQLRGGGVVATVMSNLGLERFLNA 297

Query: 300 LGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYD 359
            GL L R  VGDR+++E M+  G+NVGGEQSGH+IL+D+G+TGDG VAALQVL  +    
Sbjct: 298 RGLELVRAAVGDRHVLEKMRAGGYNVGGEQSGHMILTDHGTTGDGTVAALQVLAALVSSG 357

Query: 360 KPVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESL 419
           KP S + H F+  PQ LR+V       L + ++ + IA+AESEL G  RL++R SGTE +
Sbjct: 358 KPASEVLHLFDPVPQLLRNVRFTGGKPLENETVREVIAEAESELAGKGRLVIRPSGTEPV 417

Query: 420 IRIMAEGDDLSRIKRIVDDLAKVI 443
           IR+MAEGDD  ++  +V+ +   +
Sbjct: 418 IRVMAEGDDAEQVAEVVERICAAV 441


>gi|294012732|ref|YP_003546192.1| phosphoglucosamine mutase [Sphingobium japonicum UT26S]
 gi|292676062|dbj|BAI97580.1| phosphoglucosamine mutase [Sphingobium japonicum UT26S]
          Length = 446

 Score =  522 bits (1344), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 263/446 (58%), Positives = 326/446 (73%), Gaps = 8/446 (1%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLF-RGKKKHRRVVIGKDTRLSGYMLE 59
           M R +FGTDGIRG++N +P+T    M++G+A G  F RG  +HR VVIGKDTRLSGYM+E
Sbjct: 1   MSRTYFGTDGIRGRTNQWPMTAELAMKVGMAAGKHFKRGTHRHR-VVIGKDTRLSGYMVE 59

Query: 60  NSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGY 119
           N+LVAGFTA GMD    GPIP+PAVA+L  S+RAD+GVMISASHNPY DNGIKLFGPDGY
Sbjct: 60  NALVAGFTAVGMDVVQFGPIPTPAVALLAHSMRADLGVMISASHNPYFDNGIKLFGPDGY 119

Query: 120 KVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRI 179
           K+S + E +IE +LE ++   L+    IG A+RV+    RYI  VK + P D+ L GL+I
Sbjct: 120 KLSDEDEMKIEAMLEQEIP--LAASQDIGRARRVEDARGRYIHAVKSSFPADLRLDGLKI 177

Query: 180 VVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIG 239
           VVDCANGA+Y+VAP  FWELGA+VV IG  PNGININ  CGST    LQ  V    ADIG
Sbjct: 178 VVDCANGAAYQVAPSAFWELGAEVVAIGVTPNGININDRCGSTAPQLLQESVVSAGADIG 237

Query: 240 IALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAG 299
           IALDGD DR+I+VDE GAIV+GDQIMALIA  +     LRG G+V TVMSN+GLERF++G
Sbjct: 238 IALDGDADRLIVVDEHGAIVDGDQIMALIAGNFARAGTLRGGGLVATVMSNLGLERFLSG 297

Query: 300 LGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYD 359
            G++L+RT+VGDRY++E M+  GFNVGGEQSGH+ILSDY +TGDG VAALQVL  + +  
Sbjct: 298 QGMALERTKVGDRYVLERMREGGFNVGGEQSGHMILSDYATTGDGTVAALQVLAALVRSG 357

Query: 360 KPVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESL 419
           KP S + H F+  PQ L++V       L    + + IA AE+EL G  RL++R SGTE +
Sbjct: 358 KPASEVLHQFDPVPQLLKNVRFSGGKPLEHEDVKRVIAQAEAELNGSGRLVIRPSGTEPV 417

Query: 420 IRIMAEGDDLSRIK----RIVDDLAK 441
           IR+MAEGD   ++K    RI D +AK
Sbjct: 418 IRVMAEGDREDQVKDVVERICDAVAK 443


>gi|260762443|ref|ZP_05874780.1| phosphoglucosamine mutase [Brucella abortus bv. 2 str. 86/8/59]
 gi|260672869|gb|EEX59690.1| phosphoglucosamine mutase [Brucella abortus bv. 2 str. 86/8/59]
          Length = 406

 Score =  519 bits (1337), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 241/398 (60%), Positives = 315/398 (79%)

Query: 46  VIGKDTRLSGYMLENSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNP 105
           ++GKDTR SGYMLE +LVAGFTAAGMD F+LGPIP+PAVAML RSLRAD+GVMISASHNP
Sbjct: 1   MVGKDTRRSGYMLEKALVAGFTAAGMDVFLLGPIPTPAVAMLCRSLRADIGVMISASHNP 60

Query: 106 YQDNGIKLFGPDGYKVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVK 165
           + DNGIKLFGPDG+K+S  IE +IE ++E D+T +L+ +  +G AKRVDG   RYIE  K
Sbjct: 61  FYDNGIKLFGPDGFKLSDQIELQIEAMIEGDMTPFLASHGDVGRAKRVDGDIYRYIEFAK 120

Query: 166 RTLPRDVTLQGLRIVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVL 225
           RTLPR+++L GLR+VVDCANGA YKVAP   WELGA+V+ I ++PNGININ DCGST+ +
Sbjct: 121 RTLPRNISLNGLRVVVDCANGAGYKVAPAALWELGAEVITINNEPNGININEDCGSTHPI 180

Query: 226 SLQRKVHEVRADIGIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVT 285
            L +KVHEVRAD+GIALDGD DRV++VDE G +++GDQ+MA+IA  W + + L G GIV 
Sbjct: 181 GLMKKVHEVRADVGIALDGDADRVLLVDENGTVIDGDQLMAVIAESWAASNRLEGGGIVA 240

Query: 286 TVMSNIGLERFIAGLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGL 345
           TVMSN+GLERF+A   L+L RT+VGDRY++E+M+ +GFNVGGEQSGHI+LSD+ +TGDGL
Sbjct: 241 TVMSNLGLERFLADRNLTLARTKVGDRYVVEHMREHGFNVGGEQSGHIVLSDFATTGDGL 300

Query: 346 VAALQVLRYIKQYDKPVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRG 405
           ++ALQ+L   ++ +KP+S +C  F+  PQ L++V       L +  +  AI +A+  L G
Sbjct: 301 ISALQILAVAQEQNKPISDVCRKFQPVPQLLKNVRTTGGKPLENKRVKSAIDEAKERLGG 360

Query: 406 IDRLIVRASGTESLIRIMAEGDDLSRIKRIVDDLAKVI 443
             RL++R SGTE LIR+MAEGDD   ++++V+D+  VI
Sbjct: 361 QGRLVIRPSGTEPLIRVMAEGDDRGLVEKVVNDIIDVI 398


>gi|108755192|emb|CAK32584.1| phosphomannomutase [uncultured organism]
          Length = 448

 Score =  519 bits (1337), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 253/444 (56%), Positives = 326/444 (73%), Gaps = 2/444 (0%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLF-RGKKKHRRVVIGKDTRLSGYMLE 59
           M R+ FGTDGIRG +N  P+T    +R+G+A    F RG  +HR VVIGKDTRLSGY++E
Sbjct: 1   MTRKLFGTDGIRGTANREPMTAATALRVGMAAAAHFTRGNHRHR-VVIGKDTRLSGYLIE 59

Query: 60  NSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGY 119
            +L AGF + GMD  ++GP+P+PAVAMLTRSLRAD+GVMISASHNPY+DNG+KLFGPD Y
Sbjct: 60  PALTAGFVSMGMDVILVGPLPTPAVAMLTRSLRADLGVMISASHNPYEDNGLKLFGPDAY 119

Query: 120 KVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRI 179
           K+S ++E  IE  ++ D++  L     +G AKR+D    RY EHVK+T P+ + L GL++
Sbjct: 120 KLSDEVEAEIERRMDGDMSGGLVAPADLGRAKRLDDAQGRYTEHVKQTFPKGLRLDGLKV 179

Query: 180 VVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIG 239
           VVDCANGA+YKVAPE+ WELGADV+ IG +P+G NIN DCGST V ++   V    AD+G
Sbjct: 180 VVDCANGAAYKVAPEILWELGADVISIGVQPDGFNINKDCGSTCVETMCGHVAPNGADLG 239

Query: 240 IALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAG 299
           +ALDGD DRV+I DE GA+++GDQ+M L+A  W  +  L+G G+V TVMSN+GLER++ G
Sbjct: 240 LALDGDADRVLIADETGALIDGDQMMGLVAGHWAGNGQLKGGGVVATVMSNLGLERYLDG 299

Query: 300 LGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYD 359
           +GL L RT VGDRY++E+M+ +GFN+GGEQSGH+IL DY +TGDGL+AALQVL  I Q  
Sbjct: 300 IGLDLVRTPVGDRYVVEHMRRHGFNLGGEQSGHLILGDYSTTGDGLIAALQVLAVIVQRR 359

Query: 360 KPVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESL 419
           +P S +C  FE  PQ LR+VS      L   S+  AIA AE  L    RL+VR SGTE +
Sbjct: 360 RPASEVCRVFEALPQRLRNVSFNGGRPLEHDSVKAAIAAAEKRLGKTGRLLVRRSGTEPV 419

Query: 420 IRIMAEGDDLSRIKRIVDDLAKVI 443
           IR+MAEG+D   I  +VDD+A VI
Sbjct: 420 IRVMAEGEDEDLIGAVVDDIAGVI 443


>gi|16124372|ref|NP_418936.1| phosphoglucomutase/phosphomannomutase family protein [Caulobacter
           crescentus CB15]
 gi|221233055|ref|YP_002515491.1| phosphoglucosamine mutase [Caulobacter crescentus NA1000]
 gi|81621311|sp|Q9ABV3|GLMM_CAUCR RecName: Full=Phosphoglucosamine mutase
 gi|254798569|sp|B8GXK7|GLMM_CAUCN RecName: Full=Phosphoglucosamine mutase
 gi|13421224|gb|AAK22104.1| phosphoglucomutase/phosphomannomutase family protein [Caulobacter
           crescentus CB15]
 gi|220962227|gb|ACL93583.1| phosphoglucosamine mutase [Caulobacter crescentus NA1000]
          Length = 448

 Score =  518 bits (1335), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 248/443 (55%), Positives = 327/443 (73%), Gaps = 1/443 (0%)

Query: 2   KRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRR-VVIGKDTRLSGYMLEN 60
           KR +FGTDGIRG++N  P+T    +R+G+A G LFR + + R  VVIGKDTRLSGYM+E 
Sbjct: 3   KRAYFGTDGIRGQANKHPMTAEVALRVGLAAGKLFRSQDERRHLVVIGKDTRLSGYMIEP 62

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +LVAG T+ G+D  + GP+P+PAVAM+TRS+RAD+G+MISASHN + DNGIKLFGPDGYK
Sbjct: 63  ALVAGLTSVGLDVRLFGPLPTPAVAMMTRSMRADLGIMISASHNSFADNGIKLFGPDGYK 122

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +S   E  IE L++  L   L+    +G  KR+D    RY+E VK T PR + L GLRIV
Sbjct: 123 LSDAQELGIEALMDQGLQEGLAAPRELGRVKRIDDAQARYVEIVKATFPRHLNLSGLRIV 182

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           +DCANGA+YKVAP   +ELGA+V+ +G  P+G NIN +CGST+  ++ + V E RADIGI
Sbjct: 183 IDCANGAAYKVAPTALYELGAEVITLGVSPDGTNINEECGSTHPEAMAKMVREYRADIGI 242

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           ALDGD DR++I DEKG +V+GDQIMA+IA        L+G G+V TVMSN+GLER +  +
Sbjct: 243 ALDGDADRLVICDEKGVVVDGDQIMAIIAAASHKAGTLKGGGVVATVMSNLGLERQLNTM 302

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           GLSL+RT VGDRY+M+ M+  GFNVGGEQSGH+ILSD+ +TGDGL+AALQVL  + + DK
Sbjct: 303 GLSLERTAVGDRYVMQRMREGGFNVGGEQSGHLILSDFSTTGDGLIAALQVLAVMVETDK 362

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
           P+S +   FE  PQ L +V       L ++++ +AIAD E++L G  R++VRASGTE LI
Sbjct: 363 PMSALGRQFEPVPQLLENVRFVGGKPLEAAAVKEAIADGEAQLNGAGRIVVRASGTEPLI 422

Query: 421 RIMAEGDDLSRIKRIVDDLAKVI 443
           RIMAEGDD + +K++V  +A  +
Sbjct: 423 RIMAEGDDPALVKKVVKSIASAV 445


>gi|254419315|ref|ZP_05033039.1| phosphoglucosamine mutase [Brevundimonas sp. BAL3]
 gi|196185492|gb|EDX80468.1| phosphoglucosamine mutase [Brevundimonas sp. BAL3]
          Length = 449

 Score =  518 bits (1333), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 252/442 (57%), Positives = 322/442 (72%), Gaps = 1/442 (0%)

Query: 3   RRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFR-GKKKHRRVVIGKDTRLSGYMLENS 61
           R++FGTDGIRG++NT+P+T    +R+G+A G LFR G  +   VVIGKDTRLSGY +E +
Sbjct: 4   RKYFGTDGIRGRANTYPMTAEVALRVGLAAGKLFRTGDDRRHLVVIGKDTRLSGYTIEPA 63

Query: 62  LVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKV 121
           LVAGF + GMD    GP+P+P VAMLTRS+RAD+GVMISASHN Y DNGIKLFGPDGYK+
Sbjct: 64  LVAGFASVGMDVRTFGPVPTPGVAMLTRSMRADLGVMISASHNDYADNGIKLFGPDGYKL 123

Query: 122 STDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVV 181
           S +IE +IE L++D L   L+  + +G  KR+D    RYIE  K+  P+ +TLQGLRI V
Sbjct: 124 SDEIELKIEALMDDGLDQGLAPSNRLGRVKRIDDAQARYIEIAKQAFPKRLTLQGLRIAV 183

Query: 182 DCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIA 241
           DCANGA YKVAP   +ELGA+V  +G  PNG NIN +CGST+  +L   V   RADIGIA
Sbjct: 184 DCANGAGYKVAPTTLFELGAEVFPVGVTPNGTNINAECGSTHPATLVEAVKRYRADIGIA 243

Query: 242 LDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLG 301
           LDGD DR+II DEKG +V+GDQIMAL+  +W    LL G G+V TVMSN+GLER +   G
Sbjct: 244 LDGDADRLIICDEKGQVVDGDQIMALVGLDWARRGLLTGGGVVATVMSNLGLERRLKAEG 303

Query: 302 LSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKP 361
           L+L+RT+VGDRY+ME M+  GFN+GGEQSGHIIL D+ +TGDGL+AALQVL  +    KP
Sbjct: 304 LTLERTKVGDRYVMERMREGGFNIGGEQSGHIILHDHATTGDGLMAALQVLAVLVDSGKP 363

Query: 362 VSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLIR 421
           +S +   F+  PQ L +V       L S ++  AIA+AE+ L G  RL+VR SGTE LIR
Sbjct: 364 MSELARQFDPVPQRLENVRYTAGKPLESDTVKTAIAEAEATLNGQGRLLVRPSGTEKLIR 423

Query: 422 IMAEGDDLSRIKRIVDDLAKVI 443
           +MAEGDD + +KR+V +++  +
Sbjct: 424 VMAEGDDAALVKRVVSEVSAAV 445


>gi|197106423|ref|YP_002131800.1| phosphoglucomutase/phosphomannomutase family protein
           [Phenylobacterium zucineum HLK1]
 gi|226723903|sp|B4R906|GLMM_PHEZH RecName: Full=Phosphoglucosamine mutase
 gi|196479843|gb|ACG79371.1| phosphoglucomutase/phosphomannomutase family protein
           [Phenylobacterium zucineum HLK1]
          Length = 450

 Score =  517 bits (1331), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 247/446 (55%), Positives = 324/446 (72%), Gaps = 1/446 (0%)

Query: 2   KRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRR-VVIGKDTRLSGYMLEN 60
           KR +FGTDGIRG++N  P+T    +R+G+A G LF  K   R  VVIGKDTRLSGYM+E 
Sbjct: 3   KRAYFGTDGIRGQANRHPMTAEVALRVGMAAGKLFMSKDDRRHLVVIGKDTRLSGYMIEP 62

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +LVAGFT+ GMD  + GP+P+P VAM+TRSLRAD+GVMISASHN + DNGIKLFGPDGYK
Sbjct: 63  ALVAGFTSVGMDVRLFGPLPTPGVAMMTRSLRADLGVMISASHNHFADNGIKLFGPDGYK 122

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +S + E  IE L++  L   L+  D +G  +R+D    RY+E  K T P+ ++L G+RIV
Sbjct: 123 LSDEKELEIEALMDQGLQEGLATPDKLGRVQRIDDCQARYVEIAKATFPKGLSLAGMRIV 182

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           +DCANGA+YKVAPE  +ELGA+V+ +G +PNG NIN +CGST+  ++ R V E RADIGI
Sbjct: 183 IDCANGAAYKVAPETLYELGAEVIRVGVEPNGFNINEECGSTHPAAMSRLVKEYRADIGI 242

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           ALDGD DR++I DEKG +V+GDQIMALIA  W     L+G G+V TVMSN+GLERF+   
Sbjct: 243 ALDGDADRLVICDEKGQVVDGDQIMALIADSWAKAGRLQGGGVVATVMSNLGLERFLKAR 302

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
            L L+RT+VGDRY+M  M+  GFNVGGEQSGH+ILSD  +TGDGL+AALQVL  +++ D+
Sbjct: 303 NLKLERTQVGDRYVMARMREGGFNVGGEQSGHVILSDLSTTGDGLLAALQVLAVLQESDR 362

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
           P+S +   FE  PQ L +V       L   ++ +A+A+AE  L G  R++VRASGTE LI
Sbjct: 363 PMSALARQFEPVPQKLENVRFGSGKPLEHDAVKKALAEAEQRLNGSGRIVVRASGTEPLI 422

Query: 421 RIMAEGDDLSRIKRIVDDLAKVIPMI 446
           R+MAEGDD   + ++V ++   +  +
Sbjct: 423 RVMAEGDDEKLVSQVVKEIVGAVKKV 448


>gi|329847304|ref|ZP_08262332.1| phosphoglucosamine mutase [Asticcacaulis biprosthecum C19]
 gi|328842367|gb|EGF91936.1| phosphoglucosamine mutase [Asticcacaulis biprosthecum C19]
          Length = 447

 Score =  516 bits (1329), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 247/442 (55%), Positives = 331/442 (74%), Gaps = 1/442 (0%)

Query: 3   RRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRR-VVIGKDTRLSGYMLENS 61
           R++FGTDGIRG++NTFP+T     R+G+A G +F      R  VVIGKDTRLSGYM+E +
Sbjct: 4   RKYFGTDGIRGRANTFPMTAEVAYRVGMAAGKMFMSNADRRHLVVIGKDTRLSGYMIEPA 63

Query: 62  LVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKV 121
           LVAGFT+ GMD  + GP+P+P VA++TRS+RAD+GVMISASHN + DNGIKLFGPDGYK+
Sbjct: 64  LVAGFTSVGMDVRLFGPLPTPGVALMTRSMRADLGVMISASHNAFMDNGIKLFGPDGYKL 123

Query: 122 STDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVV 181
           S ++E  IE  ++ D+   ++    +G  +R+D    RYIE VK + PR +TL GLRIV+
Sbjct: 124 SDEVELEIEARMDGDILQGVAEPHKLGRVQRLDDAQARYIEIVKASFPRHLTLNGLRIVI 183

Query: 182 DCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIA 241
           DCA+GA+YKVAP   +ELGA+V+ IG  P+G+NIN  CGST+  ++  KV E+RAD+GIA
Sbjct: 184 DCAHGAAYKVAPLALYELGAEVICIGVSPDGLNINEKCGSTHTDAMAVKVKEMRADLGIA 243

Query: 242 LDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLG 301
           LDGD DRV+I DE G +V+GDQIMA++A       LL+G G+V TVMSN+GLERF+AG G
Sbjct: 244 LDGDADRVVICDENGKVVDGDQIMAIVAGHLADKGLLKGGGVVATVMSNLGLERFLAGKG 303

Query: 302 LSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKP 361
           L+L+RT+VGDRY+ME M+  GFN+GGEQSGH+IL+D+ +TGDGL+AALQVL  + +  KP
Sbjct: 304 LTLERTKVGDRYVMERMREGGFNLGGEQSGHVILTDHATTGDGLMAALQVLAVLVERGKP 363

Query: 362 VSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLIR 421
           +S + H F+  PQ L++V     S LNS ++ QAI + E  L+G  R++VR SGTE LIR
Sbjct: 364 MSKLGHQFDTVPQILKNVRFTGVSPLNSEAVKQAIREGEEMLKGSGRVLVRPSGTEPLIR 423

Query: 422 IMAEGDDLSRIKRIVDDLAKVI 443
           +MAEGDD  ++K  V+ +A+ I
Sbjct: 424 VMAEGDDEKQVKAAVNMIAEAI 445


>gi|148259828|ref|YP_001233955.1| phosphoglucosamine mutase [Acidiphilium cryptum JF-5]
 gi|326403244|ref|YP_004283325.1| phosphoglucosamine mutase [Acidiphilium multivorum AIU301]
 gi|172047766|sp|A5FWQ4|GLMM_ACICJ RecName: Full=Phosphoglucosamine mutase
 gi|146401509|gb|ABQ30036.1| phosphoglucosamine mutase [Acidiphilium cryptum JF-5]
 gi|325050105|dbj|BAJ80443.1| phosphoglucosamine mutase [Acidiphilium multivorum AIU301]
          Length = 456

 Score =  513 bits (1321), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 253/443 (57%), Positives = 330/443 (74%), Gaps = 2/443 (0%)

Query: 2   KRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLF-RGKKKHRRVVIGKDTRLSGYMLEN 60
           KRR FGTDGIRG++NT P+T    +R+G A G LF RG  +HR V+IGKDTRLSGYMLE 
Sbjct: 9   KRRLFGTDGIRGRANTAPMTAEIALRLGQAAGLLFTRGDHRHR-VIIGKDTRLSGYMLEP 67

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +L AGF  AGMD  + GP+P+PA+AMLTRSLRAD+GV+ISASHNP++DNGIKLFGPDG K
Sbjct: 68  ALTAGFIGAGMDVTLAGPLPTPAIAMLTRSLRADLGVVISASHNPFEDNGIKLFGPDGAK 127

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +S + E  IE L+E+DL+  L+   ++G A R+     RY+E  K +LPR + L GLR+V
Sbjct: 128 LSDETEAEIEALMEEDLSGRLAAPSALGRAMRLVDAAGRYVESAKSSLPRGLRLDGLRVV 187

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           +DCANGA+YKVAP   WELGA+V+ +G  P+G NIN +CGST   +L   V + RAD+GI
Sbjct: 188 LDCANGAAYKVAPAALWELGAEVITLGVSPDGFNINHECGSTVPSALSAAVVKHRADLGI 247

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           ALDGD DRVI+ DE+G I++GDQ++ALIAR + +   L G+GIV TVMSN+GLER++ GL
Sbjct: 248 ALDGDADRVILADERGRIIDGDQVLALIARAFQADGRLSGSGIVATVMSNLGLERYLGGL 307

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           GL+L RT VGDRY+ E+M+ +G N+GGEQSGH+IL+D+ +TGDGL+AALQVL  + +  +
Sbjct: 308 GLALHRTPVGDRYVAEHMRAHGLNLGGEQSGHVILADFATTGDGLIAALQVLAVLVREGR 367

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
           P S +C  F   PQ LR+V     S L S ++  A A AE+ L GI RL++RASGTE LI
Sbjct: 368 PASEVCRLFTPLPQLLRNVRYSGASPLLSPAVTAAAAAAEARLAGIGRLLLRASGTEPLI 427

Query: 421 RIMAEGDDLSRIKRIVDDLAKVI 443
           R+MAEG+D   +  +VD+L  VI
Sbjct: 428 RVMAEGEDEQLVAAVVDELCAVI 450


>gi|295687565|ref|YP_003591258.1| phosphoglucosamine mutase [Caulobacter segnis ATCC 21756]
 gi|295429468|gb|ADG08640.1| phosphoglucosamine mutase [Caulobacter segnis ATCC 21756]
          Length = 448

 Score =  513 bits (1320), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 247/443 (55%), Positives = 324/443 (73%), Gaps = 1/443 (0%)

Query: 2   KRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRR-VVIGKDTRLSGYMLEN 60
           KR +FGTDGIRG++N  P+T    +R+G+A G LFR +   R  VVIGKDTRLSGYM+E 
Sbjct: 3   KRAYFGTDGIRGQANKHPMTAEVALRVGLAAGKLFRSQDARRHLVVIGKDTRLSGYMIEP 62

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +LVAG T+ G+D  + GP+P+PAVAM+TRS+RAD+GVMISASHN + DNGIKLFGPDGYK
Sbjct: 63  ALVAGLTSVGLDVRLFGPLPTPAVAMMTRSMRADLGVMISASHNNFADNGIKLFGPDGYK 122

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +S + E +IE L+++ L   L+    +G  KR+D    RY+E VK T PR   L GLRIV
Sbjct: 123 LSDEQELKIEALMDEGLQEGLAAPRELGRVKRIDDAQARYVEIVKATFPRHRNLSGLRIV 182

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           +DCANGA+YKVAP   +ELGA+V+ +G  P+G NIN +CGST+  ++ + V E RADIGI
Sbjct: 183 IDCANGAAYKVAPTALYELGAEVISLGVSPDGTNINEECGSTHPETMAKMVREYRADIGI 242

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           ALDGD DR++I DEKG +V+GDQIMA+IA        L+G G+V TVMSN+GLER + G 
Sbjct: 243 ALDGDADRLVICDEKGVVVDGDQIMAIIAGALAKAGTLKGGGVVATVMSNLGLERCLNGQ 302

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           GLSL+RT VGDRY+M+ M+  GFNVGGEQSGH+ILSD+ +TGDGL+AALQVL  + +  +
Sbjct: 303 GLSLERTAVGDRYVMQRMREGGFNVGGEQSGHLILSDFSTTGDGLIAALQVLAVMVETGQ 362

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
           P+S +   FE  PQ L +V       L + ++  AIAD E++L G  R++VRASGTE LI
Sbjct: 363 PMSALGRQFEPVPQLLENVRFAGGKPLEAKTVKDAIADGEAQLNGAGRIVVRASGTEPLI 422

Query: 421 RIMAEGDDLSRIKRIVDDLAKVI 443
           RIMAEGDD + +K++V  +   +
Sbjct: 423 RIMAEGDDPALVKKVVKSIVGAV 445


>gi|148553010|ref|YP_001260592.1| phosphoglucosamine mutase [Sphingomonas wittichii RW1]
 gi|172048091|sp|A5V2D8|GLMM_SPHWW RecName: Full=Phosphoglucosamine mutase
 gi|148498200|gb|ABQ66454.1| phosphoglucosamine mutase [Sphingomonas wittichii RW1]
          Length = 445

 Score =  513 bits (1320), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 252/444 (56%), Positives = 325/444 (73%), Gaps = 4/444 (0%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLF-RGKKKHRRVVIGKDTRLSGYMLE 59
           M RR+FGTDGIRG++N  P+T    M++G A G  F RG+ +HR VVIGKDTRLSGYM+E
Sbjct: 1   MGRRYFGTDGIRGRTNESPMTAEIAMKVGQAAGAHFVRGEHRHR-VVIGKDTRLSGYMME 59

Query: 60  NSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGY 119
           ++LVAGFT+ GMD  +LGP+P+PAVAMLTRS+RAD+GVMISASHN + DNGIKLFGPDGY
Sbjct: 60  SALVAGFTSVGMDCVLLGPMPTPAVAMLTRSMRADLGVMISASHNMFADNGIKLFGPDGY 119

Query: 120 KVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRI 179
           K+S D E  IE  LE  +   L+    IG A RV+    RY+  VK + P  + L GLR+
Sbjct: 120 KLSDDDETAIEARLEKPVK--LAASADIGRAHRVESARGRYVHAVKSSFPEHLRLDGLRV 177

Query: 180 VVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIG 239
           V+DCA+GA+Y+VAP   WELGA+++ +G  PNG+NIN  CGST+  +LQ KV E RADIG
Sbjct: 178 VIDCAHGAAYEVAPLALWELGAELISMGVNPNGVNINDQCGSTDTRALQDKVRETRADIG 237

Query: 240 IALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAG 299
           IALDGD DR+IIVD +G +V+GDQ+MAL+A        LRG GIV TVMSN+GLERF+A 
Sbjct: 238 IALDGDADRLIIVDNEGRVVDGDQLMALVAVGAHRRGELRGGGIVATVMSNLGLERFLAE 297

Query: 300 LGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYD 359
            GLSL RT+VGDRY++E M+  GFN+GGEQSGHI+++D+ +TGDGLVAALQVL  + +  
Sbjct: 298 QGLSLHRTKVGDRYVVEAMRAEGFNIGGEQSGHIVMTDHATTGDGLVAALQVLAQLVESG 357

Query: 360 KPVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESL 419
           KP S + H F+  PQ L++V       L    ++ AIADAE +L G  RL++R SGTE L
Sbjct: 358 KPASELLHQFDPLPQLLKNVRFAGGEPLKDEKVIAAIADAEEKLTGTGRLVIRKSGTEPL 417

Query: 420 IRIMAEGDDLSRIKRIVDDLAKVI 443
           IR+MAEG+D   ++ +VD +   +
Sbjct: 418 IRVMAEGEDKRLVEAMVDQICDAV 441


>gi|103486450|ref|YP_616011.1| phosphoglucosamine mutase [Sphingopyxis alaskensis RB2256]
 gi|122985138|sp|Q1GUJ4|GLMM_SPHAL RecName: Full=Phosphoglucosamine mutase
 gi|98976527|gb|ABF52678.1| phosphoglucosamine mutase [Sphingopyxis alaskensis RB2256]
          Length = 444

 Score =  512 bits (1318), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 261/436 (59%), Positives = 321/436 (73%), Gaps = 4/436 (0%)

Query: 3   RRFFGTDGIRGKSNTFPITPNFMMRIGIAVG-YLFRGKKKHRRVVIGKDTRLSGYMLENS 61
           RRFFGTDGIRG +N  P+T    MR+G+A G +  RG  KHR VVIGKDTRLSGYMLEN+
Sbjct: 2   RRFFGTDGIRGLTNKVPMTAEVAMRVGMAAGAHFLRGDHKHR-VVIGKDTRLSGYMLENA 60

Query: 62  LVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKV 121
           LVAGFT+ GMD   +GP+P+PA+AMLTRS+RAD+GVMISASHNPYQDNGIKLFGPDGYK+
Sbjct: 61  LVAGFTSVGMDVVQVGPMPTPAIAMLTRSMRADLGVMISASHNPYQDNGIKLFGPDGYKL 120

Query: 122 STDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVV 181
           S   E  IE LL ++    L+    IG AKR+D    RYI  VK++LP+ V L GLRIV+
Sbjct: 121 SDADEAAIERLLVEE--PRLADATHIGRAKRIDDARGRYIHAVKQSLPQMVRLDGLRIVL 178

Query: 182 DCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIA 241
           DCANGA+Y  AP VFWELGADVV IG +PNG NIN  CGST    LQ  V    ADIGIA
Sbjct: 179 DCANGAAYNSAPTVFWELGADVVAIGVEPNGTNINDKCGSTAPALLQETVVASGADIGIA 238

Query: 242 LDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLG 301
           LDGD DR+I+VDEKG+I++GDQIM LI   W     L+G G+V TVMSN+GLERF+ G G
Sbjct: 239 LDGDADRLIVVDEKGSIIDGDQIMGLIGASWARQGRLKGGGVVATVMSNLGLERFLEGQG 298

Query: 302 LSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKP 361
           L L+RT+VGDR+++E MK  GFNVGGEQSGH+ILSD+ +TGDG +AALQ+L  +   ++P
Sbjct: 299 LRLERTKVGDRHVLERMKEGGFNVGGEQSGHMILSDHATTGDGTLAALQLLAELVAAERP 358

Query: 362 VSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLIR 421
            S + H F+  PQ L++V       L    ++ AIA+ E+ L G  RL++R SGTE LIR
Sbjct: 359 ASELLHQFDPVPQLLKNVRFAGGKPLEDKQVLAAIAEGEAALNGRGRLVIRPSGTEPLIR 418

Query: 422 IMAEGDDLSRIKRIVD 437
           +MAEGDD   ++R+VD
Sbjct: 419 VMAEGDDAGEVERVVD 434


>gi|87198506|ref|YP_495763.1| phosphoglucosamine mutase [Novosphingobium aromaticivorans DSM
           12444]
 gi|123490724|sp|Q2GB44|GLMM_NOVAD RecName: Full=Phosphoglucosamine mutase
 gi|87134187|gb|ABD24929.1| phosphoglucosamine mutase [Novosphingobium aromaticivorans DSM
           12444]
          Length = 445

 Score =  511 bits (1316), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 250/444 (56%), Positives = 327/444 (73%), Gaps = 4/444 (0%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVG-YLFRGKKKHRRVVIGKDTRLSGYMLE 59
           M R+FFGTDGIRG++N+  +T    M++G A G Y  RG  +HR VVIGKDTRLSGYM+E
Sbjct: 1   MARKFFGTDGIRGRTNSGVMTAEIAMKVGQAAGTYFQRGTHRHR-VVIGKDTRLSGYMME 59

Query: 60  NSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGY 119
           +++ AGFT+ GMD  +LGP+P+PAVAMLTRS+RAD+GVMISASHNP++DNGIKLFGPDGY
Sbjct: 60  SAMTAGFTSVGMDVVLLGPMPTPAVAMLTRSMRADLGVMISASHNPFEDNGIKLFGPDGY 119

Query: 120 KVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRI 179
           K+S + E  IE++L  +L   L+    +G A+R++    RYI  VK +LP +V L GLRI
Sbjct: 120 KLSDEAELTIESMLLQELP--LADAAQVGRARRIEDARGRYIHAVKASLPDNVRLDGLRI 177

Query: 180 VVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIG 239
           VVDCANGA+Y V P   WELGA+V+ IG +PNG NIN   GST++ +++ KV E RADIG
Sbjct: 178 VVDCANGAAYHVTPSALWELGAEVIAIGVEPNGKNINAGVGSTHLDAIKAKVRETRADIG 237

Query: 240 IALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAG 299
           IALDGD DR+I+VDEK   V+GDQIMALI  +  +   LRG G+V TVMSN+GLER +  
Sbjct: 238 IALDGDADRLIVVDEKCQTVDGDQIMALIGTQLAARGELRGGGVVATVMSNLGLERHLNA 297

Query: 300 LGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYD 359
            GL+L+RT VGDRY++E M++ GFNVGGEQSGH+IL+D+ +TGDG VAALQVL  +    
Sbjct: 298 HGLTLERTAVGDRYVLERMRSGGFNVGGEQSGHMILTDHATTGDGTVAALQVLAALVSSG 357

Query: 360 KPVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESL 419
           KP S + H F+  PQ L++V       L + S+ +AIA+AE+ L G  RL++R SGTE L
Sbjct: 358 KPASELLHLFDPVPQLLKNVRFTGGKPLEAKSVKEAIAEAEARLAGKGRLVIRPSGTEPL 417

Query: 420 IRIMAEGDDLSRIKRIVDDLAKVI 443
           IR+MAEGDD   ++ +VD +   +
Sbjct: 418 IRVMAEGDDADEVEAVVDQICDAV 441


>gi|260565807|ref|ZP_05836290.1| phosphoglucosamine mutase [Brucella melitensis bv. 1 str. 16M]
 gi|260151180|gb|EEW86275.1| phosphoglucosamine mutase [Brucella melitensis bv. 1 str. 16M]
          Length = 361

 Score =  511 bits (1315), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 234/352 (66%), Positives = 295/352 (83%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M R+FFGTDGIRG++N+FP+TP   M++G+AVGY+FR K +  R VIGKDTR SGYMLEN
Sbjct: 9   MTRKFFGTDGIRGQANSFPMTPEIAMKVGMAVGYIFRRKGQASRAVIGKDTRRSGYMLEN 68

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +LVAGFTAAGMD F+LGPIP+PAVAML RSLRAD+GVMISASHNP+ DNGIKLFGPDG+K
Sbjct: 69  ALVAGFTAAGMDVFLLGPIPTPAVAMLCRSLRADIGVMISASHNPFYDNGIKLFGPDGFK 128

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +S  IE +IE ++E D+T +L+ +  +G AKRVDG   RYIE  KRTLPR+++L GLR+V
Sbjct: 129 LSDQIELQIEAMIEGDMTPFLASHGDVGRAKRVDGDIYRYIEFAKRTLPRNISLNGLRVV 188

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           VDCANGA YKVAP   WELGA+V+ I ++PNGININ DCGST+ + L +KVH VRAD+GI
Sbjct: 189 VDCANGAGYKVAPAALWELGAEVITINNEPNGININEDCGSTHPIGLMKKVHGVRADVGI 248

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           ALDGD DRV++VDE G +++GDQ+MA+IA  W + + L G GIV TVMSN+GLERF+A  
Sbjct: 249 ALDGDADRVLLVDENGTVIDGDQLMAVIAESWAASNRLEGGGIVATVMSNLGLERFLADR 308

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVL 352
            L+L RT+VGDRY++E+M+ +GFNVGGEQSGHI+LSD+ +TGDGL++ALQ+L
Sbjct: 309 NLTLARTKVGDRYVVEHMREHGFNVGGEQSGHIVLSDFATTGDGLISALQIL 360


>gi|315497140|ref|YP_004085944.1| transcriptional regulator, xre family [Asticcacaulis excentricus CB
           48]
 gi|315415152|gb|ADU11793.1| transcriptional regulator, XRE family [Asticcacaulis excentricus CB
           48]
          Length = 541

 Score =  510 bits (1314), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 240/442 (54%), Positives = 325/442 (73%), Gaps = 1/442 (0%)

Query: 3   RRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRV-VIGKDTRLSGYMLENS 61
           R++FGTDGIRG+ N+FP+T     R+G+A G +F      R + VIGKDTRLSGYM+E +
Sbjct: 98  RKYFGTDGIRGRVNSFPMTAEVAYRVGMAAGKMFMSSDNRRHLAVIGKDTRLSGYMIEPA 157

Query: 62  LVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKV 121
           LVAGFT+ GMD  + GP+P+P VAM+TRS+RAD+GVMISASHNPY DNGIKLFGPDGYK+
Sbjct: 158 LVAGFTSVGMDVRLFGPLPTPGVAMMTRSMRADLGVMISASHNPYYDNGIKLFGPDGYKL 217

Query: 122 STDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVV 181
           S ++E  IE  ++ ++   ++    +G  +RVD    RY+E  K T P+++ L+GLRIV+
Sbjct: 218 SDEVELAIEARMDGNILDGIADPQHLGRVQRVDDAQYRYVEIAKATFPKNLLLKGLRIVI 277

Query: 182 DCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIA 241
           DCANGA+YKVAP   +ELGA++  +G  P+G+NIN  CGST   ++  KV E+RADIGIA
Sbjct: 278 DCANGAAYKVAPTTLYELGAEIFCLGVSPDGMNINEKCGSTQPQAMAEKVKELRADIGIA 337

Query: 242 LDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLG 301
           LDGD DR++I DEKG +V+GDQIMA+IA    +   L+G G+V TVMSN+GLER +   G
Sbjct: 338 LDGDADRLVICDEKGTLVDGDQIMAIIATSLAAKGQLKGGGLVATVMSNLGLERLMTSKG 397

Query: 302 LSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKP 361
           L L+RT+VGDRY+ME M+  GFN+GGEQSGH+I+ D+ +TGDGL+AALQVL  + +  +P
Sbjct: 398 LKLERTKVGDRYVMEKMREGGFNLGGEQSGHVIMLDHATTGDGLIAALQVLAVLVEGGRP 457

Query: 362 VSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLIR 421
           +S +   FE  PQ L++V     S LN + + QAIAD E+ L+G  R++VR SGTE LIR
Sbjct: 458 MSELARQFEPVPQLLKNVRFTGESPLNRADVKQAIADGEATLKGTGRVLVRPSGTEPLIR 517

Query: 422 IMAEGDDLSRIKRIVDDLAKVI 443
           +MAEGDD ++++ +VD +   I
Sbjct: 518 VMAEGDDAAQVRTVVDQIIDAI 539


>gi|312113974|ref|YP_004011570.1| phosphoglucosamine mutase [Rhodomicrobium vannielii ATCC 17100]
 gi|311219103|gb|ADP70471.1| phosphoglucosamine mutase [Rhodomicrobium vannielii ATCC 17100]
          Length = 456

 Score =  509 bits (1312), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 249/443 (56%), Positives = 323/443 (72%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M+++ FGTDGIRG++NT+P+T    +++G+A G++F    +  RVVIGKDTRLSGY +EN
Sbjct: 1   MRQKLFGTDGIRGQANTWPMTAEIALKVGMAAGHMFTNGGRRHRVVIGKDTRLSGYTIEN 60

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +LV+GFT+ GMD   LGPIP+PAVAML RSLRAD+GVMISASHN YQDNGIKLFGPDGYK
Sbjct: 61  ALVSGFTSVGMDVVQLGPIPTPAVAMLVRSLRADLGVMISASHNAYQDNGIKLFGPDGYK 120

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +S ++E  IE  +  D+   L+  D IG ++R+DG+ DRYIE  KRTL R ++L GL+IV
Sbjct: 121 LSDEVETEIEAEVFGDIDRLLAEPDHIGKSRRIDGIVDRYIEFAKRTLDRTISLSGLKIV 180

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           +DCANGA+Y+VAP   WELGA+VV +G  P+G NIN +CGST    + RKV E  A IGI
Sbjct: 181 IDCANGAAYRVAPAALWELGAEVVALGVAPDGRNINRECGSTVPDHICRKVLETGAHIGI 240

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           ALDGD DRVII DE G IV+GDQI+A+I   + +   LRG G+V TVMSN+GLER    L
Sbjct: 241 ALDGDADRVIISDENGQIVDGDQILAVIGENFRNTGRLRGGGVVATVMSNLGLERHFEKL 300

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
            LSL RT+VGDRY++E M+   +NVGGEQSGH++LSD+ +TGDGLV ALQVL  + Q DK
Sbjct: 301 DLSLIRTKVGDRYVVEAMRRGDYNVGGEQSGHVVLSDFTTTGDGLVTALQVLSVVIQSDK 360

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
           PVS +C  FE  PQ L+++     S L S ++   IA  E  L    RL++R SGTE LI
Sbjct: 361 PVSEVCRRFEPVPQLLKNLRFSGPSPLESEAVKSVIAAQEVRLGRAGRLLIRKSGTEPLI 420

Query: 421 RIMAEGDDLSRIKRIVDDLAKVI 443
           R+MA+G+D + I  +V ++   +
Sbjct: 421 RVMAQGEDQTLISGVVAEIVAAV 443


>gi|302381599|ref|YP_003817422.1| phosphoglucosamine mutase [Brevundimonas subvibrioides ATCC 15264]
 gi|302192227|gb|ADK99798.1| phosphoglucosamine mutase [Brevundimonas subvibrioides ATCC 15264]
          Length = 449

 Score =  509 bits (1311), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 246/443 (55%), Positives = 321/443 (72%), Gaps = 1/443 (0%)

Query: 2   KRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLF-RGKKKHRRVVIGKDTRLSGYMLEN 60
           +R++FGTDGIRGK+N  P+T    +R+G+A G LF  G  +   VVIGKDTRLSGYM+E 
Sbjct: 3   ERKYFGTDGIRGKANASPMTAEIALRVGLAAGKLFMSGDDRRHLVVIGKDTRLSGYMIEP 62

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +LVAGF + GMD    GPIP+P VAM+TRS+RAD+GVMISASHN Y DNGIKLFGPDGYK
Sbjct: 63  ALVAGFASVGMDVRTFGPIPTPGVAMMTRSMRADLGVMISASHNDYADNGIKLFGPDGYK 122

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +S +IE +IE L++  L   L+  + +G  KR+D    RYIE  K   PR ++L GLRI 
Sbjct: 123 LSDEIELKIEALMDAGLDEGLAPSNRLGRVKRIDDAPPRYIEIAKAAFPRHLSLSGLRIA 182

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           VDCANGA Y+VAP   +ELGA+V  +G  PNG NIN +CGST+  +L   V + RADIGI
Sbjct: 183 VDCANGAGYRVAPTTLFELGAEVCAVGVSPNGTNINAECGSTHPETLAAAVKQYRADIGI 242

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           ALDGD DR+I+ DE G +V+GDQIMALI R+W    +L+G G+V TVMSN+GLER +   
Sbjct: 243 ALDGDADRLIVCDENGKVVDGDQIMALIGRDWARRGVLKGGGVVATVMSNLGLERALKAD 302

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           GL+L+RT+VGDRY+ME M++ GFN+GGEQSGH+IL D+ +TGDGL+AALQVL  + +  K
Sbjct: 303 GLTLERTKVGDRYVMERMRSGGFNLGGEQSGHLILHDHATTGDGLMAALQVLAVMVESGK 362

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
           P+S +   F   PQ L++V       L  +++  AIA+ E+ L G  RL+VR SGTE LI
Sbjct: 363 PMSELARQFAPVPQLLQNVRFTGGKPLEDAAVKAAIAEGEAALNGSGRLLVRPSGTEKLI 422

Query: 421 RIMAEGDDLSRIKRIVDDLAKVI 443
           R+MAEGDD + +KR+V D++  +
Sbjct: 423 RVMAEGDDGALVKRVVADVSAAV 445


>gi|83592436|ref|YP_426188.1| phosphoglucosamine mutase [Rhodospirillum rubrum ATCC 11170]
 gi|123739578|sp|Q2RVE4|GLMM_RHORT RecName: Full=Phosphoglucosamine mutase
 gi|83575350|gb|ABC21901.1| phosphoglucosamine mutase [Rhodospirillum rubrum ATCC 11170]
          Length = 452

 Score =  507 bits (1306), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 246/445 (55%), Positives = 323/445 (72%), Gaps = 3/445 (0%)

Query: 2   KRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENS 61
           KR  FGTDG+RG +N  P+T +  +RIG+A G+L R       VVIGKDTRLSGYMLE +
Sbjct: 3   KRTLFGTDGVRGTANREPMTADTALRIGMAAGHLLRNGDHRHTVVIGKDTRLSGYMLEPA 62

Query: 62  LVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKV 121
           L AGF + GMD  +LGP+P+PAVAMLTRSLRAD+GVMI+ASHNP+QDNGIKLFGPDGYK+
Sbjct: 63  LAAGFISVGMDVVLLGPLPTPAVAMLTRSLRADLGVMITASHNPFQDNGIKLFGPDGYKL 122

Query: 122 STDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVV 181
           S D E  IE LL++ L  + +   ++G A+R+D  + RY+E VK T PR   L+GLRIVV
Sbjct: 123 SDDQEATIEALLDNGLEGHRAGPTALGKARRLDDCNGRYVEFVKSTFPRGRRLEGLRIVV 182

Query: 182 DCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIA 241
           DCA+GA+Y+VAP+V WELGA +V IG  P+G NIN DCGS +   +   V    AD+G+A
Sbjct: 183 DCAHGAAYRVAPKVLWELGATIVPIGVTPDGTNINKDCGSLHSRVMCETVVREGADLGVA 242

Query: 242 LDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLG 301
           LDGD DRV++ DEKGA+V+GDQ++ALI R W     L+G G+V TVMSN+GLERF+   G
Sbjct: 243 LDGDADRVVLCDEKGALVDGDQLLALIGRNWKRAGTLQGGGVVATVMSNLGLERFLKDEG 302

Query: 302 LSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKP 361
           L+L RT VGDRY++E+M+  G+N+GGEQSGHI++SD+G+TGDGL+AALQVL  +   D+P
Sbjct: 303 LALARTPVGDRYVVEHMRAEGYNLGGEQSGHIVMSDFGTTGDGLMAALQVLSALVAEDRP 362

Query: 362 VSTICHCFEEYPQFLRSVSVK---DTSILNSSSIVQAIADAESELRGIDRLIVRASGTES 418
            S +   F   PQ LR+V V      +IL    + +A++  E  L G  RL++R SGTE 
Sbjct: 363 ASEVLDVFTPLPQLLRNVRVAGHDPRAILADPQVARAVSAGEGRLNGGGRLLIRKSGTEP 422

Query: 419 LIRIMAEGDDLSRIKRIVDDLAKVI 443
           LIR+MAEG+D + + ++V D+  VI
Sbjct: 423 LIRVMAEGEDEALVAQVVGDICAVI 447


>gi|332185395|ref|ZP_08387143.1| phosphoglucosamine mutase [Sphingomonas sp. S17]
 gi|332014373|gb|EGI56430.1| phosphoglucosamine mutase [Sphingomonas sp. S17]
          Length = 446

 Score =  507 bits (1305), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 255/444 (57%), Positives = 318/444 (71%), Gaps = 4/444 (0%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVG-YLFRGKKKHRRVVIGKDTRLSGYMLE 59
           M R++FGTDGIRG +N   +T    M++G+A G Y  RG  +HR VVIGKDTRLSGYMLE
Sbjct: 1   MARKYFGTDGIRGATNGAVMTAEMAMKVGMAAGAYFLRGDHRHR-VVIGKDTRLSGYMLE 59

Query: 60  NSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGY 119
           ++LVAGFT+ GMD  ++GP+P+PAVAMLT S+RAD+GVMISASHNP+ DNGIKLFGPDGY
Sbjct: 60  SALVAGFTSVGMDVVMVGPLPTPAVAMLTHSMRADIGVMISASHNPFADNGIKLFGPDGY 119

Query: 120 KVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRI 179
           K+S + E+ IETL+E+ +   L     IG A+RVD    RYI   K T P+ + L GLR+
Sbjct: 120 KLSDEAEESIETLIEEKVP--LVPSGKIGRARRVDDAAGRYIHFAKSTFPQSLRLDGLRV 177

Query: 180 VVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIG 239
           V+DCANGA+YKVAP   WELGADVV IG  PNG NIN   GST   +L   V    ADIG
Sbjct: 178 VIDCANGAAYKVAPAALWELGADVVAIGVTPNGTNINDGVGSTAPQTLAETVVASGADIG 237

Query: 240 IALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAG 299
           IALDGD DR+IIVDEKG IV+GDQ+MA IA  +     L G G+V TVMSN+GLER +A 
Sbjct: 238 IALDGDADRLIIVDEKGMIVDGDQLMATIATSYAREGRLAGGGLVATVMSNLGLERHLAA 297

Query: 300 LGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYD 359
            GL L RT+VGDR+++E M+  G+NVGGEQSGHIILSDY  TGDGLVAALQVL  IK+  
Sbjct: 298 QGLGLVRTKVGDRHVLEAMRTRGYNVGGEQSGHIILSDYARTGDGLVAALQVLAEIKRAG 357

Query: 360 KPVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESL 419
            P S + H F+  PQ L++V       L    +   IA AE+EL G  RL++R SGTE +
Sbjct: 358 APASEVLHRFDPLPQLLKNVRFAGGKPLEHEKVQGVIAAAEAELAGRGRLVIRPSGTEPV 417

Query: 420 IRIMAEGDDLSRIKRIVDDLAKVI 443
           IR+MAEG+D ++++ +VD +  V+
Sbjct: 418 IRVMAEGEDKAQVETLVDRICDVV 441


>gi|254293912|ref|YP_003059935.1| phosphoglucosamine mutase [Hirschia baltica ATCC 49814]
 gi|254042443|gb|ACT59238.1| phosphoglucosamine mutase [Hirschia baltica ATCC 49814]
          Length = 449

 Score =  501 bits (1289), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 240/444 (54%), Positives = 318/444 (71%), Gaps = 1/444 (0%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRR-VVIGKDTRLSGYMLE 59
           M R++FGTDGIRG +N   +TP  +MR+G+A    F+   + R  VVIGKDTRLSGYM+E
Sbjct: 1   MSRKYFGTDGIRGPANKGTMTPEVVMRLGMASASYFKQDNERRHTVVIGKDTRLSGYMIE 60

Query: 60  NSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGY 119
            +L AGFTAAGMD  + GP+P+P VAMLTRSLRAD+GVMISASHN YQDNGIKLFGPDG+
Sbjct: 61  PALTAGFTAAGMDVVLFGPLPTPGVAMLTRSLRADLGVMISASHNAYQDNGIKLFGPDGF 120

Query: 120 KVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRI 179
           K+S + E  IE+L+E  + + L+    +G A R+D    RY+E VK T PR   L  LRI
Sbjct: 121 KLSDEAELEIESLMERPMDADLAASAKLGKASRIDDAQSRYVEIVKATFPRRQRLNKLRI 180

Query: 180 VVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIG 239
           VVDCA+GA+YKVAP+V +ELGA+VV +G  PNG NIN +CGST+  +L   V + RADIG
Sbjct: 181 VVDCAHGAAYKVAPKVLYELGAEVVSLGVSPNGFNINEECGSTDTRALSEAVLKYRADIG 240

Query: 240 IALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAG 299
           IALDGD DRV++ DEKG I++GDQ++ LIA+ W     L    I  TVMSN+GLE F+  
Sbjct: 241 IALDGDADRVVLCDEKGIIIDGDQVLGLIAQSWKEEGKLSKPAISATVMSNLGLENFLKS 300

Query: 300 LGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYD 359
           +G+ L+RT+VGDRY+++ M+ NG N+GGEQSGH+++SDY +TGDGLVAALQVL  + +  
Sbjct: 301 IGIELRRTKVGDRYVVQDMRENGVNLGGEQSGHVVMSDYATTGDGLVAALQVLAVVCKTG 360

Query: 360 KPVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESL 419
           KPVS + H F++ PQ L ++       L + ++ Q + D E EL    RL+VR SGTE L
Sbjct: 361 KPVSEVAHVFDKAPQRLDNIRYSGKDPLTTKAVKQVMKDVEEELGSKGRLVVRKSGTEPL 420

Query: 420 IRIMAEGDDLSRIKRIVDDLAKVI 443
           IR+MAE ++ S + + V+D+   +
Sbjct: 421 IRVMAEAEEESMMNKAVEDVVAAV 444


>gi|149186420|ref|ZP_01864733.1| phosphoglucosamine mutase [Erythrobacter sp. SD-21]
 gi|148830009|gb|EDL48447.1| phosphoglucosamine mutase [Erythrobacter sp. SD-21]
          Length = 445

 Score =  500 bits (1288), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 245/444 (55%), Positives = 322/444 (72%), Gaps = 4/444 (0%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVG-YLFRGKKKHRRVVIGKDTRLSGYMLE 59
           M R +FGTDGIRG++N   +T    M++G A G +  RG  KHR VVIGKDTRLSGYM+E
Sbjct: 1   MARTYFGTDGIRGRTNEGVMTAETAMKVGQAAGTHFLRGGHKHR-VVIGKDTRLSGYMVE 59

Query: 60  NSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGY 119
           ++LVAGFT+ GMD  + GP+P+PA+A+LTR +RAD+GVMISASHNP++DNGIKLFGPDGY
Sbjct: 60  SALVAGFTSVGMDVIMTGPLPTPAIALLTREMRADLGVMISASHNPFEDNGIKLFGPDGY 119

Query: 120 KVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRI 179
           K+S + E  IETL+       L   + IG A+R+D    RYI  VK+++  DV   GL++
Sbjct: 120 KLSDEAEMAIETLMTQQ--PLLVSPERIGRARRIDDASGRYIHAVKQSVASDVRFDGLKV 177

Query: 180 VVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIG 239
           VVDCANGA+YKVAP   WELGA V+ +G +PNG NIN D GST++ +++ +V E  A IG
Sbjct: 178 VVDCANGAAYKVAPSAIWELGAQVIAMGVEPNGTNINRDVGSTSLDAIKARVVEEGAHIG 237

Query: 240 IALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAG 299
           IALDGD DR+I++DEKG  V+GDQIM LIA        LRG G+V TVMSN+GLER++A 
Sbjct: 238 IALDGDADRLIVIDEKGNTVDGDQIMGLIATRLKERGDLRGGGVVATVMSNLGLERYLAS 297

Query: 300 LGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYD 359
            GL+L+RT VGDRY++E M+  GFNVGGEQSGH+ILSDYG+TGDG VAAL+VL  + ++ 
Sbjct: 298 QGLTLERTRVGDRYVLERMRQGGFNVGGEQSGHMILSDYGTTGDGTVAALRVLASVVRFG 357

Query: 360 KPVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESL 419
           KP S + H F+  PQ L++V       L + S+   I +AE EL G  RL++R SGTE +
Sbjct: 358 KPASELLHVFDPVPQLLKNVRYSGGKPLENESVKAVIVEAEKELEGKGRLVIRPSGTEPV 417

Query: 420 IRIMAEGDDLSRIKRIVDDLAKVI 443
           IR+MAEGDD  +++ +VD +   +
Sbjct: 418 IRVMAEGDDARQVETVVDRICDAV 441


>gi|167648552|ref|YP_001686215.1| phosphoglucosamine mutase [Caulobacter sp. K31]
 gi|189040777|sp|B0T1V6|GLMM_CAUSK RecName: Full=Phosphoglucosamine mutase
 gi|167350982|gb|ABZ73717.1| phosphoglucosamine mutase [Caulobacter sp. K31]
          Length = 448

 Score =  500 bits (1287), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 245/446 (54%), Positives = 323/446 (72%), Gaps = 1/446 (0%)

Query: 2   KRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRR-VVIGKDTRLSGYMLEN 60
           KR +FGTDGIRG++N  P+T    +R+G+A G LFR +   R  VVIGKDTRLSGYM+E 
Sbjct: 3   KRAYFGTDGIRGQANKHPMTAEVALRVGLAAGKLFRSQDDRRHLVVIGKDTRLSGYMIEP 62

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +LVAGF + GMD  + GP+P+PAVAM+TRS+RAD+GVMISASHN + DNGIKLFGPDGYK
Sbjct: 63  ALVAGFASVGMDVRLFGPLPTPAVAMMTRSMRADLGVMISASHNDFADNGIKLFGPDGYK 122

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +S + E +IE L+++ L   L+    +G  +RVD    RYIE VK T PR+++L GLRIV
Sbjct: 123 LSDEQELKIEALMDEGLQEGLAPPRGLGRVQRVDDAQARYIEIVKATFPRNMSLAGLRIV 182

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           +DCA+GA+YKVAP+  +ELGA+V  +G  PNG NIN +CGST+  ++ R V E RADIGI
Sbjct: 183 IDCAHGAAYKVAPQALYELGAEVFPVGVAPNGTNINAECGSTHPEAMARLVREYRADIGI 242

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           ALDGD DR++I DEKG +V+GDQIMA+IA        L+  G+V TVMSN+GLER +   
Sbjct: 243 ALDGDADRLVICDEKGVVVDGDQIMAIIALALAKAGKLKAGGVVATVMSNLGLERLMTDN 302

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           GL L+RT VGDRY+M  M+  GFN+GGEQSGH+ILSD+ +TGDGL+AALQVL  + +  +
Sbjct: 303 GLKLERTSVGDRYVMARMREGGFNIGGEQSGHVILSDFSTTGDGLIAALQVLAVMIETGR 362

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
           P+S +   FE  PQ L +V       L   ++ +AIAD E++L G  R++VR SGTE LI
Sbjct: 363 PMSALGRQFEPAPQILENVRFSGGKPLEHKTVKEAIADGEAQLNGSGRIVVRPSGTEPLI 422

Query: 421 RIMAEGDDLSRIKRIVDDLAKVIPMI 446
           RIMAEGDD + +K++V  +   +  +
Sbjct: 423 RIMAEGDDPALVKKVVKSIVSAVKAV 448


>gi|144897908|emb|CAM74772.1| Phosphoglucosamine mutase [Magnetospirillum gryphiswaldense MSR-1]
          Length = 450

 Score =  499 bits (1286), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 249/446 (55%), Positives = 321/446 (71%), Gaps = 4/446 (0%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLF-RGKKKHRRVVIGKDTRLSGYMLE 59
           M R+ FGTDGIRG +N  P+T    +++G+A G  F RG+ +H  VVIGKDTRLSGY+LE
Sbjct: 1   MTRKLFGTDGIRGTANIDPMTAEMALKLGMAAGRHFTRGEHRHM-VVIGKDTRLSGYLLE 59

Query: 60  NSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGY 119
            +L AGF A GMD  +LGP+P+PAVAMLTRSLRAD+GVMISASHN YQDNGIKLFGPDG+
Sbjct: 60  PALTAGFIAVGMDVVLLGPLPTPAVAMLTRSLRADLGVMISASHNAYQDNGIKLFGPDGF 119

Query: 120 KVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRI 179
           K+S + E  IE  + + L +Y    D +G AKR+D    RYIE+ K + PR + L GL+I
Sbjct: 120 KLSDEDEIEIEHKMFNGLEAYRVGSDHLGKAKRLDDAVGRYIEYAKSSFPRGLRLDGLKI 179

Query: 180 VVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIG 239
           VVDCANGA+YKVAP V WELGA+V+ +   P+G NIN DCGS +  +LQ +V    A +G
Sbjct: 180 VVDCANGAAYKVAPTVLWELGAEVIPLAVSPDGFNINKDCGSLHTQTLQTQVVAHGAHLG 239

Query: 240 IALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAG 299
           IALDGD DR+++ DEKG +++GDQ+M LI         L G GIV TVMSN+GLE+ +AG
Sbjct: 240 IALDGDADRLVLCDEKGTVIDGDQVMGLIGLTLAKSGKLTGGGIVATVMSNMGLEKHLAG 299

Query: 300 LGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYD 359
            GL L RT VGDRY++E M+ +GFNVGGEQSGHIILSD+ +TGDGLVAALQVL  + + D
Sbjct: 300 HGLHLHRTNVGDRYVLERMRRDGFNVGGEQSGHIILSDHSTTGDGLVAALQVLAALVEAD 359

Query: 360 KPVSTICHCFEEYPQFLRSVSV--KDTSILNSSSIVQAIADAESELRGIDRLIVRASGTE 417
           KP S + H F+ +PQ L++V V  K  ++L    +  AIA  E+ L G  R+++R SGTE
Sbjct: 360 KPASQVLHLFDPFPQVLKNVRVAGKPDAVLALDGVQAAIAAGEARLNGTGRVLIRKSGTE 419

Query: 418 SLIRIMAEGDDLSRIKRIVDDLAKVI 443
            LIR+MAEG+D + +  +VDD+   I
Sbjct: 420 PLIRVMAEGEDKALVDTVVDDIVATI 445


>gi|258543657|ref|YP_003189090.1| phosphoglucosamine mutase [Acetobacter pasteurianus IFO 3283-01]
 gi|256634735|dbj|BAI00711.1| phosphoglucosamine mutase [Acetobacter pasteurianus IFO 3283-01]
 gi|256637791|dbj|BAI03760.1| phosphoglucosamine mutase [Acetobacter pasteurianus IFO 3283-03]
 gi|256640845|dbj|BAI06807.1| phosphoglucosamine mutase [Acetobacter pasteurianus IFO 3283-07]
 gi|256643900|dbj|BAI09855.1| phosphoglucosamine mutase [Acetobacter pasteurianus IFO 3283-22]
 gi|256646955|dbj|BAI12903.1| phosphoglucosamine mutase [Acetobacter pasteurianus IFO 3283-26]
 gi|256650008|dbj|BAI15949.1| phosphoglucosamine mutase [Acetobacter pasteurianus IFO 3283-32]
 gi|256652998|dbj|BAI18932.1| phosphoglucosamine mutase [Acetobacter pasteurianus IFO
           3283-01-42C]
 gi|256656052|dbj|BAI21979.1| phosphoglucosamine mutase [Acetobacter pasteurianus IFO 3283-12]
          Length = 452

 Score =  499 bits (1285), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 235/445 (52%), Positives = 325/445 (73%), Gaps = 2/445 (0%)

Query: 3   RRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLF-RGKKKHRRVVIGKDTRLSGYMLENS 61
           +RFFGTDGIRG +N  P+T     ++G A G  F RG  +H  V++GKDTRLSGYM+E++
Sbjct: 5   KRFFGTDGIRGTANVAPMTVEVAQKLGQAAGLHFKRGDHRHS-VLLGKDTRLSGYMIESA 63

Query: 62  LVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKV 121
           +V+GF +AGMD  ++GP+P+PA+AMLTRSLRAD+GVMISASHNP+ DNGIKLFGPDG+K+
Sbjct: 64  MVSGFLSAGMDVTLVGPLPTPAIAMLTRSLRADLGVMISASHNPFGDNGIKLFGPDGFKL 123

Query: 122 STDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVV 181
           S   E  IE L+E DLT+YL+  + IG A R++    RYIE  K + PR + L G++IV+
Sbjct: 124 SDQDESEIEALMEKDLTAYLAKPEHIGRASRLNDAAGRYIESAKASFPRKLRLDGMKIVI 183

Query: 182 DCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIA 241
           DCANG++Y+VAP   WELGA+V+ IG +PNG+NIN  CGST+  +L   V + +AD+GIA
Sbjct: 184 DCANGSAYRVAPTALWELGAEVIRIGCEPNGVNINEKCGSTHPEALCAAVVKHKADLGIA 243

Query: 242 LDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLG 301
           LDGD DRV+I DE G +++GDQI+ALIA+ W+    L GN +V TVMSN+GLERF+  LG
Sbjct: 244 LDGDADRVLIADETGRLIDGDQILALIAQSWVREGRLMGNSVVATVMSNMGLERFLENLG 303

Query: 302 LSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKP 361
           LSL+RT VGDRY++E M     N+GGEQSGH++L+D+ +TGDGL+AALQ+L  + Q  +P
Sbjct: 304 LSLERTAVGDRYVVERMLERQANIGGEQSGHMVLTDFATTGDGLIAALQILAVLVQDGRP 363

Query: 362 VSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLIR 421
            S +C  F+ +PQ L++V  K    L+ + +    A+ E +L G  RL++R SGTE L+R
Sbjct: 364 ASEVCQLFQPFPQKLKNVRYKGACPLDMAEVKSRQAEVERKLAGRGRLVLRKSGTEPLVR 423

Query: 422 IMAEGDDLSRIKRIVDDLAKVIPMI 446
           +MAE +D + +  +VD +  V+  +
Sbjct: 424 VMAEAEDANLVDEVVDQMCDVLEQV 448


>gi|58040124|ref|YP_192088.1| phosphoglucosamine mutase [Gluconobacter oxydans 621H]
 gi|81557002|sp|Q5FQB4|GLMM_GLUOX RecName: Full=Phosphoglucosamine mutase
 gi|58002538|gb|AAW61432.1| MrsA [Gluconobacter oxydans 621H]
          Length = 452

 Score =  499 bits (1284), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 246/446 (55%), Positives = 317/446 (71%), Gaps = 1/446 (0%)

Query: 2   KRRFFGTDGIRGKSNTFPITPNFMMRIGIAVG-YLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           KR  FGTDGIRG +NT P+T     R+G A G Y  R + +   VV+GKDTRLSGYMLE 
Sbjct: 4   KRSLFGTDGIRGTANTAPMTVEIAQRLGQAAGLYFMRSQNRRHSVVLGKDTRLSGYMLEC 63

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +LVAGF +AGMD  ++GP+P+PA+AMLTRSLRAD+GVM+SASHNP+ DNGIKLFGPDG+K
Sbjct: 64  ALVAGFLSAGMDVILVGPLPTPAIAMLTRSLRADLGVMVSASHNPFTDNGIKLFGPDGFK 123

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +S ++E  IE L+  DL++ L+    IG A R+     RYIE+ K + PR + L GL+IV
Sbjct: 124 LSDEVEGEIEDLMSQDLSARLASPAQIGRASRLTDAAGRYIENAKASFPRGLRLDGLKIV 183

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           +DCANG++Y+VAP   WELGA+V+ IG  P+G+NIN   GST+  +L   V E  AD GI
Sbjct: 184 IDCANGSAYRVAPTALWELGAEVIKIGCSPDGLNINDGVGSTHPETLCAAVREHGADFGI 243

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           ALDGD DRV+I DE G +V+GDQI+ LIA  W  H  LRGN +VTTVMSN+GLE+ +A  
Sbjct: 244 ALDGDADRVLIADENGNLVDGDQIIGLIAAFWKQHDRLRGNTVVTTVMSNMGLEKALAEN 303

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           GL L+RT VGDRY++E M+  G N+GGEQSGH++LSDY +TGDGL+AALQVL    +  +
Sbjct: 304 GLELQRTAVGDRYVVERMREIGANLGGEQSGHMVLSDYATTGDGLIAALQVLAVSVETKR 363

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
           P S IC  F  YPQ L++V    TS ++S  +  A A A+  L G  RL++RASGTE LI
Sbjct: 364 PASEICRFFTPYPQLLKNVRYSGTSPMSSPDLAAAKAWADERLAGSGRLVLRASGTEPLI 423

Query: 421 RIMAEGDDLSRIKRIVDDLAKVIPMI 446
           R+MAE  D + +  +VD +  VI  I
Sbjct: 424 RVMAEAQDEALVHEVVDHVCDVIRAI 449


>gi|260752546|ref|YP_003225439.1| phosphoglucosamine mutase [Zymomonas mobilis subsp. mobilis NCIMB
           11163]
 gi|258551909|gb|ACV74855.1| phosphoglucosamine mutase [Zymomonas mobilis subsp. mobilis NCIMB
           11163]
          Length = 445

 Score =  498 bits (1282), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 247/444 (55%), Positives = 324/444 (72%), Gaps = 4/444 (0%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVG-YLFRGKKKHRRVVIGKDTRLSGYMLE 59
           M R++FGTDGIRG +N  P+T +  MR+G A G Y  RG  +HR V+IGKDTRLSGYM+E
Sbjct: 1   MSRQYFGTDGIRGCTNKDPMTADVAMRVGQAAGAYFKRGLHRHR-VLIGKDTRLSGYMVE 59

Query: 60  NSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGY 119
           ++L+AGFT+ GMD  ++GP+P+P VA+LTRS+RAD+GVMISASHNP+ DNGIKLFGP+GY
Sbjct: 60  SALMAGFTSVGMDVVLVGPLPTPGVALLTRSMRADLGVMISASHNPFSDNGIKLFGPNGY 119

Query: 120 KVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRI 179
           K+S + E         D    L+    IG A+R+D    RYI  VK + P  + L  LR+
Sbjct: 120 KLSEEEE--KAIEEAIDQPPLLAAPADIGRARRIDDAQGRYIHAVKSSFPESLRLDKLRL 177

Query: 180 VVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIG 239
           V+DCANGA+Y+VAP V WELGA+V+ +G  PNG+NIN  CGST+  +LQ+KV E RAD+G
Sbjct: 178 VLDCANGAAYQVAPTVLWELGAEVITLGVAPNGLNINDHCGSTDPSALQKKVLETRADLG 237

Query: 240 IALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAG 299
           IALDGD DRVIIVDEKG IV+GDQIMALIA      +LL+GN  V TVMSN+GLER+++ 
Sbjct: 238 IALDGDADRVIIVDEKGEIVDGDQIMALIATSAQKRNLLKGNTTVATVMSNLGLERYLSK 297

Query: 300 LGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYD 359
           LG+ L RT+VGDR+++E M+  G+ VGGEQSGHIILS + +TGDGLVAALQVL  + Q D
Sbjct: 298 LGIQLLRTQVGDRHVVEAMRAGGYTVGGEQSGHIILSYHTTTGDGLVAALQVLADLVQSD 357

Query: 360 KPVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESL 419
           K  S + H F+ +PQ L++V       L   S+ +AI++AE  L+G  RL++R SGTE L
Sbjct: 358 KKASELLHVFDPFPQLLKNVRYSSGQPLEDESVCEAISEAEESLKGKGRLLIRKSGTEPL 417

Query: 420 IRIMAEGDDLSRIKRIVDDLAKVI 443
           IR+MAE +D   + +IVD + + +
Sbjct: 418 IRVMAEAEDPDLVHQIVDHICETV 441


>gi|56551898|ref|YP_162737.1| phosphoglucosamine mutase [Zymomonas mobilis subsp. mobilis ZM4]
 gi|241761785|ref|ZP_04759871.1| phosphoglucosamine mutase [Zymomonas mobilis subsp. mobilis ATCC
           10988]
 gi|81355087|sp|Q5NNT4|GLMM_ZYMMO RecName: Full=Phosphoglucosamine mutase
 gi|56543472|gb|AAV89626.1| phosphoglucosamine mutase [Zymomonas mobilis subsp. mobilis ZM4]
 gi|241373699|gb|EER63259.1| phosphoglucosamine mutase [Zymomonas mobilis subsp. mobilis ATCC
           10988]
          Length = 445

 Score =  498 bits (1282), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 247/444 (55%), Positives = 324/444 (72%), Gaps = 4/444 (0%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVG-YLFRGKKKHRRVVIGKDTRLSGYMLE 59
           M R++FGTDGIRG +N  P+T +  MR+G A G Y  RG  +HR V+IGKDTRLSGYM+E
Sbjct: 1   MSRQYFGTDGIRGCTNKDPMTADVAMRVGQAAGAYFKRGLHRHR-VLIGKDTRLSGYMVE 59

Query: 60  NSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGY 119
           ++L+AGFT+ GMD  ++GP+P+P VA+LTRS+RAD+GVMISASHNP+ DNGIKLFGP+GY
Sbjct: 60  SALMAGFTSVGMDVVLVGPLPTPGVALLTRSMRADLGVMISASHNPFSDNGIKLFGPNGY 119

Query: 120 KVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRI 179
           K+S + E         D    L+    IG A+R+D    RYI  VK + P  + L  LR+
Sbjct: 120 KLSEEEE--KAIEEAIDQPPLLAAPADIGRARRIDDAQGRYIHAVKSSFPESLRLDKLRL 177

Query: 180 VVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIG 239
           V+DCANGA+Y+VAP V WELGA+V+ +G  PNG+NIN  CGST+  +LQ+KV E RAD+G
Sbjct: 178 VLDCANGAAYQVAPAVLWELGAEVITLGVAPNGLNINDHCGSTDPSALQKKVLETRADLG 237

Query: 240 IALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAG 299
           IALDGD DRVIIVDEKG IV+GDQIMALIA      +LL+GN  V TVMSN+GLER+++ 
Sbjct: 238 IALDGDADRVIIVDEKGEIVDGDQIMALIATSAQKRNLLKGNTTVATVMSNLGLERYLSK 297

Query: 300 LGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYD 359
           LG+ L RT+VGDR+++E M+  G+ VGGEQSGHIILS + +TGDGLVAALQVL  + Q D
Sbjct: 298 LGIQLLRTQVGDRHVVEAMRAGGYTVGGEQSGHIILSYHTTTGDGLVAALQVLADLVQSD 357

Query: 360 KPVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESL 419
           K  S + H F+ +PQ L++V       L   S+ +AI++AE  L+G  RL++R SGTE L
Sbjct: 358 KKASELLHVFDPFPQLLKNVRYSSGQPLEDESVCEAISEAEESLKGKGRLLIRKSGTEPL 417

Query: 420 IRIMAEGDDLSRIKRIVDDLAKVI 443
           IR+MAE +D   + +IVD + + +
Sbjct: 418 IRVMAEAEDPDLVHQIVDHICETV 441


>gi|329891054|ref|ZP_08269397.1| phosphoglucosamine mutase [Brevundimonas diminuta ATCC 11568]
 gi|328846355|gb|EGF95919.1| phosphoglucosamine mutase [Brevundimonas diminuta ATCC 11568]
          Length = 449

 Score =  495 bits (1274), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 243/443 (54%), Positives = 323/443 (72%), Gaps = 1/443 (0%)

Query: 2   KRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRR-VVIGKDTRLSGYMLEN 60
           +R++FGTDGIRG++NT P+T    +R+G+A G LFR     R  VVIGKDTRLSGYM+E 
Sbjct: 3   ERKYFGTDGIRGRANTHPMTAEVALRVGLAAGRLFRTDDDRRHLVVIGKDTRLSGYMIEP 62

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +LVAG  + GMD    GP+P+P VAM+TRS+RAD+G+MISASHN Y DNGIKLFGPDGYK
Sbjct: 63  ALVAGLASVGMDVRTFGPLPTPGVAMMTRSMRADLGIMISASHNDYADNGIKLFGPDGYK 122

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +S +IE +IE +++  L   L+  + +G  KR+D    RYIE  K+  P+ ++L+GLRI 
Sbjct: 123 LSDEIELKIEAMMDGALDEDLAPSNKLGRVKRIDDAPPRYIEIAKQAFPKRLSLKGLRIA 182

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           +DCANGA Y+VAP   +ELGA+V  +G +PNG+NIN +CGST+  ++   V   R DIGI
Sbjct: 183 IDCANGAGYRVAPTTLYELGAEVFPVGVEPNGLNINAECGSTHPEAVSEAVKRYRCDIGI 242

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           ALDGD DRVII DEKG +V+GDQIMALI  +W     L GNG+V TVMSN+GLER +   
Sbjct: 243 ALDGDADRVIICDEKGHVVDGDQIMALIGLDWAKRGRLNGNGVVATVMSNLGLERRLKAE 302

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           GL+L+RT+VGDRY+ME M+  GFN+GGEQSGHIIL D+ +TGDGL+AALQVL  + +   
Sbjct: 303 GLTLERTKVGDRYVMERMREGGFNIGGEQSGHIILKDHATTGDGLMAALQVLAVLVEAGV 362

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
           P+S +   FE  PQ L++V       L  + +  A+A+AE+ L G  RL+VR SGTE LI
Sbjct: 363 PMSELARQFEPVPQLLQNVRYTAGKPLEDAKVKAAMAEAEAALNGSGRLLVRPSGTEKLI 422

Query: 421 RIMAEGDDLSRIKRIVDDLAKVI 443
           R+MAEGDD + +KR+V+++A+ +
Sbjct: 423 RVMAEGDDEALVKRVVNEVAEAV 445


>gi|329113824|ref|ZP_08242595.1| Phosphoglucosamine mutase [Acetobacter pomorum DM001]
 gi|326696834|gb|EGE48504.1| Phosphoglucosamine mutase [Acetobacter pomorum DM001]
          Length = 452

 Score =  494 bits (1273), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 234/445 (52%), Positives = 322/445 (72%), Gaps = 2/445 (0%)

Query: 3   RRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLF-RGKKKHRRVVIGKDTRLSGYMLENS 61
           +RFFGTDGIRG +N  P+T     ++G A G  F RG  +H  V++GKDTRLSGYM+E++
Sbjct: 5   KRFFGTDGIRGTANVAPMTVEIAQKLGQAAGLHFKRGDHRHS-VLLGKDTRLSGYMIESA 63

Query: 62  LVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKV 121
           +V+GF +AGMD  ++GP+P+PA+AMLTRSLRAD+GVMISASHNP+ DNGIKLFGPDG+K+
Sbjct: 64  MVSGFLSAGMDVTLVGPLPTPAIAMLTRSLRADLGVMISASHNPFGDNGIKLFGPDGFKL 123

Query: 122 STDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVV 181
           S   E  IE L+E DLT+YL+  + IG A R++    RYIE  K + PR + L G++IV+
Sbjct: 124 SDQDESEIEALMEKDLTAYLATPEHIGRASRLNDAAGRYIESAKASFPRKLRLDGMKIVI 183

Query: 182 DCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIA 241
           DCANG++Y+VAP   WELGA+V+ IG +PNG+NIN  CGST+  +L   V + +AD+GIA
Sbjct: 184 DCANGSAYRVAPTALWELGAEVIRIGCEPNGVNINEKCGSTHPEALCAAVVKHKADLGIA 243

Query: 242 LDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLG 301
           LDGD DRV+I DE G +++GDQI+ALIA+ W     L G  +V TVMSN+GLERF+  LG
Sbjct: 244 LDGDADRVLIADETGRLIDGDQILALIAQSWAREGRLVGKAVVATVMSNMGLERFLENLG 303

Query: 302 LSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKP 361
           L+L+RT VGDRY++E M     N+GGEQSGH++L+D+ +TGDGL+AALQ+L  + Q  +P
Sbjct: 304 LNLERTAVGDRYVVERMLERQANIGGEQSGHMVLTDFATTGDGLIAALQILAVLVQDGRP 363

Query: 362 VSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLIR 421
            S +C  F+ +PQ L++V  K    L+   +    AD E +L G  RL++R SGTE L+R
Sbjct: 364 ASEVCRLFQPFPQKLKNVRYKGVCPLDVDEVKSRQADVERKLAGRGRLVLRKSGTEPLVR 423

Query: 422 IMAEGDDLSRIKRIVDDLAKVIPMI 446
           +MAE +D + +  +VD +  V+  +
Sbjct: 424 VMAEAEDANLVDEVVDQMCDVLEQV 448


>gi|304321222|ref|YP_003854865.1| phosphoglucomutase/phosphomannomutase family protein [Parvularcula
           bermudensis HTCC2503]
 gi|303300124|gb|ADM09723.1| phosphoglucomutase/phosphomannomutase family protein [Parvularcula
           bermudensis HTCC2503]
          Length = 454

 Score =  494 bits (1272), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 240/442 (54%), Positives = 315/442 (71%)

Query: 2   KRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENS 61
           +RR FGTDG+RG +N  P+ P+ ++R+G+A G  FR  +   RVVIGKDTRLSGYM+E +
Sbjct: 9   ERRIFGTDGVRGLANKGPLAPDQLLRLGMAAGRHFRRGQHRHRVVIGKDTRLSGYMIEPA 68

Query: 62  LVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKV 121
           L AGF A GMD  +LGP+P+PA A++TRS+RAD+GVMISASHNPY DNGIK FGPDG+K+
Sbjct: 69  LTAGFIATGMDVILLGPLPTPATALMTRSMRADLGVMISASHNPYHDNGIKFFGPDGFKL 128

Query: 122 STDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVV 181
           S   E  IE L+ED   + L   +++G A R+D    RYIE  K TLPR ++ +GLRIV+
Sbjct: 129 SDTTELTIERLMEDGAETGLCGPENLGRASRIDDAGARYIEFAKSTLPRRLSFEGLRIVL 188

Query: 182 DCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIA 241
           DCA+GA+YKVAP V +ELGA+V  IG  P+G NIN   GST+ L LQ  V E RADIGIA
Sbjct: 189 DCAHGAAYKVAPTVLYELGAEVKSIGVNPDGFNINRGVGSTDPLKLQDMVLEYRADIGIA 248

Query: 242 LDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLG 301
           LDGD DRVI+ DE G +++GDQI+A IA       LLRG G+V+TVMSNIG E ++   G
Sbjct: 249 LDGDADRVIMCDENGKLIDGDQILAAIATSLAEQDLLRGGGVVSTVMSNIGFELYLKKCG 308

Query: 302 LSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKP 361
           L L RT+VGDRY++E M+    NVGGE SGH++LSDY STGDGL+ ALQ+L  + + +KP
Sbjct: 309 LDLTRTKVGDRYVVEQMRARDINVGGEPSGHVVLSDYTSTGDGLITALQILGLVAETEKP 368

Query: 362 VSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLIR 421
           VS +C  FE +P  L++V       L + ++  AIA+ ++ L G  R ++R SGTE +IR
Sbjct: 369 VSEVCSLFEPFPSVLKNVRFTSGDPLAAETVKAAIAEGKALLGGEGRTVIRKSGTEPVIR 428

Query: 422 IMAEGDDLSRIKRIVDDLAKVI 443
           +MAEG D   ++R+VDD+   I
Sbjct: 429 VMAEGPDAGLVERVVDDICDAI 450


>gi|85709355|ref|ZP_01040420.1| phosphomannomutase [Erythrobacter sp. NAP1]
 gi|85688065|gb|EAQ28069.1| phosphomannomutase [Erythrobacter sp. NAP1]
          Length = 445

 Score =  494 bits (1272), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 244/438 (55%), Positives = 321/438 (73%), Gaps = 4/438 (0%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLF-RGKKKHRRVVIGKDTRLSGYMLE 59
           M R+FFGTDGIRG++N   +T    M++G A G+ F RG  +HR VVIGKDTRLSGYM+E
Sbjct: 1   MARKFFGTDGIRGRTNAGVMTAATAMKVGQAAGHYFVRGGHRHR-VVIGKDTRLSGYMME 59

Query: 60  NSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGY 119
           ++LVAGFT+ GMD  + GP+P+PA+AMLTR +RAD+GVMISASHN + DNGIKLFGPDG+
Sbjct: 60  SALVAGFTSVGMDVIMTGPLPTPAIAMLTREMRADLGVMISASHNLFPDNGIKLFGPDGF 119

Query: 120 KVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRI 179
           K+S + E  IE LL  D    L   + IG A+R++    RY+  +K+++  D+   GL++
Sbjct: 120 KLSDEAESEIEALL--DQEPQLVEAEKIGRARRIEDARGRYLNAIKQSVGSDIRFDGLKV 177

Query: 180 VVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIG 239
           VVDCA+GA+Y+VAP   WELGA+VV +G +PNGININ   GST + ++Q KV E  ADIG
Sbjct: 178 VVDCAHGAAYQVAPSAIWELGAEVVTLGVEPNGININDGVGSTAIEAVQAKVVEEGADIG 237

Query: 240 IALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAG 299
           IALDGD DR+I+VDEKG  V+GDQIMA IA        L G G+V TVMSN+GLER++ G
Sbjct: 238 IALDGDADRLIVVDEKGRKVDGDQIMAAIATRMHEKGALTGGGVVATVMSNLGLERYLGG 297

Query: 300 LGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYD 359
           LGL+L+RT+VGDRY++E MK  GFNVGGEQSGH+IL D+ +TGDG VAAL+V+  + +  
Sbjct: 298 LGLTLERTKVGDRYVLERMKEGGFNVGGEQSGHMILLDHATTGDGTVAALRVIASLVRSG 357

Query: 360 KPVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESL 419
           KP S I H FE  PQ L++V     + L + ++   IA+ E EL G  RL++R SGTE +
Sbjct: 358 KPASEILHKFEPVPQLLKNVRYDAGAPLENKTVKAVIAEVEGELEGKGRLVIRPSGTEPV 417

Query: 420 IRIMAEGDDLSRIKRIVD 437
           IR+MAEGDD S+++ +VD
Sbjct: 418 IRVMAEGDDSSQVENVVD 435


>gi|23015577|ref|ZP_00055349.1| COG1109: Phosphomannomutase [Magnetospirillum magnetotacticum MS-1]
          Length = 451

 Score =  491 bits (1265), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 247/447 (55%), Positives = 320/447 (71%), Gaps = 5/447 (1%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLF-RGKKKHRRVVIGKDTRLSGYMLE 59
           M R+ FGTDGIRG +NT P+T    M++G+A G  F RG+ +H  VVIGKDTRLSGY++E
Sbjct: 1   MTRKLFGTDGIRGTANTDPMTAEMAMKLGMAAGRHFTRGEHRHV-VVIGKDTRLSGYLIE 59

Query: 60  NSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGY 119
            +L AGF + GMD  +LGP+P+PAVAMLTRS+RAD+GVMISASHNPYQDNGIKLFGPDG+
Sbjct: 60  PALTAGFISVGMDVVLLGPLPTPAVAMLTRSMRADLGVMISASHNPYQDNGIKLFGPDGF 119

Query: 120 KVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRI 179
           K+S + E  IE  + + L S     D +G AKR+D    RYIE+ K T PR + L GL+I
Sbjct: 120 KLSDEDELTIEAAMFNGLESCRVGSDHLGRAKRLDDAAGRYIEYAKFTFPRGLRLDGLKI 179

Query: 180 VVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIG 239
           VVDCANGA+YKVAP V WELGA+V+ +   P+G NIN +CGS +  +++ +V    A +G
Sbjct: 180 VVDCANGAAYKVAPTVLWELGAEVIPVAVNPDGFNINKNCGSLHTETMREQVVTHGAHLG 239

Query: 240 IALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAG 299
           IALDGD DRV++ DE+G +++GDQ+MALI   W     L+G GIV TVMSN+GLERF+  
Sbjct: 240 IALDGDADRVVLCDEQGHLIDGDQLMALIGDLWHRSGQLKGGGIVATVMSNLGLERFLGQ 299

Query: 300 LGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYD 359
            GL   RT VGDRY++E+M+  GFNVGGEQSGHIILSD+ +TGDGLVA LQVL  + Q  
Sbjct: 300 RGLKTIRTNVGDRYVLEHMRREGFNVGGEQSGHIILSDHSTTGDGLVAGLQVLAALVQSG 359

Query: 360 KPVSTICHCFEEYPQFLRSVSVKDTS---ILNSSSIVQAIADAESELRGIDRLIVRASGT 416
           KP S +   F   PQ L++V V   S   +L + ++  AI DAE+ L G  RL++R SGT
Sbjct: 360 KPASEMLRLFTPLPQVLKNVRVSKGSVAEVLAAPAVEAAIKDAEARLVGQGRLLIRKSGT 419

Query: 417 ESLIRIMAEGDDLSRIKRIVDDLAKVI 443
           E LIR+MAEG+D + ++  VD + + I
Sbjct: 420 EPLIRVMAEGEDQTLVEATVDGIVEHI 446


>gi|114327776|ref|YP_744933.1| phosphoglucosamine mutase [Granulibacter bethesdensis CGDNIH1]
 gi|122327258|sp|Q0BT42|GLMM_GRABC RecName: Full=Phosphoglucosamine mutase
 gi|114315950|gb|ABI62010.1| phosphoglucosamine mutase [Granulibacter bethesdensis CGDNIH1]
          Length = 457

 Score =  490 bits (1262), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 250/443 (56%), Positives = 319/443 (72%), Gaps = 2/443 (0%)

Query: 2   KRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLF-RGKKKHRRVVIGKDTRLSGYMLEN 60
           ++R FGTDGIRG +NT P+T    +R+G A G LF RG  +HR V+IGKDTRLSGYM+E 
Sbjct: 3   QKRLFGTDGIRGTANTAPMTAEIALRVGQAAGLLFTRGDHRHR-VIIGKDTRLSGYMIEP 61

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +L AGF  AGMD  ++GP+P+PA+AMLTRSLRAD+GVMISASHNPY+DNGIKLFGPDG K
Sbjct: 62  ALTAGFIGAGMDVTLVGPLPTPAIAMLTRSLRADLGVMISASHNPYEDNGIKLFGPDGEK 121

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +S   E  IE LL  DL+  L+   ++G A R++    RYIE  K T P+   L GL+IV
Sbjct: 122 LSDATEMEIERLLHADLSGQLAAPAALGRAARLEDAAGRYIESAKSTFPKSQRLDGLKIV 181

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           +DCANGA+Y+VAP V WELGA V+ +G  P+G NIN  CGST    L  +V +  AD+GI
Sbjct: 182 LDCANGAAYRVAPTVLWELGATVIPLGVSPDGFNINSGCGSTAPDYLCAQVVKHGADLGI 241

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           ALDGD DR+++ DE+G +V+GDQI+ALIAR W +   LRG+G+V TVMSN+GLERF+   
Sbjct: 242 ALDGDADRLLVSDERGHLVDGDQIIALIARSWSASGRLRGDGVVATVMSNLGLERFLKAN 301

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           GL L RT VGDRY+ E M+  G N+GGEQSGH+ILSDY +TGDGL+AALQ+L  + +  +
Sbjct: 302 GLILDRTRVGDRYVAEQMRATGRNIGGEQSGHVILSDYATTGDGLIAALQILSVLVEEGR 361

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
           P S  C  F   PQ L++V     + L    + QAIADAES L G  RL++R SGTE LI
Sbjct: 362 PASETCRVFAPLPQKLKNVRYHRDNPLLHPRVKQAIADAESGLNGHGRLLIRRSGTEPLI 421

Query: 421 RIMAEGDDLSRIKRIVDDLAKVI 443
           R+MAE +D + + RIVD+L  +I
Sbjct: 422 RVMAEAEDETTVIRIVDELCDII 444


>gi|84501304|ref|ZP_00999509.1| Phosphoglucomutase/phosphomannomutase [Oceanicola batsensis
           HTCC2597]
 gi|84390595|gb|EAQ03083.1| Phosphoglucomutase/phosphomannomutase [Oceanicola batsensis
           HTCC2597]
          Length = 442

 Score =  490 bits (1261), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 237/440 (53%), Positives = 311/440 (70%), Gaps = 3/440 (0%)

Query: 5   FFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSLVA 64
            FGTDG+RG++NT P+T    MR+  A G  FR  ++  RVVIGKDTRLSGYMLEN+L A
Sbjct: 1   MFGTDGVRGRTNTHPMTAELAMRLAAAAGRFFRRDQQEHRVVIGKDTRLSGYMLENALTA 60

Query: 65  GFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVSTD 124
           GFT+ GM+ F+LGP+P+PAV  LTRS+RADVGVMISASHNP +DNGIK FGPDG+K+S D
Sbjct: 61  GFTSTGMNVFLLGPVPTPAVGFLTRSMRADVGVMISASHNPAEDNGIKFFGPDGFKLSDD 120

Query: 125 IEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVVDCA 184
            E  IE L+E  ++  L+    IG AKR+D    RY+E+VK T PR   L GLRIVVDCA
Sbjct: 121 AETEIERLMEAGVS--LAHPQRIGRAKRIDDSGSRYVEYVKTTFPRQFRLDGLRIVVDCA 178

Query: 185 NGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIALDG 244
           NGA+++V P + WELGADV+ +G  PNG+NIN  CGST+      KV E RAD+G+ LDG
Sbjct: 179 NGAAHRVGPSILWELGADVIPVGTSPNGLNINDKCGSTHPDLAAAKVLETRADVGLCLDG 238

Query: 245 DGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLGLSL 304
           D DR+I++D+ G  V+GDQIM LIA  W     L G+ +VTTVMSN+GLERF+   G+++
Sbjct: 239 DADRLILIDQNGQRVDGDQIMGLIASRWKEDGRLAGDTLVTTVMSNLGLERFLESRGIAI 298

Query: 305 KRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKPVST 364
           +RT+VGDRY++E M+  GFN+GGEQSGHI+++D+ +TGDGLVAALQVL  + +     S 
Sbjct: 299 ERTKVGDRYVVERMRQGGFNLGGEQSGHIVMTDHATTGDGLVAALQVLAAMVETGARASD 358

Query: 365 ICHCFEEYPQFLRSVS-VKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLIRIM 423
           +   F   PQ L +V     T  L+  S+ QAIAD E +L    RL++R SGTE LIR+M
Sbjct: 359 LLRVFTPIPQVLHNVRYASGTEPLDRDSVRQAIADGEKKLGTSGRLLIRKSGTEPLIRVM 418

Query: 424 AEGDDLSRIKRIVDDLAKVI 443
            E +D   +  ++D + + +
Sbjct: 419 GEAEDQDTLHSVLDTICRAV 438


>gi|288962720|ref|YP_003453014.1| phosphoglucosamine mutase [Azospirillum sp. B510]
 gi|288914986|dbj|BAI76470.1| phosphoglucosamine mutase [Azospirillum sp. B510]
          Length = 457

 Score =  489 bits (1258), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 244/445 (54%), Positives = 310/445 (69%), Gaps = 2/445 (0%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M R  FGTDGIRG +N  P+T    +R+ +A    FR      RVVIGKDTRLSGY+LE 
Sbjct: 1   MTRHLFGTDGIRGTANIDPMTAETALRVAMATALQFRRGDHRHRVVIGKDTRLSGYLLEP 60

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +L AGF + GMD  ++GP+P+PAVAMLTRSLRAD+GV+ISASHNPYQDNGIKLFGPDGYK
Sbjct: 61  ALTAGFISMGMDVVLVGPLPTPAVAMLTRSLRADMGVVISASHNPYQDNGIKLFGPDGYK 120

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +S  +E  IE  +       L+   ++G A R+D    RYIE+VK T PR + L GL+IV
Sbjct: 121 LSDKVEAAIEARMALPFGPDLAAPAALGRASRLDDATGRYIEYVKNTFPRGLRLDGLKIV 180

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           VDCANGA+YKVAP+V +ELGADVV +G  P+G NIN  CG+T   +LQ +V    A +G+
Sbjct: 181 VDCANGAAYKVAPKVLYELGADVVPVGVTPDGTNINKGCGATATQTLQEQVVAHGAHLGV 240

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           ALDGD DR+I+VDE G  ++GDQ+M+LIA  W     LRG G+V TVMSN+G+ER + GL
Sbjct: 241 ALDGDADRLIMVDEAGRPIDGDQLMSLIATSWAHAQTLRGGGVVATVMSNLGMERHLGGL 300

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYD- 359
           GL L RT VGDRY++E M+  G+NVGGEQSGH++LSDY +TGDGL+AALQVL  + Q D 
Sbjct: 301 GLHLARTPVGDRYVVEMMRERGYNVGGEQSGHVVLSDYSTTGDGLIAALQVLAVLIQADG 360

Query: 360 KPVSTICHCFEEYPQFLRSVS-VKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTES 418
           +  S +C  F+  PQ L +V     T  L   ++ QAI + E  L    RL++R SGTE 
Sbjct: 361 RSASEVCRVFDPVPQKLTNVRFATGTKPLEDVAVQQAIKEGEGRLASGGRLLIRKSGTEP 420

Query: 419 LIRIMAEGDDLSRIKRIVDDLAKVI 443
           LIR+MAEGDD   +  +V D+A  I
Sbjct: 421 LIRVMAEGDDEVLVHSVVGDIADAI 445


>gi|162146634|ref|YP_001601093.1| phosphoglucosamine mutase [Gluconacetobacter diazotrophicus PAl 5]
 gi|209543374|ref|YP_002275603.1| phosphoglucosamine mutase [Gluconacetobacter diazotrophicus PAl 5]
 gi|226722754|sp|A9HB20|GLMM_GLUDA RecName: Full=Phosphoglucosamine mutase
 gi|161785209|emb|CAP54755.1| putative phosphoglucosamine mutase [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|209531051|gb|ACI50988.1| phosphoglucosamine mutase [Gluconacetobacter diazotrophicus PAl 5]
          Length = 452

 Score =  488 bits (1257), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 244/442 (55%), Positives = 314/442 (71%), Gaps = 2/442 (0%)

Query: 3   RRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLF-RGKKKHRRVVIGKDTRLSGYMLENS 61
           R  FGTDGIRG +N  P+T     ++G A G  F RG  +HR V++GKDTRLSGYM+E +
Sbjct: 5   RHLFGTDGIRGLANQDPMTVEIAQKLGQAAGLRFTRGVHRHR-VLLGKDTRLSGYMIECA 63

Query: 62  LVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKV 121
           LV+GF +AGMD  ++GP+P+PA+AMLTRSLRAD+GVMISASHNP+ DNGIKLFGPDG+K+
Sbjct: 64  LVSGFLSAGMDVTLVGPMPTPAIAMLTRSLRADLGVMISASHNPFGDNGIKLFGPDGFKL 123

Query: 122 STDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVV 181
           S + E  IE L+  DL   L+  D IG A R++    RYIE+ K + PR   L GLRIV+
Sbjct: 124 SDETEAEIEELMRSDLAGRLAAPDRIGRASRLNDAAGRYIENAKASFPRGRRLDGLRIVI 183

Query: 182 DCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIA 241
           DCANGA+Y+VAP   WELGA+V+ IG +P+GININ  CGST   SL   V    A IGIA
Sbjct: 184 DCANGAAYRVAPTALWELGAEVIRIGCEPDGININEQCGSTKPESLCEAVVAHGAHIGIA 243

Query: 242 LDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLG 301
           LDGD DRV+I DEKG +++GDQI+ALIAR W     L    IV TVMSN+GL R + GLG
Sbjct: 244 LDGDADRVLIADEKGRLIDGDQILALIARSWGRQGRLNSAQIVATVMSNMGLARCLEGLG 303

Query: 302 LSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKP 361
           L L RT VGDRY++E M+  G N+GGEQSGH++LSD+ +TGDGLVAALQVL  + +  +P
Sbjct: 304 LELVRTAVGDRYVVERMRELGANLGGEQSGHMVLSDFATTGDGLVAALQVLAVLVEEGRP 363

Query: 362 VSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLIR 421
            S +C  F  +PQ LR+V     S L++ S+  A   AE+EL    RL++R SGTE L+R
Sbjct: 364 ASEVCRMFTPFPQMLRNVRFTGKSPLHAPSVQDARRRAEAELGTAGRLLLRESGTEPLVR 423

Query: 422 IMAEGDDLSRIKRIVDDLAKVI 443
           +MAE +D + ++RIV ++ + I
Sbjct: 424 VMAEAEDPALVERIVAEMCEAI 445


>gi|83312298|ref|YP_422562.1| phosphoglucosamine mutase [Magnetospirillum magneticum AMB-1]
 gi|123541254|sp|Q2W2C2|GLMM_MAGMM RecName: Full=Phosphoglucosamine mutase
 gi|82947139|dbj|BAE52003.1| Phosphomannomutase [Magnetospirillum magneticum AMB-1]
          Length = 451

 Score =  488 bits (1256), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 246/447 (55%), Positives = 319/447 (71%), Gaps = 5/447 (1%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLF-RGKKKHRRVVIGKDTRLSGYMLE 59
           M R+ FGTDGIRG +NT P+T    M++G+A G  F RG  +H  VVIGKDTRLSGY+LE
Sbjct: 1   MTRKLFGTDGIRGTANTDPMTAEMAMKLGMAAGRHFTRGDHRHV-VVIGKDTRLSGYLLE 59

Query: 60  NSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGY 119
            +L AGF + GMD  +LGP+P+PAVA+LTRS+RAD+GVMISASHNPY+DNGIKLFGPDG+
Sbjct: 60  PALTAGFISVGMDVVLLGPLPTPAVALLTRSMRADLGVMISASHNPYEDNGIKLFGPDGF 119

Query: 120 KVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRI 179
           K+S + E  IE  + + L S     D +G AKR+D    RYIE+ K T PR + L GL+I
Sbjct: 120 KLSDEDELTIEASMSNGLESCRVGSDHLGRAKRLDDAAGRYIEYAKYTFPRGLRLDGLKI 179

Query: 180 VVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIG 239
           VVDCANGA+YKVAP V WELGA+V+ +   P+G NIN +CGS +  +++ +V    A +G
Sbjct: 180 VVDCANGAAYKVAPTVLWELGAEVIPVAVNPDGFNINKNCGSLHTETMREQVVAHGAHLG 239

Query: 240 IALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAG 299
           IALDGD DRV++ DE G +++GDQ+MALI   W     L+G GIV TVMSN+GLERF+  
Sbjct: 240 IALDGDADRVVLCDELGHMIDGDQLMALIGDLWHRSGQLKGGGIVATVMSNLGLERFLDQ 299

Query: 300 LGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYD 359
            GL   RT VGDRY++E+M+ +GFNVGGEQSGHIILSD+ +TGDGLVA LQVL  + Q  
Sbjct: 300 RGLKTIRTAVGDRYVLEHMRRDGFNVGGEQSGHIILSDHSTTGDGLVAGLQVLAALVQSG 359

Query: 360 KPVSTICHCFEEYPQFLRSVSVKDTS---ILNSSSIVQAIADAESELRGIDRLIVRASGT 416
           KP S +   F   PQ L++V V   S   +L + ++  AI DAE++L G  RL++R SGT
Sbjct: 360 KPASEMLRLFTPLPQVLKNVRVAKGSVAEVLAAPAVEAAIRDAEAKLAGQGRLLIRKSGT 419

Query: 417 ESLIRIMAEGDDLSRIKRIVDDLAKVI 443
           E LIR+MAEG+D   ++  VD + + I
Sbjct: 420 EPLIRVMAEGEDEGLVEASVDAIVETI 446


>gi|114571034|ref|YP_757714.1| phosphoglucosamine mutase [Maricaulis maris MCS10]
 gi|122315282|sp|Q0ALR7|GLMM_MARMM RecName: Full=Phosphoglucosamine mutase
 gi|114341496|gb|ABI66776.1| phosphoglucosamine mutase [Maricaulis maris MCS10]
          Length = 449

 Score =  485 bits (1249), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 240/448 (53%), Positives = 318/448 (70%), Gaps = 4/448 (0%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVG-YLFRGKKKHRRVVIGKDTRLSGYMLE 59
           M +++FGTDG+RG++N+FP+T    +R+G+A G Y  R   +H  VVIGKDTRLSGYM+E
Sbjct: 1   MGKKYFGTDGVRGQTNSFPMTAENALRLGMAAGRYFVRHTGRHS-VVIGKDTRLSGYMIE 59

Query: 60  NSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGY 119
           ++LVAGFT+ GMD F  GP+P+PAVA++TRSLRAD+GVMI+ASHNPY DNG+KLFGPDG 
Sbjct: 60  SALVAGFTSVGMDVFQFGPLPTPAVALMTRSLRADLGVMITASHNPYHDNGMKLFGPDGR 119

Query: 120 KVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRI 179
           K+    E  IE L++  L   L+    +G AKRVD    RY+E VK + PR   L  LR+
Sbjct: 120 KLDDKAELEIEALMDGSLVDGLAAPSDLGRAKRVDDAQARYVEIVKSSFPRAQRLSNLRL 179

Query: 180 VVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIG 239
           VVDCANGA YKVAP   WELGADV+ IG +PNG N+N +CGST    L ++V + RAD+G
Sbjct: 180 VVDCANGAGYKVAPAALWELGADVIPIGVEPNGFNVNEECGSTAPARLSKEVIKYRADLG 239

Query: 240 IALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAG 299
           IALDGDGDRV++ DEKG +++GDQI+ L+A  W     LR   IV+TVMSN+GLE+++AG
Sbjct: 240 IALDGDGDRVVLCDEKGRVIDGDQILGLLAGHWQDIGELRHPAIVSTVMSNLGLEQYLAG 299

Query: 300 LGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYD 359
            G++L+RT VGDRY+ E M+  G N+GGE SGHI++ DY  TGDGL+AALQVLR +    
Sbjct: 300 RGIALERTRVGDRYVSERMRETGINLGGEASGHIVMPDYSPTGDGLIAALQVLRVLGDSG 359

Query: 360 KPVSTICHCFEEYPQFLRSVSV-KDTSILNSSSIVQAIADAESELRGIDRLIVRASGTES 418
           K  S +   F+  PQ L +V V +    L S ++  AIA+AE  +    RL+VRASGTE 
Sbjct: 360 KRASELLKVFKPAPQLLENVRVPRGRKPLESEAVKAAIAEAEVRMGVAGRLVVRASGTEP 419

Query: 419 LIRIMAEGDDLSRIKRIVDDLAKVIPMI 446
           ++R+MAEG+    I+ +VDD+   I  +
Sbjct: 420 VVRVMAEGEQ-KLIRSVVDDVRGAIETV 446


>gi|119383297|ref|YP_914353.1| phosphoglucosamine mutase [Paracoccus denitrificans PD1222]
 gi|158705802|sp|A1AZG3|GLMM_PARDP RecName: Full=Phosphoglucosamine mutase
 gi|119373064|gb|ABL68657.1| phosphoglucosamine mutase [Paracoccus denitrificans PD1222]
          Length = 447

 Score =  484 bits (1247), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 234/445 (52%), Positives = 314/445 (70%), Gaps = 4/445 (0%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVG-YLFRGKKKHRRVVIGKDTRLSGYMLE 59
           M R+ FGTDG+RG++NT P+T    +R+G A G Y  R  + H RVVIGKDTRLSGYMLE
Sbjct: 1   MSRKLFGTDGVRGRANTHPMTAEMALRLGAAAGRYFRRSGEDHHRVVIGKDTRLSGYMLE 60

Query: 60  NSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGY 119
           N+L AG T+ GM+  +LGP+P+PAV  LTRS+RADVG+MISASHNP  DNGIK FGPDG+
Sbjct: 61  NALTAGLTSTGMNVLLLGPVPTPAVGYLTRSMRADVGIMISASHNPAHDNGIKFFGPDGF 120

Query: 120 KVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRI 179
           K+S + E RIE ++  ++    +   +IG AKR+D    RY+E+ K T P    L+GL++
Sbjct: 121 KLSDEAEARIEAIVAGEIIP--AQPQNIGRAKRIDDGRGRYVEYAKTTFPSGQRLEGLKV 178

Query: 180 VVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIG 239
           VVDCANGA+Y+ AP+V WELGA+V+ +G  PNG NIN   GST+  +  R V E  AD+G
Sbjct: 179 VVDCANGAAYRAAPDVLWELGAEVIPLGVSPNGHNINDGLGSTHPEACARAVLEHGADMG 238

Query: 240 IALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAG 299
           I+LDGD DRV+IVDEKG + +GDQIMAL+A  W +   LRG  +V TVMSN+GLERF+ G
Sbjct: 239 ISLDGDADRVMIVDEKGQVADGDQIMALLAARWAAQGRLRGGALVATVMSNLGLERFLQG 298

Query: 300 LGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYD 359
            GL L+RT VGDRY++E M+  GFN+GGEQSGHI+++DY +TGDGL+A+LQ L  +    
Sbjct: 299 RGLRLERTAVGDRYVVERMRGAGFNLGGEQSGHIVMTDYATTGDGLIASLQFLAALSDSG 358

Query: 360 KPVSTICHCFEEYPQFLRSVSVK-DTSILNSSSIVQAIADAESELRGIDRLIVRASGTES 418
           +  S +   FE  PQ L++V        L+  S+   IA AE+ L G  R+++R SGTE 
Sbjct: 359 QRASELVAQFEPVPQLLKNVRYAVGADPLSKDSVQAEIARAEARLNGSGRVLIRKSGTEP 418

Query: 419 LIRIMAEGDDLSRIKRIVDDLAKVI 443
           LIR+MAE +D + ++ +V+D+   +
Sbjct: 419 LIRVMAEAEDETVLREVVEDIVAAV 443


>gi|85706230|ref|ZP_01037325.1| Phosphoglucomutase/phosphomannomutase [Roseovarius sp. 217]
 gi|85669394|gb|EAQ24260.1| Phosphoglucomutase/phosphomannomutase [Roseovarius sp. 217]
          Length = 446

 Score =  482 bits (1241), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 234/438 (53%), Positives = 312/438 (71%), Gaps = 3/438 (0%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M  + FGTDG+RG++N++P+T +  +++G A G  FR  K+  RVVIGKDTR SGYM+E 
Sbjct: 1   MGAKLFGTDGVRGQANSWPMTADVALQLGAAAGRYFRRDKQEHRVVIGKDTRRSGYMIEY 60

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +L AGFT+ GM+ F+LGP+P+PA+  LT SLRADVGVMISASHNP  DNGIKLFGPDGYK
Sbjct: 61  ALTAGFTSTGMNVFLLGPVPTPAIGYLTHSLRADVGVMISASHNPASDNGIKLFGPDGYK 120

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +S ++E  I  LL  D  + L+  ++IG AKR+D    RY+E+ K T P    L+GLRIV
Sbjct: 121 LSDEVEAGIAQLL--DEGARLASPENIGRAKRIDDARGRYVEYAKTTFPHRRRLEGLRIV 178

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           +DCANGA+Y+ APEV WELGA+V+ +G +P+G NINLDCGST   +  RKV E RAD+GI
Sbjct: 179 LDCANGAAYRTAPEVLWELGAEVITMGVEPDGFNINLDCGSTKPQAAARKVLETRADLGI 238

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
            LDGD DRV+++DE+G I +GDQ MALIA  W     L GN +V TVMSN+GLER +   
Sbjct: 239 CLDGDADRVVLIDEEGKIADGDQFMALIATRWAREGRLAGNTLVATVMSNLGLERHLEAQ 298

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           G++L+RT VGDRY++E M+  G N+GGEQSGHI+++DY +TGDGL+ ALQ L  + +  +
Sbjct: 299 GINLRRTAVGDRYVVEAMRAGGHNLGGEQSGHIVMTDYATTGDGLIGALQFLAAMVETGE 358

Query: 361 PVSTICHCFEEYPQFLRSVS-VKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESL 419
             S +   FE  PQ L +V   K    + S ++  A+A AE  L G  RL+VR SGTE L
Sbjct: 359 KASGLAQVFEPVPQKLINVRFAKGKDPMASDAVQSAMAAAEKLLGGDGRLLVRPSGTEPL 418

Query: 420 IRIMAEGDDLSRIKRIVD 437
           IR+MAE  + + + +++D
Sbjct: 419 IRVMAEALNPAVLDQVMD 436


>gi|94497429|ref|ZP_01303999.1| phosphoglucosamine mutase [Sphingomonas sp. SKA58]
 gi|94423060|gb|EAT08091.1| phosphoglucosamine mutase [Sphingomonas sp. SKA58]
          Length = 427

 Score =  481 bits (1239), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 246/425 (57%), Positives = 309/425 (72%), Gaps = 4/425 (0%)

Query: 20  ITPNFMMRIGIAVGYLF-RGKKKHRRVVIGKDTRLSGYMLENSLVAGFTAAGMDAFILGP 78
           +TP+  M++G+A G  F RG  +HR VVIGKDTRLSGYM+EN+LVAGFTA GMD    GP
Sbjct: 1   MTPDLAMKVGMAAGTHFQRGSHRHR-VVIGKDTRLSGYMVENALVAGFTAVGMDVVQFGP 59

Query: 79  IPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVSTDIEDRIETLLEDDLT 138
           IP+PAVA+L  S+RAD+GVMISASHNP+ DNGIKLFGPDGYK+S + E +IE LL  D T
Sbjct: 60  IPTPAVALLAHSMRADLGVMISASHNPFYDNGIKLFGPDGYKLSDEDELKIEALL--DQT 117

Query: 139 SYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVVDCANGASYKVAPEVFWE 198
             L+    IG A+RV+    RYI  VK + P D+ L GL+IVVDCANGA+Y+VAP   WE
Sbjct: 118 IELAASKDIGRARRVEDARGRYIHAVKSSFPADLRLDGLKIVVDCANGAAYQVAPSALWE 177

Query: 199 LGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIALDGDGDRVIIVDEKGAI 258
           LGA VV IG  PNG NIN  CGST+ + LQ  V    ADIGIALDGD DR+I+VDEKG +
Sbjct: 178 LGATVVAIGVSPNGTNINDSCGSTSPMLLQETVVSSGADIGIALDGDADRLIVVDEKGRL 237

Query: 259 VNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLGLSLKRTEVGDRYIMEYM 318
           V+GDQIMALIA  + +   LRG G+V TVMSN+GLERF+A  G++L+RT+VGDRY++E M
Sbjct: 238 VDGDQIMALIAANFAAAGTLRGGGLVATVMSNLGLERFLADKGITLERTKVGDRYVLERM 297

Query: 319 KNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKPVSTICHCFEEYPQFLRS 378
           +  GFNVGGEQSGH+ILSDY +TGDG VAALQVL  + +  KP S   H F+  PQ L++
Sbjct: 298 REGGFNVGGEQSGHMILSDYATTGDGTVAALQVLAALVRSGKPASETLHKFDPVPQLLKN 357

Query: 379 VSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLIRIMAEGDDLSRIKRIVDD 438
           V       L    + + IA AE+EL G+ RL++R SGTE +IR+MAEGD   +++ +VD 
Sbjct: 358 VRFAGGKPLEHEEVQRVIAQAETELAGVGRLVIRPSGTEPVIRVMAEGDSEDQVRDVVDR 417

Query: 439 LAKVI 443
           +   +
Sbjct: 418 ICAAV 422


>gi|296283044|ref|ZP_06861042.1| phosphoglucosamine mutase [Citromicrobium bathyomarinum JL354]
          Length = 445

 Score =  481 bits (1238), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 236/443 (53%), Positives = 314/443 (70%), Gaps = 2/443 (0%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M R++FGTDGIRG++N   +T    MR+  A G  FR      RVVIGKDTRLSGYM+EN
Sbjct: 1   MARKYFGTDGIRGETNKGAMTATMAMRVAQAAGAHFRRGDHRHRVVIGKDTRLSGYMVEN 60

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +LVAGFT+ G++    GP+P+PA+AMLTR +RAD+GVMISASHNPYQDNGIKLFGPDG+K
Sbjct: 61  ALVAGFTSMGVNVIQTGPLPTPAIAMLTREMRADLGVMISASHNPYQDNGIKLFGPDGFK 120

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +S + E  IE L+  D    L     IG A+R++    RYI  VK+++        L++V
Sbjct: 121 LSDEDEAAIEALI--DQEPELVPASEIGRARRIEDSRGRYIHAVKQSVSDKTRFDDLKVV 178

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           VDCANGA+Y+VAP   WELGA+V+ +G  PNG NIN   GST++ +++ KV E  ADIGI
Sbjct: 179 VDCANGAAYQVAPSAIWELGAEVITLGVDPNGTNINDGVGSTSLDAVKAKVVETGADIGI 238

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           ALDGD DR+I++DEKG  ++GDQIMA IA        LRG G+V TVMSN+GLER++ G 
Sbjct: 239 ALDGDADRLIVIDEKGEAIDGDQIMASIATRMAEKGQLRGGGVVATVMSNLGLERYLEGK 298

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           GL+L+RT+VGDRY++  M++ GFNVGGEQSGH+IL D+ +TGDG VAA++VL  + + ++
Sbjct: 299 GLTLERTKVGDRYVLGRMRSGGFNVGGEQSGHMILLDHATTGDGTVAAMRVLASLVRSNR 358

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
           P S     FE  PQ L++V     S L++ ++  AI DAE  L G  RL++RASGTE LI
Sbjct: 359 PASEELRMFEPVPQLLKNVRYDGASPLDAETVKAAIKDAERALAGKGRLVIRASGTEPLI 418

Query: 421 RIMAEGDDLSRIKRIVDDLAKVI 443
           R+MAEGDD   ++++VD +   +
Sbjct: 419 RVMAEGDDAGEVEQVVDAVCDAV 441


>gi|85374876|ref|YP_458938.1| phosphoglucosamine mutase [Erythrobacter litoralis HTCC2594]
 gi|122543842|sp|Q2N850|GLMM_ERYLH RecName: Full=Phosphoglucosamine mutase
 gi|84787959|gb|ABC64141.1| phosphomannomutase [Erythrobacter litoralis HTCC2594]
          Length = 452

 Score =  481 bits (1237), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 235/441 (53%), Positives = 311/441 (70%), Gaps = 2/441 (0%)

Query: 3   RRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSL 62
           R+FFGTDGIRG++NT  +TP   MR+  A G  FR      RVVIGKDTRLSGYM+E +L
Sbjct: 10  RKFFGTDGIRGETNTGNMTPEIAMRVAQAAGEYFRRGDHRHRVVIGKDTRLSGYMMEAAL 69

Query: 63  VAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVS 122
           VAGFT+ GMD    GP+P+PAVA+LT+ +RAD+GVMISASHNPY+DNGIKLFGPDG+K+S
Sbjct: 70  VAGFTSVGMDVIQTGPLPTPAVALLTKEMRADLGVMISASHNPYRDNGIKLFGPDGFKLS 129

Query: 123 TDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVVD 182
            + E  IE  +  +    L     IG A+R++    RYI  +K+++  +     L++VVD
Sbjct: 130 DETELAIEQGIVSE--PALVPAAEIGRARRIEDSRGRYIHALKQSVSDETRFDSLKVVVD 187

Query: 183 CANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIAL 242
           CANGA+Y+VAP   WELGA+++ +G  PNG NIN   GST++ +++R V E  ADIGIAL
Sbjct: 188 CANGAAYQVAPSAIWELGAEIITLGVTPNGTNINDGVGSTSLDAIKRTVVEEGADIGIAL 247

Query: 243 DGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLGL 302
           DGD DR+I++DEKG  V+GDQIM LIA        LRG G+V TVMSN+GLER++    L
Sbjct: 248 DGDADRLIVIDEKGEAVDGDQIMGLIATRMAEKQALRGGGVVATVMSNLGLERYLDSKNL 307

Query: 303 SLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKPV 362
            L+RT+VGDRY++E MK  GFN+GGEQSGH+IL D+ +TGDG VAAL+VL  +    KP 
Sbjct: 308 RLERTQVGDRYVLERMKTGGFNIGGEQSGHMILLDHATTGDGTVAALRVLASLVNSGKPA 367

Query: 363 STICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLIRI 422
           S + H FE+ PQ L++V  +    L+  S+  AIADAE  L G  RL++R SGTE +IR+
Sbjct: 368 SEVLHVFEKVPQLLKNVRYEGGRPLDKDSVQTAIADAEKALDGKGRLVIRPSGTEPVIRV 427

Query: 423 MAEGDDLSRIKRIVDDLAKVI 443
           MAEGDD  +++ +VD +   +
Sbjct: 428 MAEGDDADQVETVVDQICDAV 448


>gi|260433237|ref|ZP_05787208.1| phosphoglucosamine mutase [Silicibacter lacuscaerulensis ITI-1157]
 gi|260417065|gb|EEX10324.1| phosphoglucosamine mutase [Silicibacter lacuscaerulensis ITI-1157]
          Length = 448

 Score =  481 bits (1237), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 235/437 (53%), Positives = 309/437 (70%), Gaps = 4/437 (0%)

Query: 3   RRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKH-RRVVIGKDTRLSGYMLENS 61
           R+ FGTDG+RG +NT+P+T    +RIG AVG  FR  +    RVVIGKDTRLSGYMLE++
Sbjct: 2   RKLFGTDGVRGTANTYPMTAEMALRIGAAVGRYFRRDRTGVHRVVIGKDTRLSGYMLESA 61

Query: 62  LVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKV 121
           L AG T+ GM+  +LGP+P+PAV ++TRS+RAD+GVMISASHNP +DNGIK FGPDG+K+
Sbjct: 62  LTAGLTSTGMNVLLLGPVPTPAVGLMTRSMRADLGVMISASHNPAEDNGIKFFGPDGFKL 121

Query: 122 STDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVV 181
           S   E  IETL+E  +    +   +IG A+RVD    RY E VK +LPRD+ L GL++V+
Sbjct: 122 SDQAELEIETLIEAGVQPAQA--QNIGRARRVDDARFRYGERVKSSLPRDLRLDGLKVVI 179

Query: 182 DCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIA 241
           DCANGA+++ APEV WELGA+V+ +G  PNG NINL CGST        V    AD+GI 
Sbjct: 180 DCANGAAHRTAPEVLWELGAEVIPVGTAPNGKNINLGCGSTQPRVAAEAVVAHGADVGIC 239

Query: 242 LDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLG 301
           LDGD DRV+IVDE G + +GDQ+MAL+A  W S   L+G  +V TVMSN+GLERF+   G
Sbjct: 240 LDGDADRVVIVDETGQVADGDQLMALLATAWASSERLKGGALVATVMSNLGLERFLGARG 299

Query: 302 LSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKP 361
           L L+RT VGDRY++E M+  GFN+GGEQSGHI++SDY +TGDGL+A L  L  +    + 
Sbjct: 300 LRLERTAVGDRYVVERMREGGFNLGGEQSGHIVMSDYATTGDGLMAGLHFLAEMVNSGRK 359

Query: 362 VSTICHCFEEYPQFLRSVSVKD-TSILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
            S +   FE  PQ L++V   +  + L + ++  AIADAE+ L G  RL++R SGTE LI
Sbjct: 360 ASDLAQQFETVPQLLKNVRYGEGQAPLEADTVKAAIADAEARLNGRGRLLIRKSGTEPLI 419

Query: 421 RIMAEGDDLSRIKRIVD 437
           R+MAE +D   + ++VD
Sbjct: 420 RVMAECEDDVLLAQVVD 436


>gi|294676761|ref|YP_003577376.1| phosphoglucosamine mutase [Rhodobacter capsulatus SB 1003]
 gi|294475581|gb|ADE84969.1| phosphoglucosamine mutase [Rhodobacter capsulatus SB 1003]
          Length = 448

 Score =  480 bits (1236), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 231/446 (51%), Positives = 317/446 (71%), Gaps = 6/446 (1%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFR--GKKKHRRVVIGKDTRLSGYML 58
           M R+ FGTDG+RG++N++P+T    +++G A G  FR  G+  HR VVIGKDTRLSGYML
Sbjct: 1   MTRKLFGTDGVRGEANSWPMTAEMALKLGAAAGRYFRRDGRNGHR-VVIGKDTRLSGYML 59

Query: 59  ENSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDG 118
           EN+L AG T+ GM+  +LGP+P+PAV  LTRS+RAD+G+MISASHNP +DNGIK FGPDG
Sbjct: 60  ENALTAGLTSTGMNVLLLGPVPTPAVGYLTRSMRADLGIMISASHNPAKDNGIKFFGPDG 119

Query: 119 YKVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLR 178
           +K+S + E  IE L+  ++   L+   +IG AKR+D    RY+E+ K T P    L GL+
Sbjct: 120 FKLSDEAELEIEALVAGEI--RLAQPMNIGRAKRIDDGLGRYVEYAKTTFPARDRLAGLK 177

Query: 179 IVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADI 238
           +V+DCA+GA+YK AP+V WELG +V+ IG KPNG+NIN  CGST+  +    V    AD+
Sbjct: 178 VVIDCAHGAAYKAAPQVLWELGCEVIEIGTKPNGLNINDKCGSTHTRAAAEAVVAHGADL 237

Query: 239 GIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIA 298
           GI+LDGD DRV+I+DE G + +GDQIMAL A  W    LLRG  +V TVMSN+GLERF+ 
Sbjct: 238 GISLDGDADRVMILDENGLVADGDQIMALFAARWAEAGLLRGGALVATVMSNLGLERFLT 297

Query: 299 GLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQY 358
           G GL+L+RT VGDRY++E M+  GFN+GGEQSGHI+++DY +TGDGL+A LQ L  + + 
Sbjct: 298 GRGLALERTAVGDRYVVERMRAGGFNLGGEQSGHIVMTDYATTGDGLMAGLQFLAAMAET 357

Query: 359 DKPVSTICHCFEEYPQFLRSVSVK-DTSILNSSSIVQAIADAESELRGIDRLIVRASGTE 417
            KP S +   FE  PQ L++V  K   + L++ ++ + IA+AE ++ G  R+++R SGTE
Sbjct: 358 GKPASELTRQFETVPQMLKNVKFKAGQAPLDNENVRKVIAEAEGKIAGQGRILIRKSGTE 417

Query: 418 SLIRIMAEGDDLSRIKRIVDDLAKVI 443
            LIR+MAE +D   +   V+ +   +
Sbjct: 418 PLIRVMAECEDAGLLTETVEGIVAAV 443


>gi|126725584|ref|ZP_01741426.1| phosphoglucosamine mutase [Rhodobacterales bacterium HTCC2150]
 gi|126704788|gb|EBA03879.1| phosphoglucosamine mutase [Rhodobacterales bacterium HTCC2150]
          Length = 447

 Score =  480 bits (1235), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 234/446 (52%), Positives = 312/446 (69%), Gaps = 6/446 (1%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFR--GKKKHRRVVIGKDTRLSGYML 58
           M R+FFGTDG+RG++NT+P+T    +++G A G  FR  G   HR VVIGKDTRLSGYM 
Sbjct: 1   MTRKFFGTDGVRGRANTYPMTAELALKLGAAAGRYFRRDGSPAHR-VVIGKDTRLSGYMF 59

Query: 59  ENSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDG 118
           EN+L AGFT+ GM+  +LGP+P+PAV +LT S+RADVGVMISASHNP+ DNGIK FGPDG
Sbjct: 60  ENALTAGFTSTGMNVLLLGPVPTPAVGLLTTSMRADVGVMISASHNPHTDNGIKFFGPDG 119

Query: 119 YKVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLR 178
           +K+S + E  IE LL  D+   ++  ++IG AKR+D    RY E  K T P D  L GL+
Sbjct: 120 FKLSDETEKEIEALLMGDIEPVMA--ENIGRAKRIDDGRFRYQERAKTTFPSDQRLDGLK 177

Query: 179 IVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADI 238
           +V+DCANGA+YK APEV WELGA V+ IG  PNG NIN DCGST+  +    V    AD+
Sbjct: 178 VVIDCANGAAYKAAPEVLWELGAKVIPIGTSPNGNNINKDCGSTHTETAAAAVVAHGADV 237

Query: 239 GIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIA 298
           GI LDGD DRV+I+DE G + +GDQ+MALIA+ W +   L+G+ +V TVMSN+GLER +A
Sbjct: 238 GICLDGDADRVMIIDEAGNVADGDQLMALIAKRWANDGRLKGHALVATVMSNLGLERELA 297

Query: 299 GLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQY 358
              ++L RT+VGDRY++E M+   FN+GGEQSGHI+++D+ +TGDGL+A LQ L  + + 
Sbjct: 298 KSSIALHRTDVGDRYVVEAMRKGSFNLGGEQSGHIVMTDHATTGDGLIAGLQFLSEMIRT 357

Query: 359 DKPVSTICHCFEEYPQFLRSVSVKD-TSILNSSSIVQAIADAESELRGIDRLIVRASGTE 417
            +P S +   FE  PQ L++V  +   + L   S+  +I DAE  L G  RL++R SGTE
Sbjct: 358 GQPASELTRQFEPCPQLLKNVRFETGQTPLEIQSVKDSIKDAEKRLIGNGRLLIRKSGTE 417

Query: 418 SLIRIMAEGDDLSRIKRIVDDLAKVI 443
            LIR+MAE +D   +  +VD +   +
Sbjct: 418 PLIRVMAECEDEGTLNEVVDSVVSAV 443


>gi|255263894|ref|ZP_05343236.1| phosphoglucosamine mutase [Thalassiobium sp. R2A62]
 gi|255106229|gb|EET48903.1| phosphoglucosamine mutase [Thalassiobium sp. R2A62]
          Length = 446

 Score =  479 bits (1233), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 229/438 (52%), Positives = 311/438 (71%), Gaps = 6/438 (1%)

Query: 3   RRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFR--GKKKHRRVVIGKDTRLSGYMLEN 60
           R+ FGTDG+RG +N +P+T    ++IG A G  FR  G   HR VVIGKDTRLSGYM EN
Sbjct: 2   RKLFGTDGVRGTANQYPMTAEMALKIGAAAGRYFRNDGSNGHR-VVIGKDTRLSGYMFEN 60

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +L AG T+ GM+  +LGP+P+PAV ++T S+RADVGVMISASHNP+ DNGIK FGPDG+K
Sbjct: 61  ALTAGLTSTGMNVLLLGPVPTPAVGLMTTSMRADVGVMISASHNPHHDNGIKFFGPDGFK 120

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +S + E  IE L+  DL    +  ++IG AKRVD    RY E VK T P    L G+++V
Sbjct: 121 LSDEAEAEIEALVFSDLVPAQA--NNIGRAKRVDDARFRYQERVKSTFPSGQRLDGMKVV 178

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           +DCANGA+++ APEV WELGA+V+ +G  PNG NIN +CGST+  +    +    AD+GI
Sbjct: 179 IDCANGAAHRCAPEVLWELGAEVIPVGTSPNGYNINENCGSTSTQTAADAIVSHNADVGI 238

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
            LDGD DRV+++DE G + +GDQ+MAL+A  W    +LRG  +V TVMSN+GLER +   
Sbjct: 239 CLDGDADRVMVLDENGQVCDGDQLMALMATRWAEMDMLRGGALVATVMSNLGLERHLEAK 298

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           GL L+RT VGDRY++E M+N G+N+GGEQSGHI+++DY +TGDGL+A LQ L  +++  K
Sbjct: 299 GLRLERTGVGDRYVVEAMRNGGYNLGGEQSGHIVMTDYTTTGDGLIAGLQFLSEMQRSGK 358

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTS-ILNSSSIVQAIADAESELRGIDRLIVRASGTESL 419
           P S +   FE  PQ L++V     S  LN++ +  AIA AE++L G  RL++R SGTE L
Sbjct: 359 PASALSRTFEPVPQLLKNVRYDAGSDPLNAALVKAAIAQAEADLVGTGRLLIRKSGTEPL 418

Query: 420 IRIMAEGDDLSRIKRIVD 437
           +R+MAE +D + ++++VD
Sbjct: 419 VRVMAECEDNALLEQVVD 436


>gi|126735424|ref|ZP_01751170.1| Phosphoglucomutase/phosphomannomutase [Roseobacter sp. CCS2]
 gi|126715979|gb|EBA12844.1| Phosphoglucomutase/phosphomannomutase [Roseobacter sp. CCS2]
          Length = 456

 Score =  478 bits (1231), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 231/440 (52%), Positives = 312/440 (70%), Gaps = 6/440 (1%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFR--GKKKHRRVVIGKDTRLSGYML 58
           M R+FFGTDG+RGK+NT P+T +  ++IG A G  FR  G   HR VVIGKDTRLSGYM 
Sbjct: 10  MTRKFFGTDGVRGKANTHPMTADMALKIGAAAGRYFRNDGSNGHR-VVIGKDTRLSGYMF 68

Query: 59  ENSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDG 118
           EN+L AG T+ GM+  +LGP+P+PAV +LT S+RADVG+MISASHNP+ DNGIK FGPDG
Sbjct: 69  ENALTAGLTSTGMNVLLLGPVPTPAVGLLTTSMRADVGIMISASHNPHHDNGIKFFGPDG 128

Query: 119 YKVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLR 178
           +K+S + E  IETL+  ++    +   +IG AKR+D    RY E +K T P  + L GL+
Sbjct: 129 FKLSDEAETEIETLIASEIEPAKA--QNIGRAKRIDDGRFRYAERIKSTFPAGMRLDGLK 186

Query: 179 IVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADI 238
           +V+DCANGA+Y+VAPEV WELGA V+ +G  P+G NIN  CGST+  +  + + E  A +
Sbjct: 187 VVIDCANGAAYRVAPEVLWELGATVIPVGVSPDGFNINDGCGSTSTAAASKAILEEGAHV 246

Query: 239 GIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIA 298
           GI LDGD DRV+I+DEKG + +GDQ+MAL+A  W     L G  +V TVMSN+GLER++ 
Sbjct: 247 GICLDGDADRVMILDEKGQVADGDQLMALMAGRWADQDRLNGGTLVATVMSNLGLERYLD 306

Query: 299 GLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQY 358
           G GL L RT VGDRY++E M+ NG+N+GGEQSGHI+++D+ +TGDGL+A LQ L  + + 
Sbjct: 307 GRGLHLTRTAVGDRYVVEAMRANGWNLGGEQSGHIVMTDFATTGDGLLAGLQFLAAMIET 366

Query: 359 DKPVSTICHCFEEYPQFLRSVS-VKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTE 417
            +P S +   FE  PQ L++V        L +  + ++IAD ES+L G  RL++R SGTE
Sbjct: 367 GQPASALTKSFETVPQMLKNVRYAAGQDPLGAELVQKSIADGESKLVGKGRLLIRKSGTE 426

Query: 418 SLIRIMAEGDDLSRIKRIVD 437
            LIR+MAE +D + + ++VD
Sbjct: 427 PLIRVMAECEDDALLAQVVD 446


>gi|89070589|ref|ZP_01157873.1| Phosphoglucomutase/phosphomannomutase [Oceanicola granulosus
           HTCC2516]
 gi|89043806|gb|EAR50007.1| Phosphoglucomutase/phosphomannomutase [Oceanicola granulosus
           HTCC2516]
          Length = 449

 Score =  477 bits (1228), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 229/440 (52%), Positives = 313/440 (71%), Gaps = 6/440 (1%)

Query: 3   RRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFR--GKKKHRRVVIGKDTRLSGYMLEN 60
           R  FGTDG+RG +NT+P+T +  ++IG A G  FR  G   HR VVIGKDTRLSGYM EN
Sbjct: 2   RTLFGTDGVRGTANTWPMTADMALKIGAAAGRYFRNDGSNGHR-VVIGKDTRLSGYMFEN 60

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +L AG T+ GM+  +LGP+P+PAV +LT S+RAD+G+MISASHNP++DNGIK FGPDG+K
Sbjct: 61  ALTAGLTSTGMNVLLLGPVPTPAVGLLTTSMRADLGIMISASHNPHEDNGIKFFGPDGFK 120

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +S   E  IE L+  DL   +    +IG A+RVD    RY E VK T P+ + L GL++V
Sbjct: 121 LSDAAEAEIEALVSADLAPAMP--GNIGRARRVDDGRFRYAERVKATFPQGMRLDGLKVV 178

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           +DCANGA++KVAPEV WELGADV+ +G  PNG+NIN +CGST+  +    +    ADIGI
Sbjct: 179 IDCANGAAHKVAPEVLWELGADVIPVGTSPNGLNINQNCGSTSTGTAAETIVAHGADIGI 238

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
            LDGD DRV+I+DE GA+ +GDQ+MAL A  W     LR   +V TVMSN+GLERF+ G 
Sbjct: 239 CLDGDADRVMILDETGAVADGDQVMALFADRWARQQRLRDGTLVATVMSNLGLERFLGGK 298

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           GL L+RT+VGDRY++E M++ G+N+GGEQSGHI+++DY +TGDGL+A LQ L  + + D+
Sbjct: 299 GLKLQRTKVGDRYVVEAMRSGGWNLGGEQSGHIVMTDYATTGDGLLAGLQFLAAMIETDQ 358

Query: 361 PVSTICHCFEEYPQFLRSVSVKD-TSILNSSSIVQAIADAESELRGIDRLIVRASGTESL 419
           P S +   FE  PQ L++V  +     L++ S+  AI  A+ ++    R+++R SGTE L
Sbjct: 359 PASRLARNFERVPQLLQNVRYEPGQDPLSAESVQAAITAAQGDMGETGRVLIRKSGTEPL 418

Query: 420 IRIMAEGDDLSRIKRIVDDL 439
           +R+MAE +D + + R+V+ +
Sbjct: 419 VRVMAECEDEAMLARVVESI 438


>gi|114771726|ref|ZP_01449130.1| phosphoglucosamine mutase [alpha proteobacterium HTCC2255]
 gi|114547798|gb|EAU50688.1| phosphoglucosamine mutase [alpha proteobacterium HTCC2255]
          Length = 446

 Score =  477 bits (1227), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 227/447 (50%), Positives = 313/447 (70%), Gaps = 2/447 (0%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           +KR++FGTDG+RG +N FP+TP+  +++G A G  FR  +K  RVVIGKDTR S YM EN
Sbjct: 2   IKRKYFGTDGVRGLANAFPMTPDIALKLGAAAGRHFRKDQKQHRVVIGKDTRRSSYMFEN 61

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +L AGFT+ GMD ++LGP+P+PAV +LTRS+RADVGVMISASHN Y DNGIK FGP+G+K
Sbjct: 62  ALTAGFTSTGMDVYLLGPVPTPAVGVLTRSMRADVGVMISASHNSYLDNGIKFFGPEGFK 121

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +S  +E  IE LL+D++    S   +IG AKR+D    RY+E  K   PR   L GL++V
Sbjct: 122 LSDKVELEIEKLLDDEIEYAAS--QNIGMAKRIDDALGRYMEFAKSAFPRKKLLNGLKVV 179

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           VDCANGA+YK AP V WELGA+V+ IG  P+G NIN DCGST+  +  + V E  AD+GI
Sbjct: 180 VDCANGAAYKAAPIVLWELGAEVISIGVNPDGYNINKDCGSTHPQNAAKAVLEHNADVGI 239

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
            LDGD DR+I++D KG I +GDQ+M LIA +W S   L  N +V TVMSN+GLER++  L
Sbjct: 240 CLDGDADRLILIDNKGNIADGDQLMGLIASQWSSKGNLANNTLVATVMSNMGLERYLNTL 299

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
            + L RT VGDRY++E M+  G+N+GGEQSGHI+++DY +TGDGL+AALQ L  + +   
Sbjct: 300 DIKLLRTNVGDRYVVEAMRKFGYNLGGEQSGHIVMTDYATTGDGLMAALQFLNALVESKC 359

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
             S +   FE  PQ LR+V + ++  L++  + ++I   E     I R+++R SGTE L+
Sbjct: 360 TSSELIKVFEPMPQLLRNVRLNNSESLDNLKVKESIKAGEDAFGDIGRILIRKSGTEPLL 419

Query: 421 RIMAEGDDLSRIKRIVDDLAKVIPMID 447
           R+M E +D   +K ++ ++ + +  I+
Sbjct: 420 RVMGECEDPKLLKAVIGNIVETVDAIN 446


>gi|83859838|ref|ZP_00953358.1| phosphoglucomutase/phosphomannomutase family protein [Oceanicaulis
           alexandrii HTCC2633]
 gi|83852197|gb|EAP90051.1| phosphoglucomutase/phosphomannomutase family protein [Oceanicaulis
           alexandrii HTCC2633]
          Length = 455

 Score =  476 bits (1225), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 242/443 (54%), Positives = 317/443 (71%), Gaps = 3/443 (0%)

Query: 3   RRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRR-VVIGKDTRLSGYMLENS 61
           +R+FGTDGIRG++NT P+T    + +G+A    FR     R  VVIGKDTRLSGYMLEN+
Sbjct: 10  KRYFGTDGIRGRTNTAPMTAETALHLGMAAARFFRRSDDRRHTVVIGKDTRLSGYMLENA 69

Query: 62  LVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKV 121
           L AGFT+AGMD  + GP+P+PAVA LTRSLRAD+GVMI+ASHN Y+DNGIKLFGPDG+K+
Sbjct: 70  LTAGFTSAGMDVNLFGPLPTPAVATLTRSLRADLGVMITASHNLYEDNGIKLFGPDGFKL 129

Query: 122 STDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVV 181
           +   E  IE L++ D T  L+  + IG AKRVD    RY+E VK T PR + L GLRIVV
Sbjct: 130 NDQAELEIEALMDSDHTEALAQPNEIGRAKRVDDAQARYVEIVKATFPRHMRLSGLRIVV 189

Query: 182 DCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIA 241
           DCANGA+YKVAP V WELGADV+ I +KPNG NIN DCG+ + + L  +V   RAD+GIA
Sbjct: 190 DCANGAAYKVAPTVLWELGADVIPIHNKPNGQNINEDCGAVSPVGLSEEVLRYRADLGIA 249

Query: 242 LDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLG 301
           LDGD DRVI+ DE G I++GDQ++  IA  W     L  N IVTTVMSN+GLE+ +A   
Sbjct: 250 LDGDADRVILCDETGKIIDGDQLIGAIALAWKKAGKLSNNRIVTTVMSNMGLEQELAKHD 309

Query: 302 LSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKP 361
           + ++RT+VGDRY++E M+    N+GGEQSGHI++SD+ +TGD L+AALQVL  + +  + 
Sbjct: 310 IQMERTKVGDRYVVEAMRAGASNLGGEQSGHIVISDFATTGDALIAALQVLALLVEERRS 369

Query: 362 VSTICHCFEEYPQFLRSVSVKDTSI-LNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
            S + + F+  PQ L++V   + +  LN   ++ AIA+AE++L+   RL+VRASGTE +I
Sbjct: 370 ASEVLNVFKRAPQILKNVRYSNGACPLNHPDVMVAIAEAEAQLKDKGRLLVRASGTEPVI 429

Query: 421 RIMAEGDDLSRIKRIVDDLAKVI 443
           R+MAEG D   +   VD + K I
Sbjct: 430 RVMAEG-DTRLLNGAVDQICKAI 451


>gi|99082145|ref|YP_614299.1| phosphoglucosamine mutase [Ruegeria sp. TM1040]
 gi|123252193|sp|Q1GE79|GLMM_SILST RecName: Full=Phosphoglucosamine mutase
 gi|99038425|gb|ABF65037.1| phosphoglucosamine mutase [Ruegeria sp. TM1040]
          Length = 447

 Score =  476 bits (1224), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 229/443 (51%), Positives = 310/443 (69%), Gaps = 4/443 (0%)

Query: 3   RRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKH-RRVVIGKDTRLSGYMLENS 61
           R+ FGTDG+RGK+N  P+T    +RIG AVG  FR +     RVVIGKDTRLSGYM EN+
Sbjct: 2   RKLFGTDGVRGKANMHPMTAEMALRIGAAVGRYFRRENDTVHRVVIGKDTRLSGYMFENA 61

Query: 62  LVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKV 121
           L AG T+ GM+  +LGP+P+PAV ++TRS+RAD+GVMISASHNP +DNGIK FGPDGYK+
Sbjct: 62  LTAGLTSTGMNVLLLGPVPTPAVGLMTRSMRADLGVMISASHNPAEDNGIKFFGPDGYKL 121

Query: 122 STDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVV 181
           S ++E  +E L+E  +    +   +IG AKR+D    RY E VK +LPRD+ L GL++V+
Sbjct: 122 SDEVELELEALIEAGVEP--AQAQNIGRAKRIDDARFRYGERVKSSLPRDMRLDGLKVVI 179

Query: 182 DCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIA 241
           DCANGA+++ APE+ WELGADV+ +G  P+G+NIN  CGST   +    V    AD+GI 
Sbjct: 180 DCANGAAHRAAPEILWELGADVIPVGVSPDGLNINRGCGSTQPAAAAETVVAHGADVGIC 239

Query: 242 LDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLG 301
           LDGD DRV+++DE G + +GDQ+MAL+A  W +   L G  +V TVMSN+GLERF+   G
Sbjct: 240 LDGDADRVVVIDETGTVADGDQLMALLASAWSADGRLSGGALVATVMSNLGLERFLNERG 299

Query: 302 LSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKP 361
           + L+RT VGDRY++E M+  GFN+GGEQSGHI++SDY +TGDGL+A L  L  + +  + 
Sbjct: 300 IGLERTGVGDRYVVERMRQGGFNLGGEQSGHIVMSDYATTGDGLMAGLHFLAEMVRRGQK 359

Query: 362 VSTICHCFEEYPQFLRSVSVK-DTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
            S +   FE  PQ L++V  +   + L +  +  AIA+AE +L G  RL++R SGTE LI
Sbjct: 360 ASELARQFEPVPQLLKNVRFEAGQAPLEADQVQTAIAEAEKQLNGRGRLLIRKSGTEPLI 419

Query: 421 RIMAEGDDLSRIKRIVDDLAKVI 443
           R+MAE +D   + R VDD+   +
Sbjct: 420 RVMAESEDPVLLNRAVDDVVAAV 442


>gi|296535980|ref|ZP_06898126.1| phosphoglucosamine mutase [Roseomonas cervicalis ATCC 49957]
 gi|296263691|gb|EFH10170.1| phosphoglucosamine mutase [Roseomonas cervicalis ATCC 49957]
          Length = 459

 Score =  476 bits (1224), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 237/422 (56%), Positives = 303/422 (71%), Gaps = 2/422 (0%)

Query: 3   RRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLF-RGKKKHRRVVIGKDTRLSGYMLENS 61
           RR FGTDGIRG +N  P+  +  +R+G A G  F RG  +HR VVIGKDTRLSGYMLE +
Sbjct: 6   RRLFGTDGIRGVANRAPMDASTALRLGQAAGRFFNRGSHRHR-VVIGKDTRLSGYMLEPA 64

Query: 62  LVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKV 121
           L AGF  AGMD  ++GP+P+PA+AMLTRSLRAD+GVMISASHNP++DNGIKLFGPDG K+
Sbjct: 65  LTAGFVGAGMDVVLVGPLPTPAIAMLTRSLRADLGVMISASHNPFEDNGIKLFGPDGLKL 124

Query: 122 STDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVV 181
           S   E  IE L+  DL++ L     +G A R++    RYIE VK + P+  +L G+RIVV
Sbjct: 125 SDAEEAEIEALMAGDLSAQLVAPSRLGRASRLEDAAGRYIEAVKASFPKGRSLSGMRIVV 184

Query: 182 DCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIA 241
           DCA+GA+Y+VAP V WELGA+VV +G  P+G NIN +CGST    +   V E RAD+GIA
Sbjct: 185 DCAHGAAYRVAPTVLWELGAEVVPLGVAPDGFNINRECGSTAPTRMAELVRERRADLGIA 244

Query: 242 LDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLG 301
           LDGD DR+++ DEKG IV+GDQI+A++A  W +   LRG+ +V TVMSN+GLERF+   G
Sbjct: 245 LDGDADRLVLADEKGQIVDGDQILAVVAASWAAQGRLRGDAVVATVMSNLGLERFLHSTG 304

Query: 302 LSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKP 361
           L L RT+VGDRY+ E M+  G N+GGEQSGH+ILSD+G+TGDGLVAALQVL  + +  +P
Sbjct: 305 LKLLRTKVGDRYVSERMREAGCNLGGEQSGHMILSDFGTTGDGLVAALQVLAVLAEEGRP 364

Query: 362 VSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLIR 421
            S IC  F   PQ L +V     S L  + +  AIA A + L G  R+++R SGTE +IR
Sbjct: 365 ASEICRRFTPLPQRLVNVRYAGVSPLQDAGVQAAIAAASARLEGRGRILIRPSGTEPVIR 424

Query: 422 IM 423
           +M
Sbjct: 425 VM 426


>gi|84516917|ref|ZP_01004275.1| Phosphoglucomutase/phosphomannomutase [Loktanella vestfoldensis
           SKA53]
 gi|84509385|gb|EAQ05844.1| Phosphoglucomutase/phosphomannomutase [Loktanella vestfoldensis
           SKA53]
          Length = 447

 Score =  475 bits (1223), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 234/442 (52%), Positives = 311/442 (70%), Gaps = 6/442 (1%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFR--GKKKHRRVVIGKDTRLSGYML 58
           M R+FFGTDG+RG +N +P+T +  +RIG A G  FR  G   HR VVIGKDTRLSGYM 
Sbjct: 1   MTRKFFGTDGVRGTANIYPMTADMALRIGAAAGRYFRNDGSNGHR-VVIGKDTRLSGYMF 59

Query: 59  ENSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDG 118
           EN+L AG T+ GM+  +LGP+P+PAV +LT S+RADVG+MISASHNP+ DNGIK FGPDG
Sbjct: 60  ENALTAGLTSTGMNVLLLGPVPTPAVGLLTTSMRADVGIMISASHNPHHDNGIKFFGPDG 119

Query: 119 YKVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLR 178
           +K+S   E++IE L+  D+    +   +IG AKR+D    RY E +K T P  + L GL+
Sbjct: 120 FKLSDAAEEQIEALIASDVEPAKAA--NIGRAKRIDDGRFRYAERLKATFPAGMRLDGLK 177

Query: 179 IVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADI 238
           +VVDCANGA+YKVAPEV WELGA V+ +G  P+G NIN  CGST+     + + +  AD+
Sbjct: 178 VVVDCANGAAYKVAPEVLWELGATVIKVGVDPDGFNINDGCGSTHPERAAQVIRDTGADV 237

Query: 239 GIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIA 298
           GI LDGD DRV+I+DE GA+ +GDQIMAL+A  W +   L+G+ +V TVMSN+GLERF+ 
Sbjct: 238 GICLDGDADRVMILDETGAVADGDQIMALMAARWAAVGRLQGDTLVATVMSNLGLERFLD 297

Query: 299 GLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQY 358
             GL LKRT VGDRY++E M+  GFN+GGEQSGHI+++DY +TGDGL+A LQ L  +   
Sbjct: 298 AKGLHLKRTAVGDRYVVEAMRAGGFNLGGEQSGHIVMTDYATTGDGLLAGLQFLAAMIDT 357

Query: 359 DKPVSTICHCFEEYPQFLRSVS-VKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTE 417
               S +   F+  PQ L++V     T  L +  +  +IADAE +L G  RL++R SGTE
Sbjct: 358 GHKASVLARNFDTVPQMLKNVRFTAGTDPLATKRVAASIADAEIKLNGKGRLLIRKSGTE 417

Query: 418 SLIRIMAEGDDLSRIKRIVDDL 439
            LIR+MAE +D + + ++VD +
Sbjct: 418 PLIRVMAECEDDTLLAQVVDQI 439


>gi|254509672|ref|ZP_05121739.1| phosphoglucosamine mutase [Rhodobacteraceae bacterium KLH11]
 gi|221533383|gb|EEE36371.1| phosphoglucosamine mutase [Rhodobacteraceae bacterium KLH11]
          Length = 447

 Score =  475 bits (1222), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 232/437 (53%), Positives = 307/437 (70%), Gaps = 4/437 (0%)

Query: 3   RRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKH-RRVVIGKDTRLSGYMLENS 61
           R+ FGTDG+RG +NT P+T    +RIG AVG  FR       RVVIGKDTRLSGYMLEN+
Sbjct: 2   RKLFGTDGVRGTANTHPMTAEMALRIGAAVGRYFRRDASGVHRVVIGKDTRLSGYMLENA 61

Query: 62  LVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKV 121
           L AG T+ GM+  +LGP+P+PAV ++TRS+RAD+GVMISASHNP +DNGIK FGPDG+K+
Sbjct: 62  LTAGLTSTGMNVLLLGPVPTPAVGLMTRSMRADLGVMISASHNPAEDNGIKFFGPDGFKL 121

Query: 122 STDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVV 181
           S   E  IE L+E+ ++   +   +IG A+RVD    RY E VK +LPRDV L GL++V+
Sbjct: 122 SDQAEVEIERLIEEGVSPAQA--QNIGRARRVDDARFRYGERVKSSLPRDVRLDGLKVVI 179

Query: 182 DCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIA 241
           DCANGA+++ APEV WELGADV+ IG  P+G NINL CGST        V    AD+GI 
Sbjct: 180 DCANGAAHRTAPEVLWELGADVIPIGTAPDGKNINLGCGSTQPRVAAETVVAHGADVGIC 239

Query: 242 LDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLG 301
           LDGD DRV+++DE G + +GDQ+MAL+A  W     L+G  +V TVMSN+GLER +   G
Sbjct: 240 LDGDADRVVVIDETGKVADGDQLMALLASAWSKADQLKGGALVATVMSNLGLERHLTDQG 299

Query: 302 LSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKP 361
           L L+RT VGDRY++E M+  GFN+GGEQSGHI++SDY +TGDGL+A L  L  +   D+ 
Sbjct: 300 LRLERTAVGDRYVVERMRAGGFNLGGEQSGHIVMSDYATTGDGLMAGLHFLAEMVLSDRK 359

Query: 362 VSTICHCFEEYPQFLRSVS-VKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
            S +   FE  PQ L++V      + L ++++  AI +AE+ L G  RL++R SGTE LI
Sbjct: 360 ASELSRQFETVPQLLKNVRFTAGQAPLEAANVKSAITEAEARLNGQGRLLIRKSGTEPLI 419

Query: 421 RIMAEGDDLSRIKRIVD 437
           R+MAE +D + + ++VD
Sbjct: 420 RVMAECEDAALLTQVVD 436


>gi|163796937|ref|ZP_02190893.1| Phosphomannomutase [alpha proteobacterium BAL199]
 gi|159177684|gb|EDP62235.1| Phosphomannomutase [alpha proteobacterium BAL199]
          Length = 453

 Score =  475 bits (1222), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 233/446 (52%), Positives = 313/446 (70%), Gaps = 5/446 (1%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRR---VVIGKDTRLSGYM 57
           M R+ FGTDGIRG++NT P+T +  M++ +A G  FR  K H R    VIGKDTRLSGYM
Sbjct: 1   MARKLFGTDGIRGRANTEPMTADLAMKVAMAAGLHFR--KDHGRRPLAVIGKDTRLSGYM 58

Query: 58  LENSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPD 117
           LE ++VAGFTA GMD  ++GP+P+PAVAMLT SLRAD+GV+ISASHN + DNGIKLFGPD
Sbjct: 59  LEPAMVAGFTAIGMDVVLVGPMPTPAVAMLTPSLRADLGVVISASHNAFHDNGIKLFGPD 118

Query: 118 GYKVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGL 177
           GYK+S   E  IE  + D     L     +G A+R++    RYIE VK   P +++L GL
Sbjct: 119 GYKLSDAAELDIEARMGDLGAGALVGSRDLGRARRMEDAQGRYIEAVKAAFPSNLSLDGL 178

Query: 178 RIVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRAD 237
           ++VVDCANGA YKVAP V +ELGA+V+ IG +PNG NIN  CG+T   S++ +V E  AD
Sbjct: 179 KVVVDCANGAGYKVAPRVLYELGAEVIPIGVEPNGFNINDRCGATVPQSMRARVVEEGAD 238

Query: 238 IGIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFI 297
           +G+ALDGD DR+I+ DE G +++GDQ++ ++AR W     L+G G+V TVMSN+GLER++
Sbjct: 239 VGLALDGDADRLILADEIGQVIDGDQVLGMMARSWSESGRLKGGGVVATVMSNLGLERYL 298

Query: 298 AGLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQ 357
             + L L+RT VGDRY++E M ++G+NVGGEQSGH+I SDY  TGDGL+AALQVL  + +
Sbjct: 299 QSIDLKLERTAVGDRYVLERMHSDGYNVGGEQSGHMIFSDYAKTGDGLLAALQVLAVLIR 358

Query: 358 YDKPVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTE 417
             +P+S +   F   PQ L++        L ++++  AIAD E  L G  RL++R SGTE
Sbjct: 359 AGRPMSEVARVFAPLPQVLKNARYGGGDPLQTAAVKAAIADGERALNGTGRLLIRKSGTE 418

Query: 418 SLIRIMAEGDDLSRIKRIVDDLAKVI 443
            +IR+MAEG++   +  IVD +   I
Sbjct: 419 PVIRVMAEGENQRAVAGIVDAIVGAI 444


>gi|260426604|ref|ZP_05780583.1| phosphoglucosamine mutase [Citreicella sp. SE45]
 gi|260421096|gb|EEX14347.1| phosphoglucosamine mutase [Citreicella sp. SE45]
          Length = 447

 Score =  474 bits (1221), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 229/439 (52%), Positives = 309/439 (70%), Gaps = 4/439 (0%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKH-RRVVIGKDTRLSGYMLE 59
           M R+ FGTDG+RG +N FP+T    + IG A G  FR ++    RVVIGKDTRLSGYM E
Sbjct: 1   MTRKLFGTDGVRGTANAFPMTAEMALMIGAAAGRYFRRERAGVHRVVIGKDTRLSGYMFE 60

Query: 60  NSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGY 119
           N+L AG T+ GM   +LGP+P+PAV +LT ++RAD+G+MISASHNP  DNGIK FGPDG+
Sbjct: 61  NALTAGLTSTGMSVLLLGPVPTPAVGLLTPAMRADLGIMISASHNPADDNGIKFFGPDGF 120

Query: 120 KVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRI 179
           K+S ++E  IE L+E  +    +   +IG AKR+D    RY+E VK TLP  + L G+++
Sbjct: 121 KLSDEVEAEIEALVEAGVQPAQA--HNIGRAKRIDDGRFRYMERVKSTLPHGMRLDGMKV 178

Query: 180 VVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIG 239
           VVDCANGA+Y+ APEV WELGADV+ +G  PNG+NIN +CGST   +    V    AD+G
Sbjct: 179 VVDCANGAAYRTAPEVLWELGADVIPVGTSPNGLNINANCGSTRPQAAAEAVVAHGADVG 238

Query: 240 IALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAG 299
           I LDGD DR+I++DE G I +GDQIMAL+A  W     L    +V TVMSN+GLERF+  
Sbjct: 239 ICLDGDADRIILIDETGTIADGDQIMALMAARWAEEQRLHEGTLVATVMSNLGLERFLES 298

Query: 300 LGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYD 359
            GL L+RT+VGDRY++E M+ +G+N+GGEQSGHI+++DY +TGDGL+A LQ L  + +  
Sbjct: 299 RGLRLERTKVGDRYVVEAMRAHGWNLGGEQSGHIVMTDYATTGDGLMAGLQFLCEMVRTG 358

Query: 360 KPVSTICHCFEEYPQFLRSVSV-KDTSILNSSSIVQAIADAESELRGIDRLIVRASGTES 418
           +P S +   F   PQ L++V    D + L ++S+  AIA+AE+ L G  RL++R SGTE 
Sbjct: 359 QPASDLARNFAPVPQLLKNVRFGADKAPLEAASVQGAIAEAEAALTGKGRLLIRKSGTEP 418

Query: 419 LIRIMAEGDDLSRIKRIVD 437
           LIR+MAE +D + + ++VD
Sbjct: 419 LIRVMAECEDEALLAQVVD 437


>gi|89055216|ref|YP_510667.1| phosphoglucosamine mutase [Jannaschia sp. CCS1]
 gi|122498288|sp|Q28NS0|GLMM_JANSC RecName: Full=Phosphoglucosamine mutase
 gi|88864765|gb|ABD55642.1| phosphoglucosamine mutase [Jannaschia sp. CCS1]
          Length = 447

 Score =  474 bits (1220), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 234/446 (52%), Positives = 315/446 (70%), Gaps = 6/446 (1%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKK-HRRVVIGKDTRLSGYMLE 59
           M R+ FGTDG+RG++NT+P+T    +R+G A G  FR       RVVIGKDTRLSGYM+E
Sbjct: 1   MTRKLFGTDGVRGRANTYPMTAEIALRMGAAAGRYFRRDSSIAHRVVIGKDTRLSGYMIE 60

Query: 60  NSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGY 119
           N+L AG T+ GM+  +L P+P+PAV +LT S+RAD+G+MISASHNP +DNGIKLFGPDG+
Sbjct: 61  NALTAGLTSTGMNVLLLSPVPTPAVGLLTPSMRADLGIMISASHNPAEDNGIKLFGPDGF 120

Query: 120 KVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRV-DGVHDRYIEHVKRTLPRDVTLQGLR 178
           K+S ++E  IE L+  D+   L+    IG AK V DG+  RYIE VK T P ++ L GL+
Sbjct: 121 KLSDEVEAEIEALMASDIP--LAPAAEIGRAKHVYDGLF-RYIERVKSTFPTELRLDGLK 177

Query: 179 IVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADI 238
           +VVDCANGA+Y+ APEV WELGADVV +G +P+G+NINL CGST   +   K+ EV A +
Sbjct: 178 VVVDCANGAAYRAAPEVLWELGADVVAMGVEPDGLNINLGCGSTKPEAAAAKIREVGAHV 237

Query: 239 GIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIA 298
           GI LDGD DRV+++DE G + +GDQIMAL A+ W     L+G  +  TVMSN+GLERF+A
Sbjct: 238 GICLDGDADRVVLIDETGQVADGDQIMALFAKRWADEGRLKGRTLAATVMSNLGLERFLA 297

Query: 299 GLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQY 358
              + L RT VGDRY++E M+  GFN+GGEQSGHI+++DY +TGDGL+A LQ L  + + 
Sbjct: 298 DESIVLHRTAVGDRYVVEAMRAGGFNLGGEQSGHIVMTDYATTGDGLIAGLQFLAEMVRT 357

Query: 359 DKPVSTICHCFEEYPQFLRSVSVK-DTSILNSSSIVQAIADAESELRGIDRLIVRASGTE 417
            +  ST+ H FE  PQ L++V      + L++ ++  AIA  E  L G  RL++R SGTE
Sbjct: 358 GQSASTLAHNFETVPQVLKNVRFDVGAAPLDAPAVQAAIAAGEERLTGSGRLLIRKSGTE 417

Query: 418 SLIRIMAEGDDLSRIKRIVDDLAKVI 443
            LIR+MAE +D + +  +VDD+   +
Sbjct: 418 PLIRVMAEAEDEALMTAVVDDIVGAV 443


>gi|83950837|ref|ZP_00959570.1| Phosphoglucomutase/phosphomannomutase [Roseovarius nubinhibens ISM]
 gi|83838736|gb|EAP78032.1| Phosphoglucomutase/phosphomannomutase [Roseovarius nubinhibens ISM]
          Length = 451

 Score =  472 bits (1214), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 234/446 (52%), Positives = 311/446 (69%), Gaps = 6/446 (1%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFR--GKKKHRRVVIGKDTRLSGYML 58
           M R++FGTDGIRG +N FP+T +  +RIG A G  FR  G   HR VVIGKDTR SGYML
Sbjct: 1   MARKYFGTDGIRGTANQFPMTADNALRIGAAAGRHFRKDGLNGHR-VVIGKDTRRSGYML 59

Query: 59  ENSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDG 118
           EN+L AG T+ GM+  +LGPIP+PAV  LTRS+RAD+G+MISASHNP+ DNGIK FGPDG
Sbjct: 60  ENALTAGLTSTGMNVLLLGPIPTPAVGFLTRSMRADLGIMISASHNPHHDNGIKFFGPDG 119

Query: 119 YKVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLR 178
           +K+S   E  IE +LE D+T   +   +IG AKR++    RY+E+ K T PRD  L GL+
Sbjct: 120 FKLSDTDEAAIEAILEGDVTP--AQPGNIGRAKRIESGRGRYVEYAKTTFPRDQRLSGLK 177

Query: 179 IVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADI 238
           IVVDCANGA+Y VAPEV WELGA+V+ +G  P+G NIN DCGST   +  R+V +  AD+
Sbjct: 178 IVVDCANGAAYHVAPEVLWELGAEVIPVGVTPDGFNINADCGSTAPQTAAREVLKHGADL 237

Query: 239 GIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIA 298
           GI LDGD DR+I++DEKG + +GDQIMAL A  W + + L    +V TVMSN+GLE FI 
Sbjct: 238 GICLDGDADRIILIDEKGQVADGDQIMALFASRWAAQNALAHGTLVATVMSNLGLENFIK 297

Query: 299 GLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQY 358
           G GL+L+RT VGDR+++E M+  GFN+GGEQSGHI+++D+ +TGDGL+A LQ L  + + 
Sbjct: 298 GKGLTLERTAVGDRHVVERMRAGGFNLGGEQSGHIVMTDFATTGDGLIAGLQFLSAMVES 357

Query: 359 DKPVSTICHCFEEYPQFLRSVSVKDTS-ILNSSSIVQAIADAESELRGIDRLIVRASGTE 417
            +  S +   F   PQ L +V     S  L +  +  AIA  E  +    R+++R SGTE
Sbjct: 358 GQRASELVQNFAPVPQILENVRFDAGSDPLGAERVQSAIAAQEKRIADRGRILIRKSGTE 417

Query: 418 SLIRIMAEGDDLSRIKRIVDDLAKVI 443
            LIR+MAE +D + ++ +V ++A  +
Sbjct: 418 PLIRVMAECEDETLLREVVGEIAGAV 443


>gi|149913091|ref|ZP_01901625.1| hypothetical protein RAZWK3B_03845 [Roseobacter sp. AzwK-3b]
 gi|149813497|gb|EDM73323.1| hypothetical protein RAZWK3B_03845 [Roseobacter sp. AzwK-3b]
          Length = 446

 Score =  472 bits (1214), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 226/444 (50%), Positives = 313/444 (70%), Gaps = 3/444 (0%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M ++ FGTDG+RG++N++P+T    +++G A G  FR   +  RVVIGKDTRLSGYM+EN
Sbjct: 1   MSQKLFGTDGVRGRANSWPMTAEIALKLGAAAGRYFRRDTQEHRVVIGKDTRLSGYMIEN 60

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +L AGFT+ GM+ F+LGP+P+PA+  LT  LRADVGVMISASHNP  DNGIK FGPDG+K
Sbjct: 61  ALTAGFTSTGMNVFLLGPMPTPAIGYLTHGLRADVGVMISASHNPASDNGIKFFGPDGFK 120

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +S + E  IE L+ + + +  +  ++IG AKR D    RY+E+ K T P    L GLRIV
Sbjct: 121 LSDEAEAGIEALMMEGVQA--AAPENIGRAKRFDDAMGRYVEYAKTTFPSRRRLDGLRIV 178

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           VDCANGA+YK AP V WELGA+V+ +G +P+G NIN +CGST+  +  +KV E RADIGI
Sbjct: 179 VDCANGAAYKTAPAVLWELGAEVISMGVEPDGSNINRNCGSTHPEAAAKKVIETRADIGI 238

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
            LDGD DRV+++DEKG I +GDQIM LIA  W     L G+ +V TVMSN+GLER++   
Sbjct: 239 CLDGDADRVVLIDEKGQIADGDQIMGLIAGRWHQEGRLAGDALVATVMSNLGLERYLNDR 298

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           G+ +KRT VGDRY++E M+  G ++GGEQSGHI+++DY +TGDGL+ ALQ L  + +  +
Sbjct: 299 GIGMKRTAVGDRYVVEAMRAGGHSLGGEQSGHIVMTDYATTGDGLIGALQFLACMVETGQ 358

Query: 361 PVSTICHCFEEYPQFLRSVSVKD-TSILNSSSIVQAIADAESELRGIDRLIVRASGTESL 419
             ST+ H F+  PQ L ++  +   + L + ++ +AIA  E  L    RL++R SGTE L
Sbjct: 359 KASTLAHVFDPVPQKLINLRYESGKTPLEAEAVKEAIAMGEKALGRDGRLLIRKSGTEPL 418

Query: 420 IRIMAEGDDLSRIKRIVDDLAKVI 443
           IR+MAE  D + + ++++D+   +
Sbjct: 419 IRVMAEAVDPAMLDKVLNDVVAAV 442


>gi|114766649|ref|ZP_01445590.1| phosphoglucosamine mutase [Pelagibaca bermudensis HTCC2601]
 gi|114541112|gb|EAU44166.1| phosphoglucosamine mutase [Roseovarius sp. HTCC2601]
          Length = 447

 Score =  471 bits (1213), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 229/439 (52%), Positives = 308/439 (70%), Gaps = 4/439 (0%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKH-RRVVIGKDTRLSGYMLE 59
           M R+ FGTDG+RG +NTFP+T    + IG A G  FR ++    RVVIGKDTRLSGYM E
Sbjct: 1   MTRKLFGTDGVRGTANTFPMTAEMALMIGAAAGRYFRREQGGVHRVVIGKDTRLSGYMFE 60

Query: 60  NSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGY 119
           N+L AG T+ GM+  +LGP+P+PAV +LT S+RAD+G+MISASHNP  DNGIK FGPDG+
Sbjct: 61  NALTAGLTSTGMNVLLLGPVPTPAVGLLTPSMRADLGIMISASHNPADDNGIKFFGPDGF 120

Query: 120 KVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRI 179
           K+S + E  IE L+E  +    +   +IG AKR+D    RY E +K TLP  + L G+++
Sbjct: 121 KLSDEAEAEIEALVEAGVAPAQA--GNIGRAKRIDDGRFRYQERLKGTLPHGMRLDGMKV 178

Query: 180 VVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIG 239
           VVDCANGA+YK APEV WELGADV+ +G  PNG+NIN +CGST   +    V    AD+G
Sbjct: 179 VVDCANGAAYKTAPEVLWELGADVIPLGTSPNGLNINDNCGSTKPQAAAEAVVAHGADVG 238

Query: 240 IALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAG 299
           I LDGD DR++++DE G I +GDQIMAL+A  W     L    +V TVMSN+GLERF+ G
Sbjct: 239 ICLDGDADRILLIDETGTIADGDQIMALMAARWAEEDRLVDGTLVATVMSNLGLERFLTG 298

Query: 300 LGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYD 359
            GL L+RT+VGDRY++E M+  G+N+GGEQSGHI+++DY +TGDGL+A +Q L  + +  
Sbjct: 299 RGLRLERTKVGDRYVVEAMRAKGWNLGGEQSGHIVMTDYATTGDGLMAGMQFLAEMVRTG 358

Query: 360 KPVSTICHCFEEYPQFLRSVS-VKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTES 418
           +P S +   FE  PQ L++V      + L ++ +  AIA+AE+ L G  RL++R SGTE 
Sbjct: 359 QPASRLARRFEPVPQLLQNVRFAAGQTPLEAARVQGAIAEAEATLSGKGRLLIRKSGTEP 418

Query: 419 LIRIMAEGDDLSRIKRIVD 437
           LIR+MAE +D + + R+V+
Sbjct: 419 LIRVMAECEDEALLSRVVE 437


>gi|126741348|ref|ZP_01757024.1| phosphoglucosamine mutase [Roseobacter sp. SK209-2-6]
 gi|126717553|gb|EBA14279.1| phosphoglucosamine mutase [Roseobacter sp. SK209-2-6]
          Length = 453

 Score =  471 bits (1211), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 229/443 (51%), Positives = 309/443 (69%), Gaps = 4/443 (0%)

Query: 3   RRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKH-RRVVIGKDTRLSGYMLENS 61
           R+FFGTDG+RG +N  P+T    +RIG AVG  FR +     RVVIGKDTRLSGYM EN+
Sbjct: 2   RKFFGTDGVRGTANIHPMTAEMALRIGAAVGRYFRREAGGVHRVVIGKDTRLSGYMFENA 61

Query: 62  LVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKV 121
           L AG T+ GM+  +LGP+P+PAV ++TRS+RAD+GVMISASHNP QDNGIK FGPDG+K+
Sbjct: 62  LTAGLTSTGMNVLLLGPVPTPAVGLMTRSMRADLGVMISASHNPAQDNGIKFFGPDGFKL 121

Query: 122 STDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVV 181
           S   E  IE L+E+ +    +   +IG AKR+D    RY E VK +LPR + L GL++V+
Sbjct: 122 SDQAELEIEALIENGVAP--AQPQNIGRAKRIDDARFRYGERVKSSLPRGIRLDGLKVVL 179

Query: 182 DCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIA 241
           DCANGA++++APEV WELGADVV +G  P+G+NIN DCGST   +    V   RAD+GI 
Sbjct: 180 DCANGAAHRIAPEVLWELGADVVPLGIAPDGVNINHDCGSTKPEAAAATVVAHRADVGIC 239

Query: 242 LDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLG 301
           LDGD DRVI++DE G + +GDQ+MAL+A  W    LL  N +V TVMSN+GLER +   G
Sbjct: 240 LDGDADRVILIDENGQVADGDQLMALLAGRWAKADLLAQNTLVATVMSNLGLERCLEAQG 299

Query: 302 LSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKP 361
           L L RT VGDRY++E M+  G+N+GGEQSGHI++SD+ +TGDGL+A L +L  + +  + 
Sbjct: 300 LKLARTAVGDRYVVEEMRAKGYNLGGEQSGHIVMSDHATTGDGLMAGLHMLAAMVETGEK 359

Query: 362 VSTICHCFEEYPQFLRSVSV-KDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
            S + + F   PQ L++    +  + L  +++ QAI+ AE  L G  RL++R SGTE LI
Sbjct: 360 ASQLLNQFTPVPQLLKNTRFERGQTPLEDAAVQQAISAAEQALNGQGRLLIRKSGTEPLI 419

Query: 421 RIMAEGDDLSRIKRIVDDLAKVI 443
           R+MAE +D   +++ VD +   +
Sbjct: 420 RVMAECEDAVLLEQTVDQVVAAV 442


>gi|260575532|ref|ZP_05843530.1| phosphoglucosamine mutase [Rhodobacter sp. SW2]
 gi|259022175|gb|EEW25473.1| phosphoglucosamine mutase [Rhodobacter sp. SW2]
          Length = 447

 Score =  469 bits (1207), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 231/446 (51%), Positives = 310/446 (69%), Gaps = 6/446 (1%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFR--GKKKHRRVVIGKDTRLSGYML 58
           M R  FGTDG+RG++NT+P+T    +R+G A G  FR  G   HR VVIGKDTRLSGYML
Sbjct: 1   MTRTLFGTDGVRGRANTYPMTAEMALRLGAAAGRFFRRDGTAAHR-VVIGKDTRLSGYML 59

Query: 59  ENSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDG 118
           EN+L AG T+ GM+  +LGP+P+PAV  LTRS+RAD+GVMISASHNP+QDNGIK FGPDG
Sbjct: 60  ENALTAGLTSTGMNVLLLGPVPTPAVGFLTRSMRADLGVMISASHNPHQDNGIKFFGPDG 119

Query: 119 YKVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLR 178
           +K+S D E  IE +L  ++   L+   +IG AKR+D    RY E+ K T P  + L GL+
Sbjct: 120 FKLSDDAEREIEAILAGEIA--LAQPQNIGRAKRIDDGRGRYQEYAKTTFPVGLRLDGLK 177

Query: 179 IVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADI 238
           +V+DCANGA+Y+ APEV WELGA+V+ +G  PNG NIN  CGST   +    V    AD+
Sbjct: 178 VVIDCANGAAYRAAPEVLWELGAEVIPVGVAPNGTNINDRCGSTYTQTAAEAVVAHGADV 237

Query: 239 GIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIA 298
           GI LDGD DRV+I+D+ G + +GDQIMAL+A  W     L G  +V TVMSN+GLERF+ 
Sbjct: 238 GICLDGDADRVMILDQTGKVADGDQIMALLAARWAEEGRLHGGTLVATVMSNLGLERFLE 297

Query: 299 GLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQY 358
             GL L+RT VGDRY++E M+  GFN+GGEQSGHI+++DY +TGDGL+A LQ L  + + 
Sbjct: 298 RRGLRLERTNVGDRYVVEAMRRGGFNLGGEQSGHIVMTDYATTGDGLIAGLQFLAEMART 357

Query: 359 DKPVSTICHCFEEYPQFLRSVSV-KDTSILNSSSIVQAIADAESELRGIDRLIVRASGTE 417
           ++P S +   F+  PQ L++V     +  L ++++   IADAE+ L+G  RL++R SGTE
Sbjct: 358 EQPASALAQSFQTVPQMLKNVRYGAGSQPLAAAAVQAVIADAEARLQGSGRLLIRKSGTE 417

Query: 418 SLIRIMAEGDDLSRIKRIVDDLAKVI 443
            L+R+MAE +D   +  +V  +   +
Sbjct: 418 PLVRVMAECEDEVLLAEVVGSIVAAV 443


>gi|126728907|ref|ZP_01744722.1| phosphoglucosamine mutase [Sagittula stellata E-37]
 gi|126710837|gb|EBA09888.1| phosphoglucosamine mutase [Sagittula stellata E-37]
          Length = 451

 Score =  468 bits (1204), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 231/439 (52%), Positives = 307/439 (69%), Gaps = 4/439 (0%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKH-RRVVIGKDTRLSGYMLE 59
           M R+ FGTDG+RGK+NT+P+T    + +G AVG  FR +     RVVIGKDTRLSGYM E
Sbjct: 1   MSRKLFGTDGVRGKANTYPMTVELAVALGAAVGRHFRNEHGGVHRVVIGKDTRLSGYMFE 60

Query: 60  NSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGY 119
           N+L AG T+ GM+  +LGP+P+PAV +LT S+RAD+G+MISASHNP  DNGIK FGPDG+
Sbjct: 61  NALTAGLTSTGMNVLLLGPVPTPAVGLLTTSMRADLGIMISASHNPADDNGIKFFGPDGF 120

Query: 120 KVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRI 179
           K+S  +E  IE L+E  +  + +   +IG AKR+D    RY E +K TLP  + L G+++
Sbjct: 121 KLSDAVEAEIEGLVEGGV--HAAQPQNIGRAKRIDDGRFRYQERIKGTLPSGLRLDGIKV 178

Query: 180 VVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIG 239
           VVDCANGA+YK APEV WELGADVV +G  PNG+NIN  CGST+  +    V    AD+G
Sbjct: 179 VVDCANGAAYKTAPEVLWELGADVVPLGTNPNGLNINDKCGSTHPQAAAEAVVAHGADVG 238

Query: 240 IALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAG 299
           + LDGD DR+I++DE G +V+GDQIMAL+A  W     L+G  +V TVMSN+GLERF+ G
Sbjct: 239 LCLDGDADRIILIDETGTVVDGDQIMALLADRWAEEDRLKGGALVATVMSNLGLERFLDG 298

Query: 300 LGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYD 359
            GL L+RT VGDRY++E M+  GFN+GGEQSGHI+++DY +TGDGL+A LQ L  + +  
Sbjct: 299 RGLRLERTAVGDRYVVERMRAGGFNLGGEQSGHIVMTDYATTGDGLMAGLQFLAEMVRTG 358

Query: 360 KPVSTICHCFEEYPQFLRSVSV-KDTSILNSSSIVQAIADAESELRGIDRLIVRASGTES 418
           +  S +   F   PQ L++V      + L+S  +   I DAE+ L G  RL++R SGTE 
Sbjct: 359 RRASELTRSFAPVPQLLKNVRFGPGVAPLDSEQVKAVIRDAEARLAGKGRLLIRKSGTEP 418

Query: 419 LIRIMAEGDDLSRIKRIVD 437
           LIR+MAE +D + +  +VD
Sbjct: 419 LIRVMAECEDDALLLSVVD 437


>gi|254463794|ref|ZP_05077205.1| phosphoglucosamine mutase [Rhodobacterales bacterium Y4I]
 gi|206684702|gb|EDZ45184.1| phosphoglucosamine mutase [Rhodobacterales bacterium Y4I]
          Length = 448

 Score =  468 bits (1204), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 228/429 (53%), Positives = 298/429 (69%), Gaps = 6/429 (1%)

Query: 3   RRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFR--GKKKHRRVVIGKDTRLSGYMLEN 60
           R+ FGTDG+RG +N  P+T    +RIG AVG  FR  G   HR VVIGKDTRLSGYM EN
Sbjct: 2   RKLFGTDGVRGTANIHPMTAEMALRIGAAVGRYFRRDGTGAHR-VVIGKDTRLSGYMFEN 60

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +L AG T+ GM+  +LGP+P+PAV ++TRS+RAD+GVMISASHNP +DNGIK FGPDG+K
Sbjct: 61  ALTAGLTSTGMNVLLLGPVPTPAVGLMTRSMRADLGVMISASHNPSEDNGIKFFGPDGFK 120

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +S   E  IE L++  +    +   +IG AKR+D    RY E VK +LPR+++L GL++V
Sbjct: 121 LSDSAELEIEALIDSGVEPAQAA--NIGRAKRIDDARFRYGERVKSSLPRNLSLSGLKVV 178

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           +DCANGA+++ APEV WELGADV+ +G  P+G+NIN  CGST   +    V    A  GI
Sbjct: 179 IDCANGAAHRTAPEVLWELGADVIPVGVSPDGLNINRGCGSTQPQTAAEAVVAHGAHAGI 238

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
            LDGD DRVI++DE G + +GDQ+MAL+A  W    LL G  +V TVMSN+GLER +   
Sbjct: 239 CLDGDADRVIVIDETGTVADGDQLMALLATRWAEQDLLAGGALVATVMSNLGLERHLEAK 298

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           GL L+RT VGDRY++E M+  GFN+GGEQSGHI++SDY +TGDGL+A L  L  + Q  +
Sbjct: 299 GLGLERTAVGDRYVVERMREGGFNLGGEQSGHIVMSDYATTGDGLMAGLHFLSEMVQTGQ 358

Query: 361 PVSTICHCFEEYPQFLRSVSVK-DTSILNSSSIVQAIADAESELRGIDRLIVRASGTESL 419
             S + H FE  PQ LR+V  +   + L    + +AIA AE  L G  RL++R SGTE L
Sbjct: 359 KASALAHQFETVPQRLRNVRFQAGQAPLEDEQVQEAIAAAEKMLDGQGRLLIRKSGTEPL 418

Query: 420 IRIMAEGDD 428
           +R+MAE +D
Sbjct: 419 VRVMAESED 427


>gi|259416951|ref|ZP_05740871.1| phosphoglucosamine mutase [Silicibacter sp. TrichCH4B]
 gi|259348390|gb|EEW60167.1| phosphoglucosamine mutase [Silicibacter sp. TrichCH4B]
          Length = 483

 Score =  468 bits (1203), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 228/445 (51%), Positives = 306/445 (68%), Gaps = 4/445 (0%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKH-RRVVIGKDTRLSGYMLE 59
           + R+ FGTDG+RGK+N  P+T    +RIG AVG  FR +     RVVIGKDTRLSGYM E
Sbjct: 36  LMRKLFGTDGVRGKANLHPMTAEMALRIGAAVGRYFRRETDTVHRVVIGKDTRLSGYMFE 95

Query: 60  NSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGY 119
           N+L AG T+ GM+  +LGP+P+PAV ++TRS+RAD+GVMISASHNP +DNGIK FGPDGY
Sbjct: 96  NALTAGLTSTGMNVLLLGPVPTPAVGLMTRSMRADLGVMISASHNPAEDNGIKFFGPDGY 155

Query: 120 KVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRI 179
           K+S ++E  +E L+E  +    S   +IG AKR+D    RY E VK +LPRD+ L GL++
Sbjct: 156 KLSDEVELELEALIEAGVEPAQS--HNIGRAKRIDDARFRYGERVKSSLPRDMRLDGLKV 213

Query: 180 VVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIG 239
           V+DCANGA+++ APE+ WELGADV+ +G  P+G NIN  CGST        V    A +G
Sbjct: 214 VIDCANGAAHRAAPEILWELGADVIPVGVSPDGKNINRGCGSTKPAVAAETVVAHGAHVG 273

Query: 240 IALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAG 299
           I LDGD DRV+++DE G + +GDQ+MAL+A  W     L G  +V TVMSN+GLERF+  
Sbjct: 274 ICLDGDADRVVMIDETGTVADGDQLMALLASAWAEDGRLSGGALVATVMSNLGLERFLND 333

Query: 300 LGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYD 359
            G+ L+RT VGDRY++E M+  GFN+GGEQSGHI++SDY +TGDGL+A L  L  + + +
Sbjct: 334 RGIGLERTGVGDRYVVERMRQGGFNLGGEQSGHIVMSDYATTGDGLMAGLHFLAEMVRRE 393

Query: 360 KPVSTICHCFEEYPQFLRSVSVKDTSI-LNSSSIVQAIADAESELRGIDRLIVRASGTES 418
           +  S +   FE  PQ L++V  +   + L   ++  AIA AE +L G  RL++R SGTE 
Sbjct: 394 QKASELAQQFEPVPQLLKNVRFEAGQVPLEVDAVQDAIAQAEGQLNGHGRLLIRKSGTEP 453

Query: 419 LIRIMAEGDDLSRIKRIVDDLAKVI 443
           LIR+MAE +D   + R VD +   +
Sbjct: 454 LIRVMAESEDPDLLNRAVDGVVAAV 478


>gi|146276701|ref|YP_001166860.1| phosphoglucosamine mutase [Rhodobacter sphaeroides ATCC 17025]
 gi|166990423|sp|A4WQ91|GLMM_RHOS5 RecName: Full=Phosphoglucosamine mutase
 gi|145554942|gb|ABP69555.1| phosphoglucosamine mutase [Rhodobacter sphaeroides ATCC 17025]
          Length = 447

 Score =  466 bits (1200), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 226/445 (50%), Positives = 308/445 (69%), Gaps = 4/445 (0%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRG-KKKHRRVVIGKDTRLSGYMLE 59
           M R+ FGTDG+RG++N++P+T    +R+G A G  FR       RVVIGKDTRLSGYMLE
Sbjct: 1   MTRKLFGTDGVRGRANSYPMTAEVALRLGAAAGRYFRPVGAGSPRVVIGKDTRLSGYMLE 60

Query: 60  NSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGY 119
           N+L AG T+ GM+  +LGP+P+PAV  LTRS+RAD+GVMISASHNP++DNGIK FGPDG+
Sbjct: 61  NALTAGLTSTGMNVLLLGPVPTPAVGFLTRSMRADLGVMISASHNPHEDNGIKFFGPDGF 120

Query: 120 KVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRI 179
           K+S + E  IE +L  ++    +   +IG AKR+D    RY E+ K T P  + L GL++
Sbjct: 121 KLSDEAEAEIEAILAGEIQP--AQPGNIGRAKRIDDGRGRYQEYCKTTFPAGLRLDGLKV 178

Query: 180 VVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIG 239
           V+DCANGA+Y+ APEV WELGA+V+ +G +P+G NINL CGST+  +    V    AD+G
Sbjct: 179 VIDCANGAAYRAAPEVLWELGAEVIPLGVEPDGKNINLRCGSTHPEAAAEAVRAHGADVG 238

Query: 240 IALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAG 299
           I LDGD DRVII+DE+G   +GDQIMAL A  W     LR   +V TVMSN+GLERF++ 
Sbjct: 239 ICLDGDADRVIILDEQGRQADGDQIMALFAARWAEEGRLRDATLVATVMSNLGLERFLSA 298

Query: 300 LGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYD 359
            GL L+RT VGDRY++E M+  G+N+GGEQSGHI+++D+ +TGDGL+A LQ L  + Q  
Sbjct: 299 RGLRLERTPVGDRYVVEAMRRGGWNLGGEQSGHIVMTDFATTGDGLLAGLQFLAAMAQTG 358

Query: 360 KPVSTICHCFEEYPQFLRSVS-VKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTES 418
           +  S +   FE  PQ L++V        L + S+   I +AE  L G  RL++R SGTE 
Sbjct: 359 RKASELSRSFETVPQLLQNVRYAAGQEPLTAPSVQAVIREAEVRLNGSGRLLIRKSGTEP 418

Query: 419 LIRIMAEGDDLSRIKRIVDDLAKVI 443
           LIR+MAE +D + ++ +V+++   +
Sbjct: 419 LIRVMAECEDEALLRDVVEEIVAAV 443


>gi|163742171|ref|ZP_02149559.1| phosphoglucosamine mutase [Phaeobacter gallaeciensis 2.10]
 gi|161384501|gb|EDQ08882.1| phosphoglucosamine mutase [Phaeobacter gallaeciensis 2.10]
          Length = 448

 Score =  466 bits (1199), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 225/428 (52%), Positives = 301/428 (70%), Gaps = 4/428 (0%)

Query: 3   RRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKH-RRVVIGKDTRLSGYMLENS 61
           R+FFGTDG+RG +N  P+T +  +RIG AVG  FR       RVVIGKDTRLSGYM E++
Sbjct: 2   RKFFGTDGVRGTANIHPMTADMALRIGAAVGRYFRRDASGVHRVVIGKDTRLSGYMFESA 61

Query: 62  LVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKV 121
           L AG T+ GM+  +LGP+P+PAV ++TRS+RAD+GVMISASHNP  DNGIK FGPDG+K+
Sbjct: 62  LTAGLTSTGMNVLLLGPVPTPAVGLMTRSMRADLGVMISASHNPAADNGIKFFGPDGFKL 121

Query: 122 STDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVV 181
           S  +E  +E L+E  +    +   +IG AKR+D    RY E VK +LPRD+ L GL++V+
Sbjct: 122 SDTVEMELEALIEAGVEPAQA--QNIGRAKRIDDARFRYGERVKSSLPRDIRLDGLKVVI 179

Query: 182 DCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIA 241
           DCANGA+++ APE+ WELGA+V+ +G  P+G NIN DCGST+  +    V    A +GI 
Sbjct: 180 DCANGAAHRAAPEILWELGAEVIPVGVSPDGTNINRDCGSTHPGTAAETVVAHGAHVGIC 239

Query: 242 LDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLG 301
           LDGD DRVII+DE G + +GDQ+MAL+A  W    +L GN +V+TVMSN+GLER +A  G
Sbjct: 240 LDGDADRVIIIDETGKVADGDQLMALLATRWAEDGVLAGNALVSTVMSNLGLERHLAARG 299

Query: 302 LSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKP 361
           ++L+RT VGDRY++E M+  GFN+GGEQSGHI+++DY +TGDGL+A L  L  + + DKP
Sbjct: 300 IALERTAVGDRYVVERMREGGFNLGGEQSGHIVMTDYATTGDGLMAGLHFLAEMVRADKP 359

Query: 362 VSTICHCFEEYPQFLRSVS-VKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
            S +   F   PQ L++V      + L S  +  AI  AE  L G  RL++R SGTE L+
Sbjct: 360 ASQLAQQFAPVPQLLKNVRFAAGQTPLESDQVQTAIRVAEETLAGQGRLLIRKSGTEPLV 419

Query: 421 RIMAEGDD 428
           R+MAE +D
Sbjct: 420 RVMAECED 427


>gi|84683649|ref|ZP_01011552.1| Phosphoglucomutase/phosphomannomutase [Maritimibacter alkaliphilus
           HTCC2654]
 gi|84668392|gb|EAQ14859.1| Phosphoglucomutase/phosphomannomutase [Rhodobacterales bacterium
           HTCC2654]
          Length = 448

 Score =  466 bits (1198), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 224/440 (50%), Positives = 314/440 (71%), Gaps = 6/440 (1%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFR--GKKKHRRVVIGKDTRLSGYML 58
           M  + FGTDG+RG +N+ P+T    +++G A G  FR  GK  HR VVIGKDTRLSGYML
Sbjct: 1   MAEKLFGTDGVRGLANSHPMTAEMALKLGAAAGRFFRSDGKNDHR-VVIGKDTRLSGYML 59

Query: 59  ENSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDG 118
           EN+L AG T+ GM+  +LGP+P+PAV  LT S+RAD+G+MISASHN + DNGIK FGPDG
Sbjct: 60  ENALTAGLTSTGMNVLLLGPVPTPAVGHLTHSMRADLGIMISASHNHFTDNGIKFFGPDG 119

Query: 119 YKVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLR 178
           +K+S + E  IE ++++ +   L+  ++IG A+R+D    RY+E +K T P D  L GL+
Sbjct: 120 FKLSDEAEADIERMVDEGVE--LAHPENIGRARRIDEGRHRYVEFIKTTFPSDHRLDGLK 177

Query: 179 IVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADI 238
           +V+DCANGA+Y+ APE  WELGA+V+ +G KPNG NINL+CGST+  +  + V +  AD+
Sbjct: 178 VVIDCANGAAYRAAPEALWELGAEVIEVGVKPNGTNINLECGSTDTRTAVKAVLDHGADV 237

Query: 239 GIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIA 298
           GI LDGD DRV+I+DE G + +GDQIMAL+A  +     LRG  +V TVMSN+GLER++ 
Sbjct: 238 GICLDGDADRVMIIDETGRVADGDQIMALMAGRFAEKGALRGGALVATVMSNLGLERYLG 297

Query: 299 GLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQY 358
           G GL L+RT+VGDRY++E M+  GFN+GGEQSGHI+++DY +TGDGL+A LQ L  + + 
Sbjct: 298 GKGLRLERTKVGDRYVVERMREGGFNLGGEQSGHIVMTDYATTGDGLLAGLQFLAAMVET 357

Query: 359 DKPVSTICHCFEEYPQFLRSVSVK-DTSILNSSSIVQAIADAESELRGIDRLIVRASGTE 417
            +  S +   F+  PQ L++V      + L+  ++ + IA +E +L G  RL++R SGTE
Sbjct: 358 GQRASDLTQVFDTVPQLLKNVRYHAGQTPLDDENVRKVIAASEQDLTGKGRLLIRKSGTE 417

Query: 418 SLIRIMAEGDDLSRIKRIVD 437
            LIR+MAE +D + + ++VD
Sbjct: 418 PLIRVMAECEDETFLTQVVD 437


>gi|254474472|ref|ZP_05087858.1| phosphoglucosamine mutase [Ruegeria sp. R11]
 gi|214028715|gb|EEB69550.1| phosphoglucosamine mutase [Ruegeria sp. R11]
          Length = 448

 Score =  465 bits (1197), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 225/428 (52%), Positives = 299/428 (69%), Gaps = 4/428 (0%)

Query: 3   RRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKH-RRVVIGKDTRLSGYMLENS 61
           R+FFGTDG+RG +N  P+T +  +RIG AVG  FR       RVVIGKDTRLSGYM E++
Sbjct: 2   RKFFGTDGVRGTANIHPMTADMALRIGAAVGRYFRRDASGVHRVVIGKDTRLSGYMFESA 61

Query: 62  LVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKV 121
           L AG T+ GM+  +LGP+P+PAV ++TRS+RAD+GVMISASHNP  DNGIK FGPDG+K+
Sbjct: 62  LTAGLTSTGMNVLLLGPVPTPAVGLMTRSMRADLGVMISASHNPAADNGIKFFGPDGFKL 121

Query: 122 STDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVV 181
           S  +E  +E L+E  +    +   +IG AKR+D    RY E VK +LPRD+ L GL++V+
Sbjct: 122 SDSVEMELEALIEAGVEP--AQAQNIGRAKRIDDARFRYGERVKSSLPRDIRLDGLKVVI 179

Query: 182 DCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIA 241
           DCANGA+++ APE+ WELGADV+ IG  P+G NIN DCGST   +    V    A +GI 
Sbjct: 180 DCANGAAHRAAPEILWELGADVIPIGVSPDGTNINRDCGSTQPGTAAETVVAHAAHVGIC 239

Query: 242 LDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLG 301
           LDGD DRVI++DE G + +GDQ+MAL+A  W +  LL GN +V TVMSN+GLER +AG G
Sbjct: 240 LDGDADRVIVIDETGKVADGDQLMALLASRWAADGLLAGNALVATVMSNLGLERHLAGQG 299

Query: 302 LSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKP 361
           + L+RT VGDRY++E M+  GFN+GGEQSGHI++SDY +TGDGL+A L  L  + +  + 
Sbjct: 300 IGLERTAVGDRYVVERMREGGFNLGGEQSGHIVMSDYATTGDGLMAGLHFLAEMVRSGQK 359

Query: 362 VSTICHCFEEYPQFLRSVS-VKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
            S +   F   PQ L++V      + L++  +  AI  AE  L G  RL++R SGTE L+
Sbjct: 360 ASELAQQFAPVPQLLKNVRFAAGQTPLDTDRVQSAIMAAEKALEGNGRLLIRKSGTEPLV 419

Query: 421 RIMAEGDD 428
           R+MAE +D
Sbjct: 420 RVMAESED 427


>gi|254487295|ref|ZP_05100500.1| phosphoglucosamine mutase [Roseobacter sp. GAI101]
 gi|214044164|gb|EEB84802.1| phosphoglucosamine mutase [Roseobacter sp. GAI101]
          Length = 448

 Score =  464 bits (1195), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 225/442 (50%), Positives = 310/442 (70%), Gaps = 4/442 (0%)

Query: 4   RFFGTDGIRGKSNTFPITPNFMMRIGIAVG-YLFRGKKKHRRVVIGKDTRLSGYMLENSL 62
           + FGTDG+RG++N +P+T    +RIG AVG Y  + +    RVVIGKDTRLSGYM E++L
Sbjct: 3   KLFGTDGVRGQANIYPMTAENALRIGAAVGRYFGQSRSGVHRVVIGKDTRLSGYMFESAL 62

Query: 63  VAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVS 122
            AG T+ GM+  +LGP+P+PAV +LTRS+RAD+GVMISASHNP  DNGIK FGPDG+K+S
Sbjct: 63  TAGLTSTGMNVLLLGPVPTPAVGLLTRSMRADLGVMISASHNPATDNGIKFFGPDGFKLS 122

Query: 123 TDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVVD 182
             +E  IE L+++ +   L+  D IG AKR+D    RY+E VK + PR ++L GL++VVD
Sbjct: 123 DQVEAEIEALVDNGVD--LNAADQIGRAKRIDDGRFRYVERVKSSFPRQMSLDGLKVVVD 180

Query: 183 CANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIAL 242
           CANGA+Y+VAPE  WELGA+VV +G KPNG NIN +CGST+       V    AD+GI L
Sbjct: 181 CANGAAYRVAPETLWELGAEVVEVGVKPNGHNINQNCGSTHPEMAAAAVVSHGADLGICL 240

Query: 243 DGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLGL 302
           DGD DRVI++DE G + +GDQ MAL+   W +   L  N +V TVMSN+GLE F+ G G+
Sbjct: 241 DGDADRVILIDETGKVGDGDQFMALMGSRWAAEGRLANNALVATVMSNLGLEHFLQGHGV 300

Query: 303 SLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKPV 362
           +L+RT VGDRY++E M+  GFN+GGEQSGHI+++D+ +TGDGL+A LQ L  + +  K  
Sbjct: 301 NLERTAVGDRYVVERMREGGFNLGGEQSGHIVMTDHATTGDGLMAGLQFLAEVVRSGKKA 360

Query: 363 STICHCFEEYPQFLRSVSVKDTSI-LNSSSIVQAIADAESELRGIDRLIVRASGTESLIR 421
           S + + F+  PQ L +V      + L  + +  AIA AE++L G  RL++R SGTE L+R
Sbjct: 361 SELLNNFDPVPQLLMNVRFSAGQVPLEDAHVQAAIAQAEADLAGKGRLLIRKSGTEPLVR 420

Query: 422 IMAEGDDLSRIKRIVDDLAKVI 443
           +MAE +D + + + V+ +   +
Sbjct: 421 VMAEHEDAALMAQAVNSVVDAV 442


>gi|159044940|ref|YP_001533734.1| phosphoglucosamine mutase [Dinoroseobacter shibae DFL 12]
 gi|189040783|sp|A8LS40|GLMM_DINSH RecName: Full=Phosphoglucosamine mutase
 gi|157912700|gb|ABV94133.1| phosphoglucosamine mutase [Dinoroseobacter shibae DFL 12]
          Length = 447

 Score =  464 bits (1195), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 236/430 (54%), Positives = 300/430 (69%), Gaps = 4/430 (0%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVG-YLFRGKKKHRRVVIGKDTRLSGYMLE 59
           M R+ FGTDG+RG +NT P+T    +R+G A G Y  R +    RVVIGKDTRLSGYM E
Sbjct: 1   MARKLFGTDGVRGTANTAPMTAEMALRLGAAAGRYFRRDQSAAHRVVIGKDTRLSGYMFE 60

Query: 60  NSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGY 119
            +L AGFT+ GM+  +LGPIP+PAVA+LT+S+RADVGVMISASHNP  DNGIK FGPDGY
Sbjct: 61  TALTAGFTSTGMNVLLLGPIPTPAVALLTQSMRADVGVMISASHNPADDNGIKFFGPDGY 120

Query: 120 KVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRI 179
           K+S   E+ IE +L  D+    +   +IG AKR+D    RYIE  KRT P  + L GL++
Sbjct: 121 KLSDAAEEEIEEILAGDIRPAQA--PNIGRAKRIDDGLGRYIERAKRTFPAHLRLDGLKV 178

Query: 180 VVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIG 239
           VVDCANGA+YKVAP V WELGADV+ +G  PNG NIN DCGST   +    V    AD+G
Sbjct: 179 VVDCANGAAYKVAPAVLWELGADVIPVGVSPNGRNINRDCGSTAPQTAAEAVVSHGADVG 238

Query: 240 IALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAG 299
           I LDGD DRV+I+DE G + +GDQ+MAL A  W +  LLR N +V TVMSN+GLE ++  
Sbjct: 239 ICLDGDADRVMILDENGELADGDQLMALFATRWAAQGLLRDNTLVATVMSNLGLEYYLND 298

Query: 300 LGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYD 359
           LGL L RT VGDRY++E M+  G+N+GGEQSGHI++ D+G+TGDGL+A LQ L  + Q  
Sbjct: 299 LGLKLVRTAVGDRYVVEAMRKGGWNLGGEQSGHIVMLDHGTTGDGLMAGLQFLAEMVQQG 358

Query: 360 KPVSTICHCFEEYPQFLRSVSV-KDTSILNSSSIVQAIADAESELRGIDRLIVRASGTES 418
           +  S + H F   PQ L +V        L ++S+  AIA AE++L G  RL++R SGTE 
Sbjct: 359 RSASELKHSFTTVPQRLENVRFGAGQDPLAAASVKSAIAAAEAQLSGKGRLLIRKSGTEP 418

Query: 419 LIRIMAEGDD 428
           L+R+MAE +D
Sbjct: 419 LVRVMAECED 428


>gi|163738412|ref|ZP_02145827.1| phosphoglucosamine mutase [Phaeobacter gallaeciensis BS107]
 gi|161388333|gb|EDQ12687.1| phosphoglucosamine mutase [Phaeobacter gallaeciensis BS107]
          Length = 448

 Score =  464 bits (1195), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 224/428 (52%), Positives = 301/428 (70%), Gaps = 4/428 (0%)

Query: 3   RRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKH-RRVVIGKDTRLSGYMLENS 61
           R+FFGTDG+RG +N  P+T +  +RIG AVG  FR       RVVIGKDTRLSGYM E++
Sbjct: 2   RKFFGTDGVRGTANIHPMTADMALRIGAAVGRYFRRDASGVHRVVIGKDTRLSGYMFESA 61

Query: 62  LVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKV 121
           L AG T+ GM+  +LGP+P+PAV ++TRS+RAD+GVMISASHNP  DNGIK FGPDG+K+
Sbjct: 62  LTAGLTSTGMNVLLLGPVPTPAVGLMTRSMRADLGVMISASHNPAADNGIKFFGPDGFKL 121

Query: 122 STDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVV 181
           S  +E  +E L+E  +    +   +IG AKR+D    RY E VK +LPRD+ L GL++V+
Sbjct: 122 SDTVEMELEALIEAGVEPAQA--QNIGRAKRIDDARFRYGERVKSSLPRDIRLDGLKVVI 179

Query: 182 DCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIA 241
           DCANGA+++ APE+ WELGA+V+ +G  P+G NIN DCGST+  +    V    A +GI 
Sbjct: 180 DCANGAAHRAAPEILWELGAEVIPVGVSPDGTNINRDCGSTHPGTAAETVVAHGAHVGIC 239

Query: 242 LDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLG 301
           LDGD DRVII+D+ G + +GDQ+MAL+A  W    +L GN +V+TVMSN+GLER +A  G
Sbjct: 240 LDGDADRVIIIDDTGKVADGDQLMALLATRWAEDGVLAGNALVSTVMSNLGLERHLAARG 299

Query: 302 LSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKP 361
           ++L+RT VGDRY++E M+  GFN+GGEQSGHI+++DY +TGDGL+A L  L  + + DKP
Sbjct: 300 IALERTAVGDRYVVERMREGGFNLGGEQSGHIVMTDYATTGDGLMAGLHFLAEMVRADKP 359

Query: 362 VSTICHCFEEYPQFLRSVS-VKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
            S +   F   PQ L++V      + L S  +  AI  AE  L G  RL++R SGTE L+
Sbjct: 360 ASQLAQQFAPVPQLLKNVRFAAGQTPLESDQVQTAIRVAEETLAGQGRLLIRKSGTEPLV 419

Query: 421 RIMAEGDD 428
           R+MAE +D
Sbjct: 420 RVMAECED 427


>gi|296117361|ref|ZP_06835951.1| phosphoglucosamine mutase [Gluconacetobacter hansenii ATCC 23769]
 gi|295976127|gb|EFG82915.1| phosphoglucosamine mutase [Gluconacetobacter hansenii ATCC 23769]
          Length = 431

 Score =  462 bits (1189), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 234/428 (54%), Positives = 303/428 (70%), Gaps = 2/428 (0%)

Query: 20  ITPNFMMRIGIAVGYLF-RGKKKHRRVVIGKDTRLSGYMLENSLVAGFTAAGMDAFILGP 78
           +T     ++G A G  F +G  +H  V++GKDTRLSGYM+E +LV+GF +AGMD  ++GP
Sbjct: 1   MTVEIAQKLGQAAGLRFIQGTHRHS-VLLGKDTRLSGYMIECALVSGFLSAGMDVTLVGP 59

Query: 79  IPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVSTDIEDRIETLLEDDLT 138
           +P+PA+AMLTRSLRAD+GVMISASHNPY DNGIKLFGPDG+K+S ++E  IE  +  DL+
Sbjct: 60  MPTPAIAMLTRSLRADLGVMISASHNPYGDNGIKLFGPDGFKLSDEVEAEIEETMRSDLS 119

Query: 139 SYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVVDCANGASYKVAPEVFWE 198
             L+  D IG A R++    RYIE  K + PR + L GLRIV+DCANGA+Y+VAP   WE
Sbjct: 120 GRLAAPDQIGRASRLNDAAGRYIESAKSSFPRGLRLDGLRIVIDCANGAAYRVAPTALWE 179

Query: 199 LGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIALDGDGDRVIIVDEKGAI 258
           LGA+V+ IG  P+GININ  CGST   +L   V   RADIGIALDGD DRV+I DEKG +
Sbjct: 180 LGAEVIRIGCDPDGININEGCGSTRPEALCAAVTRHRADIGIALDGDADRVLIADEKGRL 239

Query: 259 VNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLGLSLKRTEVGDRYIMEYM 318
           ++GDQI+ALIAR W+    L G  IV TVMSN+GLERF++ LGL L RT VGDRY++E M
Sbjct: 240 IDGDQILALIARSWLKQGRLAGRQIVATVMSNMGLERFLSELGLELIRTAVGDRYVVEKM 299

Query: 319 KNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKPVSTICHCFEEYPQFLRS 378
           +  G N+GGEQSGH++LSD+ +TGDGLVAALQVL  + +  +P S +C  F  YPQ LR+
Sbjct: 300 RELGANLGGEQSGHMLLSDFATTGDGLVAALQVLAVLVEDGRPASEVCRMFTPYPQLLRN 359

Query: 379 VSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLIRIMAEGDDLSRIKRIVDD 438
           V     S L   +I +A   AE+ L    RL++R SGTE LIR+M E  D   ++++VDD
Sbjct: 360 VRFAGRSPLQDPAIAEARRAAEALLGARGRLVLRESGTEPLIRVMVEAQDEPLVRQVVDD 419

Query: 439 LAKVIPMI 446
           +   I  +
Sbjct: 420 MCAAIAAV 427


>gi|126461286|ref|YP_001042400.1| phosphoglucosamine mutase [Rhodobacter sphaeroides ATCC 17029]
 gi|221638272|ref|YP_002524534.1| phosphoglucosamine mutase [Rhodobacter sphaeroides KD131]
 gi|158705806|sp|A3PH12|GLMM_RHOS1 RecName: Full=Phosphoglucosamine mutase
 gi|254798591|sp|B9KM35|GLMM_RHOSK RecName: Full=Phosphoglucosamine mutase
 gi|126102950|gb|ABN75628.1| phosphoglucosamine mutase [Rhodobacter sphaeroides ATCC 17029]
 gi|221159053|gb|ACM00033.1| Phosphoglucosamine mutase [Rhodobacter sphaeroides KD131]
          Length = 447

 Score =  462 bits (1189), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 226/445 (50%), Positives = 302/445 (67%), Gaps = 4/445 (0%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRG-KKKHRRVVIGKDTRLSGYMLE 59
           M R+ FGTDG+RG +NT P+T    +R+G A G  FR       RVVIGKDTRLSGYMLE
Sbjct: 1   MTRKLFGTDGVRGTANTHPMTAEMALRLGAAAGRYFRPVGAGSPRVVIGKDTRLSGYMLE 60

Query: 60  NSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGY 119
           N+L AG T+ GM+  +LGP+P+PAV  LTRS+RA +GVMISASHNP++DNGIK FGPDG+
Sbjct: 61  NALTAGLTSTGMNVLLLGPVPTPAVGFLTRSMRAALGVMISASHNPHEDNGIKFFGPDGF 120

Query: 120 KVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRI 179
           K+S + E  IE +L  ++    +   +IG AKR++    RY E+ K T P  + L GL++
Sbjct: 121 KLSDEAEAEIEAILAGEIQP--AQPGNIGRAKRIEDGRGRYQEYCKTTFPSGLRLDGLKV 178

Query: 180 VVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIG 239
           V+DCANGA+Y+ APEV WELGA+V+ +G +PNG NINL CGST+  +    V    AD+G
Sbjct: 179 VIDCANGAAYRAAPEVLWELGAEVIPVGVEPNGKNINLRCGSTHPEAAAEAVRAHGADVG 238

Query: 240 IALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAG 299
           I LDGD DRVII+DE G   +GDQIMAL A  W     LR   +V TVMSN+GLERF+  
Sbjct: 239 ICLDGDADRVIILDETGKEADGDQIMALFAARWADEGRLRDGTLVATVMSNLGLERFLGA 298

Query: 300 LGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYD 359
            GL L+RT VGDRY++E M+  G+N+GGEQSGHI+++D+ +TGDGL+A LQ L  + Q  
Sbjct: 299 RGLRLERTPVGDRYVVEAMRRGGWNLGGEQSGHIVMTDFATTGDGLLAGLQFLAAMAQTG 358

Query: 360 KPVSTICHCFEEYPQFLRSVS-VKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTES 418
           +  S +   FE  PQ L++V        L +  +   I DAE  L G  RL++R SGTE 
Sbjct: 359 RRASDLARSFETVPQLLQNVRYAAGQEPLKAPGVQAVIRDAEVRLNGAGRLLIRKSGTEP 418

Query: 419 LIRIMAEGDDLSRIKRIVDDLAKVI 443
           LIR+MAE +D + ++ +V+++   +
Sbjct: 419 LIRVMAECEDEALLRDVVEEIVAAV 443


>gi|77462409|ref|YP_351913.1| phosphoglucosamine mutase [Rhodobacter sphaeroides 2.4.1]
 gi|123592820|sp|Q3J5C2|GLMM_RHOS4 RecName: Full=Phosphoglucosamine mutase
 gi|77386827|gb|ABA78012.1| phosphoglucosamine mutase [Rhodobacter sphaeroides 2.4.1]
          Length = 447

 Score =  462 bits (1188), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 226/445 (50%), Positives = 302/445 (67%), Gaps = 4/445 (0%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRG-KKKHRRVVIGKDTRLSGYMLE 59
           M R+ FGTDG+RG +NT P+T    +R+G A G  FR       RVVIGKDTRLSGYMLE
Sbjct: 1   MTRKLFGTDGVRGTANTHPMTAEMALRLGAAAGRYFRPVGAGSPRVVIGKDTRLSGYMLE 60

Query: 60  NSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGY 119
           N+L AG T+ GM+  +LGP+P+PAV  LTRS+RA +GVMISASHNP++DNGIK FGPDG+
Sbjct: 61  NALTAGLTSTGMNVLLLGPVPTPAVGFLTRSMRAALGVMISASHNPHEDNGIKFFGPDGF 120

Query: 120 KVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRI 179
           K+S + E  IE +L  ++    +   +IG AKR++    RY E+ K T P  + L GL++
Sbjct: 121 KLSDEAEAEIEAILAGEIQP--AQPGNIGRAKRIEDGRGRYQEYCKTTFPSGLRLDGLKV 178

Query: 180 VVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIG 239
           V+DCANGA+Y+ APEV WELGA+V+ +G +PNG NINL CGST+  +    V    AD+G
Sbjct: 179 VIDCANGAAYRAAPEVLWELGAEVIPVGVEPNGKNINLRCGSTHPQAAGEAVRAHGADVG 238

Query: 240 IALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAG 299
           I LDGD DRVII+DE G   +GDQIMAL A  W     LR   +V TVMSN+GLERF+  
Sbjct: 239 ICLDGDADRVIILDETGKEADGDQIMALFAARWADEGRLRDGTLVATVMSNLGLERFLGA 298

Query: 300 LGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYD 359
            GL L+RT VGDRY++E M+  G+N+GGEQSGHI+++D+ +TGDGL+A LQ L  + Q  
Sbjct: 299 RGLRLERTPVGDRYVVEAMRRGGWNLGGEQSGHIVMTDFATTGDGLLAGLQFLAAMAQTG 358

Query: 360 KPVSTICHCFEEYPQFLRSVS-VKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTES 418
           +  S +   FE  PQ L++V        L +  +   I DAE  L G  RL++R SGTE 
Sbjct: 359 RRASDLARSFETVPQLLQNVRYAAGQEPLKAPGVQAVIRDAEVRLNGAGRLLIRKSGTEP 418

Query: 419 LIRIMAEGDDLSRIKRIVDDLAKVI 443
           LIR+MAE +D + ++ +V+++   +
Sbjct: 419 LIRVMAECEDEALLRDVVEEIVAAV 443


>gi|332560293|ref|ZP_08414615.1| phosphoglucosamine mutase [Rhodobacter sphaeroides WS8N]
 gi|332278005|gb|EGJ23320.1| phosphoglucosamine mutase [Rhodobacter sphaeroides WS8N]
          Length = 447

 Score =  461 bits (1187), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 226/445 (50%), Positives = 302/445 (67%), Gaps = 4/445 (0%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRG-KKKHRRVVIGKDTRLSGYMLE 59
           M R+ FGTDG+RG +NT P+T    +R+G A G  FR       RVVIGKDTRLSGYMLE
Sbjct: 1   MTRKLFGTDGVRGTANTHPMTAEMALRLGAAAGRYFRPVGAGSPRVVIGKDTRLSGYMLE 60

Query: 60  NSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGY 119
           N+L AG T+ GM+  +LGP+P+PAV  LTRS+RA +GVMISASHNP++DNGIK FGPDG+
Sbjct: 61  NALTAGLTSTGMNVLLLGPVPTPAVGFLTRSMRAALGVMISASHNPHEDNGIKFFGPDGF 120

Query: 120 KVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRI 179
           K+S + E  IE +L  ++    +   +IG AKR++    RY E+ K T P  + L GL++
Sbjct: 121 KLSDEAEAEIEAILAGEIQP--AQPGNIGRAKRIEDGRGRYQEYCKTTFPSGLRLDGLKV 178

Query: 180 VVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIG 239
           V+DCANGA+Y+ APEV WELGA+V+ +G +PNG NINL CGST+  +    V    AD+G
Sbjct: 179 VIDCANGAAYRAAPEVLWELGAEVIPVGVEPNGKNINLRCGSTHPEAAGEAVRAHGADVG 238

Query: 240 IALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAG 299
           I LDGD DRVII+DE G   +GDQIMAL A  W     LR   +V TVMSN+GLERF+  
Sbjct: 239 ICLDGDADRVIILDETGKEADGDQIMALFAARWADEGRLRDGTLVATVMSNLGLERFLGA 298

Query: 300 LGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYD 359
            GL L+RT VGDRY++E M+  G+N+GGEQSGHI+++D+ +TGDGL+A LQ L  + Q  
Sbjct: 299 RGLRLERTPVGDRYVVEAMRRGGWNLGGEQSGHIVMTDFATTGDGLLAGLQFLAAMAQTG 358

Query: 360 KPVSTICHCFEEYPQFLRSVS-VKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTES 418
           +  S +   FE  PQ L++V        L +  +   I DAE  L G  RL++R SGTE 
Sbjct: 359 RRASDLARSFETVPQLLQNVRYAAGQEPLKAPGVQAVIRDAEVRLNGAGRLLIRKSGTEP 418

Query: 419 LIRIMAEGDDLSRIKRIVDDLAKVI 443
           LIR+MAE +D + ++ +V+++   +
Sbjct: 419 LIRVMAECEDEALLRDVVEEIVAAV 443


>gi|56696249|ref|YP_166606.1| phosphoglucosamine mutase [Ruegeria pomeroyi DSS-3]
 gi|81558615|sp|Q5LTP9|GLMM_SILPO RecName: Full=Phosphoglucosamine mutase
 gi|56677986|gb|AAV94652.1| phosphoglucosamine mutase [Ruegeria pomeroyi DSS-3]
          Length = 448

 Score =  460 bits (1183), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 227/443 (51%), Positives = 307/443 (69%), Gaps = 4/443 (0%)

Query: 3   RRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKH-RRVVIGKDTRLSGYMLENS 61
           R+ FGTDG+RG +NT P+T    +RIG AVG  FR +     RVVIGKDTRLSGYM EN+
Sbjct: 2   RKLFGTDGVRGTANTHPMTAEMALRIGAAVGRYFRREAGGVHRVVIGKDTRLSGYMFENA 61

Query: 62  LVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKV 121
           L AG  + GM+  +LGP+P+PAV ++TRS+RAD+GVMISASHN  +DNGIK FGPDG+K+
Sbjct: 62  LTAGLASTGMNVLLLGPVPTPAVGLMTRSMRADLGVMISASHNSAEDNGIKFFGPDGFKL 121

Query: 122 STDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVV 181
           S   E  IE ++   +   L+   +IG  +RVD    RY E VK +L R + L GL++VV
Sbjct: 122 SDQAEMEIEEMVATGV--RLAQAHNIGRVRRVDDARFRYGERVKSSLTRGLRLDGLKVVV 179

Query: 182 DCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIA 241
           DCANGA+++ APE+ WELGADVV IG  P+G+NIN  CGST   +    V    AD+GI 
Sbjct: 180 DCANGAAHRTAPEILWELGADVVPIGTSPDGLNINRGCGSTCPRTASEAVVAHGADVGIC 239

Query: 242 LDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLG 301
           LDGD DRVI++D+ G + +GDQIMAL+A  W +   L+G  +V TVMSN+GLERF+   G
Sbjct: 240 LDGDADRVIVIDQLGNVADGDQIMALLAARWAAEGRLQGGALVATVMSNLGLERFLGDRG 299

Query: 302 LSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKP 361
           + L+RT VGDRY++E M+  GFN+GGEQSGHI++SD+ +TGDGL+A L  L  + +  +P
Sbjct: 300 IGLERTAVGDRYVVERMREGGFNLGGEQSGHIVMSDFATTGDGLMAGLHFLGEMMRSGQP 359

Query: 362 VSTICHCFEEYPQFLRSVS-VKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
            S +   F   PQ L++V   K  + L+++S+  AIA+AE  L G  RL++R SGTE LI
Sbjct: 360 SSELVRQFVPVPQLLKNVRFAKGQTPLDAASVQSAIAEAEGVLNGSGRLLIRKSGTEPLI 419

Query: 421 RIMAEGDDLSRIKRIVDDLAKVI 443
           R+MAE +D + + R VD + + +
Sbjct: 420 RVMAECEDEALLTRAVDSVVEAV 442


>gi|163733332|ref|ZP_02140775.1| phosphoglucosamine mutase [Roseobacter litoralis Och 149]
 gi|161393120|gb|EDQ17446.1| phosphoglucosamine mutase [Roseobacter litoralis Och 149]
          Length = 451

 Score =  459 bits (1182), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 232/443 (52%), Positives = 307/443 (69%), Gaps = 6/443 (1%)

Query: 4   RFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFR--GKKKHRRVVIGKDTRLSGYMLENS 61
           + FGTDG+RGK+N  P+T    +RIG AVG  FR  G   HR VVIGKDTRLSGYM EN+
Sbjct: 5   KLFGTDGVRGKANQHPMTAEMALRIGAAVGKYFRRDGSVAHR-VVIGKDTRLSGYMFENA 63

Query: 62  LVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKV 121
           L AG T+ GM+  +LGP+P+PAV +LTRS+RAD+GVMISASHNP  DNGIK FGPDG+K+
Sbjct: 64  LTAGLTSTGMNVLLLGPVPTPAVGLLTRSMRADLGVMISASHNPACDNGIKFFGPDGFKL 123

Query: 122 STDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVV 181
           S   E  IE L+   + +  +  + IG AKR+D    RYIE +K + PR   L GL++V+
Sbjct: 124 SDQAEQEIEALIASGVDAVEA--NDIGRAKRIDDGRFRYIERLKTSFPRQRRLDGLKVVI 181

Query: 182 DCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIA 241
           DCANGA+++VAPE  WELGA V+ +G  PNG NIN  CGST+  S    V    AD+GI 
Sbjct: 182 DCANGAAHRVAPEALWELGATVIPMGVSPNGKNINEGCGSTHPQSAAEMVVAHGADVGIC 241

Query: 242 LDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLG 301
           LDGD DRVI++DE G + +GDQ MAL+A+ W     L  N +V TVMSN+GLE F+  LG
Sbjct: 242 LDGDADRVILIDETGKVGDGDQFMALMAQRWAERGKLANNALVATVMSNLGLEHFLTDLG 301

Query: 302 LSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKP 361
           L L+RT VGDRY++E M+  GFN+GGEQSGHI+++DY +TGDGL+A LQ L  + Q D+P
Sbjct: 302 LKLERTAVGDRYVVERMRAGGFNLGGEQSGHIVMTDYATTGDGLMAGLQFLAAMTQADQP 361

Query: 362 VSTICHCFEEYPQFLRSVS-VKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
            S + + FE  PQ L++V      + L  + +  AIA AE++L    RL++R SGTE L+
Sbjct: 362 ASVLLNRFEPVPQLLKNVRFTAGQTPLEDARVKAAIAAAEADLSAKGRLLIRKSGTEPLV 421

Query: 421 RIMAEGDDLSRIKRIVDDLAKVI 443
           R+MAE +D + ++R VD + + +
Sbjct: 422 RVMAEHEDQTVMERAVDSVVEAV 444


>gi|209965089|ref|YP_002298004.1| phosphoglucosamine mutase [Rhodospirillum centenum SW]
 gi|226723910|sp|B6ITH3|GLMM_RHOCS RecName: Full=Phosphoglucosamine mutase
 gi|209958555|gb|ACI99191.1| phosphoglucosamine mutase [Rhodospirillum centenum SW]
          Length = 473

 Score =  459 bits (1180), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 234/451 (51%), Positives = 309/451 (68%), Gaps = 8/451 (1%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M RR FGTDGIRG +NT P+T    +++ +A    FR       VVI KDTRLSGYMLE 
Sbjct: 1   MTRRLFGTDGIRGTANTDPMTAEMALKVAMATAAQFRRGSHRHVVVIAKDTRLSGYMLEP 60

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +L AGF + GMD  ++GP+P+PAVAMLTRSLRAD+GVM+SASHNP+ DNGIKLFGPDGYK
Sbjct: 61  ALTAGFVSMGMDVVLVGPLPTPAVAMLTRSLRADLGVMVSASHNPFHDNGIKLFGPDGYK 120

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDS-----IGHAKRVDGVHDRYIEHVKRTLPRDVTLQ 175
           +S ++E  IE  +  D  +     D      +G A R++    RYIE VK + PR + L 
Sbjct: 121 LSDEMEAAIEARIAADGAAGGPAADLAGPRDLGRASRLEDAPGRYIEQVKASFPRGLRLD 180

Query: 176 GLRIVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVR 235
           GL+IVVDCANGA+Y+VAP+V WELGA+VV +   P+G NIN DCG+T   +++  V E +
Sbjct: 181 GLKIVVDCANGAAYRVAPKVLWELGAEVVPLAVGPDGFNINRDCGATAPAAMRAAVLEHK 240

Query: 236 ADIGIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLER 295
           A +G+ALDGD DR+I+ DE G  ++GDQIMALI R W     L+G G+V TVMSN+GLE 
Sbjct: 241 AHLGLALDGDADRLILADESGTQIDGDQIMALIGRSWAEDGRLKGGGVVATVMSNLGLEL 300

Query: 296 FIAGLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYI 355
           F+   GL+L RT VGDRY++E+M+  GFNVGGEQSGHI+LSD+ +TGDGL+AALQVL  I
Sbjct: 301 FLRDRGLTLVRTPVGDRYVVEHMREYGFNVGGEQSGHIVLSDFATTGDGLLAALQVLAEI 360

Query: 356 KQYDKPVSTICHCFEEYPQFLRSVSVKDTS---ILNSSSIVQAIADAESELRGIDRLIVR 412
           ++  +P S +   F+  PQ LR+V          L ++ +  AI   E+ L G  R+++R
Sbjct: 361 QRTGRPASEVLRVFQPLPQLLRNVRFDPAGGVRPLEAAGVQAAIRAGEARLGGRGRVLIR 420

Query: 413 ASGTESLIRIMAEGDDLSRIKRIVDDLAKVI 443
            SGTE LIR+MAEG+D   +  +V D+   +
Sbjct: 421 KSGTEPLIRVMAEGEDEGLVASVVADIVAAV 451


>gi|110679239|ref|YP_682246.1| phosphoglucosamine mutase [Roseobacter denitrificans OCh 114]
 gi|122972829|sp|Q168N3|GLMM_ROSDO RecName: Full=Phosphoglucosamine mutase
 gi|109455355|gb|ABG31560.1| phosphoglucosamine mutase [Roseobacter denitrificans OCh 114]
          Length = 449

 Score =  458 bits (1179), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 231/443 (52%), Positives = 309/443 (69%), Gaps = 6/443 (1%)

Query: 4   RFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFR--GKKKHRRVVIGKDTRLSGYMLENS 61
           + FGTDG+RGK+N  P+T    +RIG AVG  FR  G   HR VVIGKDTRLSGYM EN+
Sbjct: 3   KLFGTDGVRGKANEHPMTAEMALRIGAAVGKYFRRDGSAAHR-VVIGKDTRLSGYMFENA 61

Query: 62  LVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKV 121
           L AG T+ GM+  +LGP+P+PAV +LTRS+RAD+GVMISASHNP  DNGIK FGPDG+K+
Sbjct: 62  LTAGLTSTGMNVLLLGPVPTPAVGLLTRSMRADLGVMISASHNPACDNGIKFFGPDGFKL 121

Query: 122 STDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVV 181
           S   E+ IE L+   + +  +  + IG AKR+D    RYIE +K + PR   L GL++V+
Sbjct: 122 SDQAEEEIEALIASGVDAVEA--NDIGRAKRIDDGRFRYIERLKTSFPRQRRLDGLKVVI 179

Query: 182 DCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIA 241
           DCANGA+++VAPE  WELGA V+ +G  PNG NIN  CGST+       V    AD+GI 
Sbjct: 180 DCANGAAHRVAPEALWELGATVIPVGVSPNGKNINEGCGSTHPQFAADTVVAHGADVGIC 239

Query: 242 LDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLG 301
           LDGD DRVI++DE G + +GDQ MAL+A+ W     L  N +V TVMSN+GLE F++ LG
Sbjct: 240 LDGDADRVILIDETGKVGDGDQFMALMAQRWAERGKLANNALVATVMSNLGLEHFLSDLG 299

Query: 302 LSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKP 361
           L L+RT VGDRY++E M+  GFN+GGEQSGHI+++DY +TGDGL+A LQ L  + Q ++P
Sbjct: 300 LKLERTAVGDRYVVERMRAGGFNLGGEQSGHIVMTDYATTGDGLMAGLQFLAAMTQSEQP 359

Query: 362 VSTICHCFEEYPQFLRSVS-VKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
            S + + FE  PQ LR+V      + L  + +  AIA AE++L G  RL++R SGTE L+
Sbjct: 360 ASVLLNRFEPVPQLLRNVRFAAGQTPLEDARVKAAIAAAEADLSGKGRLLIRKSGTEPLV 419

Query: 421 RIMAEGDDLSRIKRIVDDLAKVI 443
           R+MAE +D + +++ VD + + +
Sbjct: 420 RVMAEHEDQTVMEQAVDSVVEAV 442


>gi|254452197|ref|ZP_05065634.1| phosphoglucosamine mutase [Octadecabacter antarcticus 238]
 gi|198266603|gb|EDY90873.1| phosphoglucosamine mutase [Octadecabacter antarcticus 238]
          Length = 451

 Score =  454 bits (1168), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 233/440 (52%), Positives = 302/440 (68%), Gaps = 6/440 (1%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFR--GKKKHRRVVIGKDTRLSGYML 58
           M R+FFGTDG+RG +N +P+T    ++IG A G  FR  G   HR VVIGKDTRLSGYM 
Sbjct: 1   MARKFFGTDGVRGTANKYPMTAEMGLKIGAAAGCYFRNDGSNGHR-VVIGKDTRLSGYMF 59

Query: 59  ENSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDG 118
           E++L AG T+ GM+  +LGPIP+PAVAMLT S+RAD+G+MISASHNP  DNGIK FGPDG
Sbjct: 60  ESALTAGLTSTGMNVLLLGPIPTPAVAMLTTSMRADLGIMISASHNPAVDNGIKFFGPDG 119

Query: 119 YKVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLR 178
           +K+S + E  IE LLE DL    +   +IG AKR+D    RY E +K T P  + L G++
Sbjct: 120 FKLSDEAEAEIERLLEGDLVPAQAS--NIGRAKRIDDGRFRYAERLKGTFPHGMRLDGIK 177

Query: 179 IVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADI 238
           +V+DCANGA YKVAPEV WELGA V+ +G  P+G NIN  CGST   +    +    AD+
Sbjct: 178 VVIDCANGAGYKVAPEVLWELGATVIPVGTHPDGFNINEGCGSTAPRTAAETIVTHGADV 237

Query: 239 GIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIA 298
           GI LDGD DRV+I+DE G + +GDQIM L A  W     L    +V TVMSN+GLERF+ 
Sbjct: 238 GICLDGDADRVMILDEHGNVADGDQIMGLFANRWAQADRLNKGTLVATVMSNLGLERFLN 297

Query: 299 GLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQY 358
             GLSL+R +VGDRY++E M+  GFN+GGEQSGHI+++D+ +TGDGL+A LQ L  + + 
Sbjct: 298 DKGLSLERADVGDRYVVEAMRAGGFNLGGEQSGHIVMTDFATTGDGLLAGLQFLAAMIET 357

Query: 359 DKPVSTICHCFEEYPQFLRSVSVKDTS-ILNSSSIVQAIADAESELRGIDRLIVRASGTE 417
            KP S +   FE  PQ L++V   D +  L    +  AIA AE+ L G  RL++R SGTE
Sbjct: 358 GKPASELIRVFETVPQMLKNVRYSDGADPLGQPPVKAAIAAAEASLVGKGRLLIRKSGTE 417

Query: 418 SLIRIMAEGDDLSRIKRIVD 437
            LIR+MAE +D + + ++VD
Sbjct: 418 PLIRVMAECEDDALLAQVVD 437


>gi|149201247|ref|ZP_01878222.1| phosphoglucosamine mutase [Roseovarius sp. TM1035]
 gi|149145580|gb|EDM33606.1| phosphoglucosamine mutase [Roseovarius sp. TM1035]
          Length = 427

 Score =  453 bits (1165), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 221/425 (52%), Positives = 298/425 (70%), Gaps = 3/425 (0%)

Query: 20  ITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSLVAGFTAAGMDAFILGPI 79
           +T +  +R+G A G  FR  K+  RVVIGKDTRLSGYM+E +L AGFT+ GM+ F+LGP+
Sbjct: 1   MTADVALRLGAAAGGYFRRDKQEHRVVIGKDTRLSGYMIEYALTAGFTSTGMNVFLLGPV 60

Query: 80  PSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVSTDIEDRIETLLEDDLTS 139
           P+PA+  LT SLRADVGVMISASHNP  DNGIKLFGPDGYK+S + E  I  LL++   +
Sbjct: 61  PTPAIGYLTHSLRADVGVMISASHNPASDNGIKLFGPDGYKLSDEAEAGIARLLDEG--A 118

Query: 140 YLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVVDCANGASYKVAPEVFWEL 199
            L+  + IG AKR++    RY+E+ K T P    L+GLRIV+DCANGA+Y+ APEV WEL
Sbjct: 119 RLAAPEKIGRAKRIEDARGRYVEYAKTTFPHRRRLEGLRIVLDCANGAAYRTAPEVLWEL 178

Query: 200 GADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIALDGDGDRVIIVDEKGAIV 259
           GA+V+ +G +P+G NINLDCGST   +  R+V E RAD+GI LDGD DRV+++DE+G I 
Sbjct: 179 GAEVIPMGVEPDGFNINLDCGSTKPQAAARRVLETRADLGICLDGDADRVVLIDEQGRIA 238

Query: 260 NGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLGLSLKRTEVGDRYIMEYMK 319
           +GDQ M LIA  W     L GN +V TVMSN+GLER +   G++LKRT VGDRY++E M+
Sbjct: 239 DGDQFMGLIATRWAREGRLAGNTLVATVMSNLGLERHLEAQGIALKRTAVGDRYVVEEMR 298

Query: 320 NNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKPVSTICHCFEEYPQFLRSV 379
             G N+GGEQSGHI+++DY +TGDGL+ ALQ L  + +  +  S++   FE  PQ L +V
Sbjct: 299 AGGHNLGGEQSGHIVMTDYATTGDGLIGALQFLAAMVETGEKASSLAQVFEPVPQKLINV 358

Query: 380 S-VKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLIRIMAEGDDLSRIKRIVDD 438
              K  + + + ++  A+A AE  L G  RL+VR SGTE +IR+MAE  +   + +++D 
Sbjct: 359 RFAKGKNPMATDAVQSAVAAAEKLLGGDGRLLVRPSGTEPMIRVMAEALNPGVLDQVMDS 418

Query: 439 LAKVI 443
           +   +
Sbjct: 419 VVGAV 423


>gi|117923675|ref|YP_864292.1| phosphoglucosamine mutase [Magnetococcus sp. MC-1]
 gi|158705800|sp|A0L4J3|GLMM_MAGSM RecName: Full=Phosphoglucosamine mutase
 gi|117607431|gb|ABK42886.1| phosphoglucosamine mutase [Magnetococcus sp. MC-1]
          Length = 483

 Score =  452 bits (1162), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 222/442 (50%), Positives = 315/442 (71%), Gaps = 1/442 (0%)

Query: 3   RRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSL 62
           R+FFGTDGIRG +N  P+TP+ ++++G A G++FR   K   V+IGKDTRLSGYM E++L
Sbjct: 32  RKFFGTDGIRGMANIHPMTPDLVLKLGRAAGHVFRVGDKRHTVIIGKDTRLSGYMFESAL 91

Query: 63  VAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVS 122
           +AG T+ G+    +GP+P+PA+A LTR+LRAD G+MISASHNP+ DNGIK FGP+G K+ 
Sbjct: 92  LAGLTSMGIHCLQVGPLPTPAIAFLTRALRADAGIMISASHNPFHDNGIKFFGPNGMKLP 151

Query: 123 TDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVVD 182
            ++E  IE +L  D    +     +G A R+D    RYIE  K + P+D+ L GLR+VVD
Sbjct: 152 DELELEIERVLLSDEDLPMPTPHHLGRAHRIDDALGRYIEFAKTSFPKDLRLDGLRVVVD 211

Query: 183 CANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIAL 242
           CA+GA+YKVAP V WELGA+VV +G+ PNG NIN   GS     + ++V EVRAD+GIA 
Sbjct: 212 CAHGAAYKVAPAVLWELGAEVVTLGNHPNGTNINDGVGSLYPQEMVKRVQEVRADVGIAF 271

Query: 243 DGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLGL 302
           DGD DRV+I DE+G I++GD I+A+ A E     +LRG+G+V TVMSN+GLER +A  GL
Sbjct: 272 DGDADRVVICDERGEILDGDVILAMSALEMKRKGVLRGDGVVATVMSNLGLERALAAEGL 331

Query: 303 SLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKPV 362
           +L RT+VGDRY++E+M  +GFN+GGEQSGH+I  D+ +TGDGL++AL VL  +    +P+
Sbjct: 332 TLARTKVGDRYVLEHMLAHGFNLGGEQSGHLIFLDHNTTGDGLISALSVLALMTTQAQPL 391

Query: 363 STICHCFEEYPQFLRSVSV-KDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLIR 421
           S + +  +  PQ L++V++ + +  ++ S +V AIA+AE++L    R++VR SGTE  +R
Sbjct: 392 SKLANVMQRVPQVLQNVTIARGSDPMDDSRVVAAIAEAEAQLGTRGRILVRKSGTEPKVR 451

Query: 422 IMAEGDDLSRIKRIVDDLAKVI 443
           +M EGDD + I  +   + + I
Sbjct: 452 VMVEGDDTAHITALASGVCEAI 473


>gi|254460809|ref|ZP_05074225.1| phosphoglucosamine mutase [Rhodobacterales bacterium HTCC2083]
 gi|206677398|gb|EDZ41885.1| phosphoglucosamine mutase [Rhodobacteraceae bacterium HTCC2083]
          Length = 448

 Score =  451 bits (1161), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 228/450 (50%), Positives = 301/450 (66%), Gaps = 12/450 (2%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVG-YLFRGKKKHRRVVIGKDTRLSGYMLE 59
           M R+ FGTDG+RGK+NT+P+T    +RIG A G Y  R   K  RVVIGKDTR SGYMLE
Sbjct: 1   MSRKLFGTDGVRGKANTYPMTAEMALRIGAAAGIYFRRNHSKVHRVVIGKDTRRSGYMLE 60

Query: 60  NSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGY 119
           ++L AG T+ GM  F++GPIP+PAV MLT S+RAD+G+MISASHNP++DNGIK FGPDGY
Sbjct: 61  SALTAGLTSTGMSVFLMGPIPTPAVGMLTPSMRADLGIMISASHNPHEDNGIKFFGPDGY 120

Query: 120 KVSTDIEDRIETLLED--DLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGL 177
           K+S + E  IE L+    DL   +     IG  + +     RY E VK   P +++L GL
Sbjct: 121 KLSDEAEMEIEALVASGGDLVEPMK----IGRTRHIYDGRSRYNERVKAAFPSNLSLGGL 176

Query: 178 RIVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRAD 237
           ++V+DCANGA+Y+ APEV WELGA+V+ +G  PNG NIN +CGST  ++    V    A 
Sbjct: 177 KVVIDCANGAAYRAAPEVLWELGAEVIPVGVSPNGYNINDNCGSTMPMTASETVIAHGAH 236

Query: 238 IGIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFI 297
           +GI LDGD DR II+DE G + +GDQ M LIA  W     L+G+ +V TVMSN+GLER +
Sbjct: 237 VGICLDGDADRCIILDETGKVADGDQFMGLIAGRWAQEGRLKGDTLVATVMSNLGLERHL 296

Query: 298 AGLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQ 357
              GL+L RT VGDRY++E M+ N FN+GGEQSGHI+++DY +TGDGL+A LQ L  + +
Sbjct: 297 ESKGLTLARTGVGDRYVVEEMRKNDFNLGGEQSGHIVMTDYATTGDGLMAGLQFLGELAR 356

Query: 358 YDKPVSTICHCFEEYPQFLRSVSVKDTSI-LNSSSIVQAIADAESELRGIDRLIVRASGT 416
             +  S +   FE  PQ L++V      I L  S +   I  AE +L G  RL++R SGT
Sbjct: 357 TGRKASELISVFEPVPQMLQNVRYAAGQIPLEDSKVQSVIVGAEKDLSGKGRLLIRKSGT 416

Query: 417 ESLIRIMAEGDDL----SRIKRIVDDLAKV 442
           E LIR+MAE +D       ++RIV ++A+ 
Sbjct: 417 EPLIRVMAECEDPDLLNEVVERIVGEVARA 446


>gi|317052484|ref|YP_004113600.1| phosphoglucosamine mutase [Desulfurispirillum indicum S5]
 gi|316947568|gb|ADU67044.1| phosphoglucosamine mutase [Desulfurispirillum indicum S5]
          Length = 455

 Score =  450 bits (1158), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 221/445 (49%), Positives = 319/445 (71%), Gaps = 4/445 (0%)

Query: 3   RRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLF--RGKKKHRRVVIGKDTRLSGYMLEN 60
           R+FFGTDG+RG++N +P+T +F++++G+A  ++F  R   K  ++VIGKDTR SGYMLE+
Sbjct: 2   RQFFGTDGVRGEANCYPMTADFVLKLGMAAAHIFKDRDTSKKSQIVIGKDTRRSGYMLES 61

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +LVAG T+AGMDA  LGP+P+P +A++T++LRA  G++ISASHNP+ DNGIK F  DG+K
Sbjct: 62  ALVAGITSAGMDAIQLGPLPTPGIALMTKTLRASAGIVISASHNPFFDNGIKFFNRDGFK 121

Query: 121 VSTDIEDRIETL-LEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRI 179
           +  ++E+ +E + LE+D+  Y S   ++G A+R++G  +RYIE+ K T PR++TL G++I
Sbjct: 122 LDDNVEEELERIVLENDVERYTSRRGALGRARRIEGATERYIEYCKGTFPRNMTLDGMKI 181

Query: 180 VVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIG 239
           VVDCANGA+YKVAPEVF ELGA  + I  +PNGININ  CG+ +   L + V    A+IG
Sbjct: 182 VVDCANGAAYKVAPEVFSELGAQTIAINTQPNGININEQCGAVHPEGLAQAVISHGAEIG 241

Query: 240 IALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAG 299
           IALDGD DR+I+VD  G +++GDQI+ +  R     SLL+G  +VTTVMSN+GLE F+AG
Sbjct: 242 IALDGDADRLIVVDRHGNVIDGDQIIGVAGRFMHQRSLLKGGAVVTTVMSNLGLEHFLAG 301

Query: 300 LGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYD 359
           + + L RT VGDRY+++ M+  GFN+GGEQSGH++  DY +TGDG+++ALQ++  + +  
Sbjct: 302 MNIKLIRTSVGDRYVLDRMRFGGFNLGGEQSGHLVFLDYATTGDGIISALQLMAIMVENG 361

Query: 360 KPVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQA-IADAESELRGIDRLIVRASGTES 418
           + +  +      YPQ L + SV +   L +    QA I D E  LRG  R++VR SGTE 
Sbjct: 362 RHIDELAADIPRYPQVLVNRSVSEKIPLENLPASQARIHDIEQALRGSGRVLVRYSGTEP 421

Query: 419 LIRIMAEGDDLSRIKRIVDDLAKVI 443
            +R+M EGDD   +K+  DD+A+ I
Sbjct: 422 KVRVMLEGDDEQTLKKYADDIAECI 446


>gi|94986636|ref|YP_594569.1| phosphoglucosamine mutase [Lawsonia intracellularis PHE/MN1-00]
 gi|158564221|sp|Q1MRX8|GLMM_LAWIP RecName: Full=Phosphoglucosamine mutase
 gi|94730885|emb|CAJ54248.1| phosphomannomutase [Lawsonia intracellularis PHE/MN1-00]
          Length = 451

 Score =  447 bits (1149), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 219/445 (49%), Positives = 312/445 (70%), Gaps = 2/445 (0%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M ++ FGTDG+RG+ N +P+TP   +R+G+A G  +R K    RVVIGKDTR+SGY+ EN
Sbjct: 1   MGKKLFGTDGLRGRVNIYPMTPEVALRLGLAAGTYYRRKSHRSRVVIGKDTRISGYIFEN 60

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +L AG  A+GMD F++GP+P+PAV+ LT ++RAD GV+ISASHNP+ DNGIKLF  DG+K
Sbjct: 61  ALTAGLLASGMDVFLVGPLPTPAVSFLTANMRADFGVVISASHNPFYDNGIKLFDADGFK 120

Query: 121 VSTDIEDRI-ETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRI 179
           +    E +I E +L+   T       S+G A ++     RYI ++K T P  ++L+GLRI
Sbjct: 121 IPDKAEHKISEMILDQSHTWDYPDPSSVGRAHKIKDALGRYIVYLKNTFPSTLSLEGLRI 180

Query: 180 VVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIG 239
           V+DCANGA+YKVAP    ELGA+++ IG  PNG+NIN  CGS     + +KV E+RADIG
Sbjct: 181 VLDCANGANYKVAPLALEELGAELIKIGTDPNGLNINHQCGSLFPEYVAKKVIEMRADIG 240

Query: 240 IALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAG 299
           +ALDGD DR+I+VDEKG I+NGDQIMAL A++ M  + L GN +V TVMSN+ LE F+  
Sbjct: 241 LALDGDADRLIVVDEKGIILNGDQIMALCAQDLMRQNKLPGNILVATVMSNMALEVFMKE 300

Query: 300 LGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYD 359
              +L R+ VGDRY+ME M+ +G   GGEQSGH+I  +Y +TGDGL+AALQ+LR +KQY+
Sbjct: 301 KKGALIRSNVGDRYVMEAMRKHGAMFGGEQSGHLIFREYSNTGDGLLAALQILRIMKQYE 360

Query: 360 KPVSTICHCFEEYPQFLRSVSVKDTSILNS-SSIVQAIADAESELRGIDRLIVRASGTES 418
           +P+S++    + +PQ L +V+VK    + +  ++++ I   E+   G  R+++R SGTE 
Sbjct: 361 RPLSSLAGLLQLFPQRLINVNVKQKRPIETMPTLLKTIQRIETAFSGRGRVLLRYSGTEP 420

Query: 419 LIRIMAEGDDLSRIKRIVDDLAKVI 443
           L R+M EG+  S++    ++LA ++
Sbjct: 421 LCRVMVEGESDSKVNTYAEELADIV 445


>gi|284097491|ref|ZP_06385580.1| Phosphoglucosamine mutase [Candidatus Poribacteria sp. WGA-A3]
 gi|283830999|gb|EFC35020.1| Phosphoglucosamine mutase [Candidatus Poribacteria sp. WGA-A3]
          Length = 449

 Score =  446 bits (1146), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 223/443 (50%), Positives = 301/443 (67%), Gaps = 2/443 (0%)

Query: 3   RRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSL 62
           R+ FGTDG+RG +N  P+    ++++G AV Y+F+G+  H ++VIGKDTRLSGYMLE++L
Sbjct: 2   RKLFGTDGVRGIANLEPMNSEMVLKLGRAVAYVFKGRAGHHQIVIGKDTRLSGYMLESAL 61

Query: 63  VAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVS 122
           ++G  + G+D  ++GP+PSP VA LTRSLRAD GVMISASHNPYQDNGIK F  DG+K+ 
Sbjct: 62  ISGICSMGVDVLLVGPMPSPGVAFLTRSLRADAGVMISASHNPYQDNGIKFFSHDGFKLP 121

Query: 123 TDIEDRIETL-LEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVV 181
            D+E RIE L L +++       + IG A R+     RYIE VKR+LPR++  QG+++V+
Sbjct: 122 DDLELRIEELILSNEIEHLRPTANEIGKAFRIPDAEGRYIEFVKRSLPREMDYQGMKVVI 181

Query: 182 DCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIA 241
           DCA+GA+Y V P+V  ELGADV VIGD+P+G NIN   G+     LQ  V   R DIGIA
Sbjct: 182 DCAHGAAYSVFPKVIRELGADVSVIGDEPDGTNINAGYGALYPERLQEAVRAHRGDIGIA 241

Query: 242 LDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLG 301
           LDGD DR + V E+G +VNGDQ +A  A +      L  + +V TVMSN GLE  +   G
Sbjct: 242 LDGDADRAVFVTEEGDVVNGDQALAAFALDLQQRGGLNRHTVVGTVMSNFGLESAMQKNG 301

Query: 302 LSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKP 361
           ++L RT VGDR I+E M  +G+N+GGEQSGH+I  DY +TGDGL++ LQ+L+ +K+    
Sbjct: 302 INLVRTPVGDRSILERMLADGYNLGGEQSGHVIFLDYNTTGDGLISGLQMLKLVKRSGSA 361

Query: 362 VSTICHCFEEYPQFLRSVSVKDTSILNS-SSIVQAIADAESELRGIDRLIVRASGTESLI 420
           VS + HC E  PQ L  V+V     L S   + +AI   E  L G  R++VR SGTE L+
Sbjct: 362 VSELTHCIETVPQVLLGVTVNRKPDLGSLPELREAIRSGEERLNGTGRILVRYSGTEPLV 421

Query: 421 RIMAEGDDLSRIKRIVDDLAKVI 443
           R+M EG D S+I+ + D+LA V+
Sbjct: 422 RVMVEGQDYSQIREVADELAGVV 444


>gi|330991886|ref|ZP_08315835.1| Phosphoglucosamine mutase [Gluconacetobacter sp. SXCC-1]
 gi|329760907|gb|EGG77402.1| Phosphoglucosamine mutase [Gluconacetobacter sp. SXCC-1]
          Length = 406

 Score =  445 bits (1144), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 220/399 (55%), Positives = 286/399 (71%)

Query: 45  VVIGKDTRLSGYMLENSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHN 104
           +++GKDTRLSGYM+E +LV+GF +AGMD  ++GP+P+PA+AMLTRSLRAD+GVMISASHN
Sbjct: 1   MLLGKDTRLSGYMIECALVSGFLSAGMDVTLVGPMPTPAIAMLTRSLRADLGVMISASHN 60

Query: 105 PYQDNGIKLFGPDGYKVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHV 164
           PY DNGIKLFGPDG+K+S + E  IE  +  DLT  L+  D IG A R++    RY+E+ 
Sbjct: 61  PYGDNGIKLFGPDGFKLSDETEAGIEEDMGMDLTDRLAAPDQIGRASRLNDAAGRYVENA 120

Query: 165 KRTLPRDVTLQGLRIVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNV 224
           K + PR + L GLRIV+DCANGA+Y+VAP   WELGA+VV IG  P+GININ  CGST  
Sbjct: 121 KSSFPRGLRLDGLRIVIDCANGAAYRVAPTALWELGAEVVRIGCDPDGININEGCGSTRP 180

Query: 225 LSLQRKVHEVRADIGIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIV 284
            +L   V   RADIGIALDGD DRV+I DEKG +++GDQI+ALI+  W     L G  IV
Sbjct: 181 EALCAAVLRHRADIGIALDGDADRVLISDEKGRLIDGDQILALISTSWARQGRLSGRHIV 240

Query: 285 TTVMSNIGLERFIAGLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDG 344
            TVMSN+GLER++   GL L RT VGDRY++E M+  G N+GGEQSGH++LSD+ +TGDG
Sbjct: 241 ATVMSNMGLERYLQTQGLELVRTAVGDRYVVEKMRELGANIGGEQSGHMVLSDFATTGDG 300

Query: 345 LVAALQVLRYIKQYDKPVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELR 404
           LVAALQVL  + +   P S +C  F  YPQ LR++     S L+   + +A   AE  L 
Sbjct: 301 LVAALQVLAEVVETGCPASAVCRMFRPYPQMLRNIRFVGRSPLHDPQVHEARKAAEKRLG 360

Query: 405 GIDRLIVRASGTESLIRIMAEGDDLSRIKRIVDDLAKVI 443
              RL++R SGTE L+R+M E +D + +K +V+D+ + I
Sbjct: 361 EHGRLLLRESGTEPLVRVMVEAEDEALVKDVVEDMCESI 399


>gi|302038044|ref|YP_003798366.1| phosphoglucosamine mutase [Candidatus Nitrospira defluvii]
 gi|300606108|emb|CBK42441.1| Phosphoglucosamine mutase [Candidatus Nitrospira defluvii]
          Length = 449

 Score =  444 bits (1143), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 225/443 (50%), Positives = 300/443 (67%), Gaps = 2/443 (0%)

Query: 3   RRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSL 62
           R+ FGTDG+RG +N  P+T    M++G A  ++F  +    +VVIGKDTRLSGYMLE++L
Sbjct: 2   RKLFGTDGVRGVANLEPMTSEIAMQLGRAAAHMFMRRAGRHQVVIGKDTRLSGYMLESAL 61

Query: 63  VAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVS 122
            +G  + G+D  ++GP+P+PA+A LTRSLRAD GV+ISASHNPYQDNGIK F  +G+K+ 
Sbjct: 62  TSGICSMGVDVLLVGPLPTPAIAFLTRSLRADAGVVISASHNPYQDNGIKFFSNEGFKLP 121

Query: 123 TDIEDRIETLLEDDLTSYL-SCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVV 181
            ++E RIE L+  D   +L    D+IG A R+D    RYIE VKR+LPRD+  QG+++VV
Sbjct: 122 DELEARIEQLIISDEIKHLRPTADAIGKAYRIDDAEGRYIEFVKRSLPRDLDFQGIKLVV 181

Query: 182 DCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIA 241
           DCANGA+YKVAP VF ELGA++ VI + P+G+NIN  CG+ +   LQ  V    A IGIA
Sbjct: 182 DCANGAAYKVAPAVFRELGAEIEVIANTPDGMNINDGCGAVHPERLQEAVRRHGAHIGIA 241

Query: 242 LDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLG 301
           LDGD DR I V E+G I++GD +MA +  +  +   L    +V TVMSN GLE  +   G
Sbjct: 242 LDGDADRAIFVCEQGTIIDGDHVMAALGLDLHAQGQLACQTVVGTVMSNFGLEIAMKKAG 301

Query: 302 LSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKP 361
           + L RT VGDRY+ME M  +G+N GGEQSGH I  D+ +TGDGL++ALQ+L  +K+  KP
Sbjct: 302 IQLMRTPVGDRYLMERMLADGYNFGGEQSGHFIFLDHNTTGDGLISALQILSLMKRTGKP 361

Query: 362 VSTICHCFEEYPQFLRSVSVKDTSILNS-SSIVQAIADAESELRGIDRLIVRASGTESLI 420
           +S +       PQ L +V VK    LN    I QAI  AE  L G  R++VR SGTESL+
Sbjct: 362 LSELAKAMTAVPQILLNVKVKHKPDLNQIPDIQQAIKSAEVTLNGSGRVLVRYSGTESLL 421

Query: 421 RIMAEGDDLSRIKRIVDDLAKVI 443
           RIM EG+  S I+ + D LA+++
Sbjct: 422 RIMVEGERDSTIREVADHLAEIV 444


>gi|163746099|ref|ZP_02153458.1| phosphoglucosamine mutase [Oceanibulbus indolifex HEL-45]
 gi|161380844|gb|EDQ05254.1| phosphoglucosamine mutase [Oceanibulbus indolifex HEL-45]
          Length = 448

 Score =  444 bits (1143), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 225/442 (50%), Positives = 303/442 (68%), Gaps = 4/442 (0%)

Query: 4   RFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKH-RRVVIGKDTRLSGYMLENSL 62
           + FGTDG+RG +N  P+T    +RIG AVG  FR +K    RVVIGKDTRLSGYM EN+L
Sbjct: 3   KLFGTDGVRGTANFHPMTAEMALRIGAAVGRYFRREKDSVHRVVIGKDTRLSGYMFENAL 62

Query: 63  VAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVS 122
            AG T+ GM+  +LGP+P+PAV +LTRS+RAD+GVMISASHNP  DNGIK FGPDG+K+S
Sbjct: 63  TAGLTSTGMNVLLLGPVPTPAVGLLTRSMRADLGVMISASHNPASDNGIKFFGPDGFKLS 122

Query: 123 TDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVVD 182
             +E  IETL+ + +    +  D IG AKR+D    RYIE VK + PR + L GL++V+D
Sbjct: 123 DQVEHEIETLVAEGVEP--TAPDQIGRAKRIDDSRFRYIERVKSSFPRQMRLDGLKVVID 180

Query: 183 CANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIAL 242
           CA+GA+Y VAP   WELGA V+ +G  PNG+NIN  CGST   S    V    AD+GI L
Sbjct: 181 CAHGAAYHVAPMALWELGATVIPVGVAPNGLNINDGCGSTEPQSAAEAVVANGADVGICL 240

Query: 243 DGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLGL 302
           DGD DRVI++D+ G I +GDQ MAL+A  W +   L    +V TVMSN+GLERF+   G+
Sbjct: 241 DGDADRVILIDQNGRIGDGDQFMALMAARWAADDRLANKALVATVMSNLGLERFLNDRGV 300

Query: 303 SLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKPV 362
            L+RT VGDRY++E M+  GFN+GGEQSGHI+++D+ +TGDGL+A +Q L  + +  KP 
Sbjct: 301 QLERTAVGDRYVVERMRAGGFNLGGEQSGHIVMTDHATTGDGLMAGMQFLAEMVRSGKPA 360

Query: 363 STICHCFEEYPQFLRSVSVKD-TSILNSSSIVQAIADAESELRGIDRLIVRASGTESLIR 421
           S + + F+  PQ L++V      + L  + +  AIA AE++L    RL++R SGTE L+R
Sbjct: 361 SELLYQFDPVPQLLKNVRFSSGQTPLEDAQVQAAIAQAEADLAKGGRLLIRKSGTEPLVR 420

Query: 422 IMAEGDDLSRIKRIVDDLAKVI 443
           +MAE +D + ++  VD +   +
Sbjct: 421 VMAEHEDAALMEGAVDSVVDAV 442


>gi|46579693|ref|YP_010501.1| phosphoglucosamine mutase [Desulfovibrio vulgaris str.
           Hildenborough]
 gi|120602827|ref|YP_967227.1| phosphoglucosamine mutase [Desulfovibrio vulgaris DP4]
 gi|81566867|sp|Q72CK1|GLMM_DESVH RecName: Full=Phosphoglucosamine mutase
 gi|158513915|sp|A1VED4|GLMM_DESVV RecName: Full=Phosphoglucosamine mutase
 gi|46449108|gb|AAS95760.1| phosphoglucosamine mutase [Desulfovibrio vulgaris str.
           Hildenborough]
 gi|120563056|gb|ABM28800.1| phosphoglucosamine mutase [Desulfovibrio vulgaris DP4]
 gi|311233488|gb|ADP86342.1| phosphoglucosamine mutase [Desulfovibrio vulgaris RCH1]
          Length = 450

 Score =  444 bits (1141), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 217/445 (48%), Positives = 310/445 (69%), Gaps = 2/445 (0%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M RR FGTDG+RG+ N +P+T +  +R+G+A G  FR   +  RVVIGKDTRLSGYM E+
Sbjct: 1   MGRRLFGTDGLRGQVNIYPMTADMALRLGLAAGTRFRNGNRRHRVVIGKDTRLSGYMFES 60

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +L AG  AAGMD F +GP+P+PA++ LTR++RAD+GV+ISASHNP+ DNGIK F   G+K
Sbjct: 61  ALTAGLCAAGMDVFQVGPLPTPAISFLTRNMRADLGVVISASHNPFMDNGIKFFDRSGFK 120

Query: 121 VSTDIEDRI-ETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRI 179
           +  D+E+++ + +L+ D        + +G A ++     RYI ++K + P D+TL GLR+
Sbjct: 121 LPDDVENQMTDMVLDPDWQWDYPASEKVGRAYKIADAPGRYIVYIKSSFPADLTLDGLRV 180

Query: 180 VVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIG 239
           V+DCANGA+YKVAP    ELGA+V+ +G +PNG+NIN  CGS     +  KV E RADIG
Sbjct: 181 VIDCANGANYKVAPLALEELGAEVIKLGTEPNGLNINHQCGSLYPEVVAAKVRETRADIG 240

Query: 240 IALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAG 299
           +ALDGD DR+I+VDEKG I++GDQIMAL A++ M+   L GN +V TVMSN+ LE F+  
Sbjct: 241 LALDGDADRLIVVDEKGTILDGDQIMALCAQDLMAKGKLPGNMLVATVMSNMALEVFMKE 300

Query: 300 LGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYD 359
            G +L RT VGDRY++E M+ +G  +GGEQSGH+I  +Y +TGDGL+AALQ+LR +++  
Sbjct: 301 HGGTLLRTAVGDRYVVEAMRQHGALLGGEQSGHLIFREYSTTGDGLLAALQILRIMRERG 360

Query: 360 KPVSTICHCFEEYPQFLRSVSV-KDTSILNSSSIVQAIADAESELRGIDRLIVRASGTES 418
           KP+S +    + +PQ L +V V +         +  A+A  E+EL    R+++R SGTES
Sbjct: 361 KPLSELAGQLQLFPQQLINVHVERKIPFAECQPVADAVAAIETELGDRGRVLLRYSGTES 420

Query: 419 LIRIMAEGDDLSRIKRIVDDLAKVI 443
           + R+M EG+   ++ R+ + LA+ +
Sbjct: 421 VCRVMVEGEHPEQVARLAEMLAETV 445


>gi|83942781|ref|ZP_00955242.1| phosphoglucosamine mutase [Sulfitobacter sp. EE-36]
 gi|83846874|gb|EAP84750.1| phosphoglucosamine mutase [Sulfitobacter sp. EE-36]
          Length = 430

 Score =  443 bits (1140), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 219/420 (52%), Positives = 293/420 (69%), Gaps = 4/420 (0%)

Query: 20  ITPNFMMRIGIAVG-YLFRGKKKHRRVVIGKDTRLSGYMLENSLVAGFTAAGMDAFILGP 78
           +T    ++IG AVG Y   G+    RVVIGKDTRLSGYM EN+L AG T++GM+  +LGP
Sbjct: 1   MTAEVALKIGAAVGRYFSAGRDGVHRVVIGKDTRLSGYMFENALTAGLTSSGMNVLLLGP 60

Query: 79  IPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVSTDIEDRIETLLEDDLT 138
           +P+PAV +LTRS+RAD+GVMISASHNP  DNGIK FGPDG+K+S  +E  IE L+E  + 
Sbjct: 61  VPTPAVGLLTRSMRADLGVMISASHNPATDNGIKFFGPDGFKLSDAVEAEIEALIEGGVE 120

Query: 139 SYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVVDCANGASYKVAPEVFWE 198
             L+  D IG AKR+D    RY+E VK + PR + L GL++V+DCANGA+++VAPE  WE
Sbjct: 121 --LNPADKIGRAKRIDDGRFRYVERVKSSFPRQMRLDGLKVVIDCANGAAHRVAPETLWE 178

Query: 199 LGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIALDGDGDRVIIVDEKGAI 258
           LGA+V+ IG  PNG NIN +CGST+       V E  A +GI LDGD DRVI++DE G +
Sbjct: 179 LGAEVIEIGVSPNGFNINENCGSTHPERAAAAVVEHGAHVGICLDGDADRVILIDETGKV 238

Query: 259 VNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLGLSLKRTEVGDRYIMEYM 318
            +GDQ MAL+A  W +   L    +V TVMSN+GLE F+ G GL L+RT VGDRY++E M
Sbjct: 239 GDGDQFMALMASRWAAEDRLANGALVATVMSNLGLEHFLQGKGLRLERTSVGDRYVVERM 298

Query: 319 KNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKPVSTICHCFEEYPQFLRS 378
           +  GFN+GGEQSGHI+++D+ +TGDGL+A LQ L  + + +K  S + + FE  PQ L++
Sbjct: 299 REGGFNLGGEQSGHIVMTDHATTGDGLMAGLQFLAEMIRSEKTSSELLNNFEPVPQLLKN 358

Query: 379 VSVKDTSI-LNSSSIVQAIADAESELRGIDRLIVRASGTESLIRIMAEGDDLSRIKRIVD 437
           V      + L  + +  AIA AE++L G  RL++R SGTE L+R+MAE +D   ++R VD
Sbjct: 359 VRFSAGQVPLEDAQVQGAIAQAEADLAGQGRLLIRKSGTEPLVRVMAEHEDAQLMERAVD 418


>gi|83955605|ref|ZP_00964185.1| phosphoglucosamine mutase [Sulfitobacter sp. NAS-14.1]
 gi|83839899|gb|EAP79075.1| phosphoglucosamine mutase [Sulfitobacter sp. NAS-14.1]
          Length = 430

 Score =  442 bits (1137), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 219/420 (52%), Positives = 293/420 (69%), Gaps = 4/420 (0%)

Query: 20  ITPNFMMRIGIAVG-YLFRGKKKHRRVVIGKDTRLSGYMLENSLVAGFTAAGMDAFILGP 78
           +T    ++IG AVG Y   G+    RVVIGKDTRLSGYM EN+L AG T++GM+  +LGP
Sbjct: 1   MTAEVALKIGAAVGRYFSAGRDGVHRVVIGKDTRLSGYMFENALTAGLTSSGMNVLLLGP 60

Query: 79  IPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVSTDIEDRIETLLEDDLT 138
           +P+PAV +LTRS+RAD+GVMISASHNP  DNGIK FGPDG+K+S  +E  IE L+E  + 
Sbjct: 61  VPTPAVGLLTRSMRADLGVMISASHNPATDNGIKFFGPDGFKLSDAVEAEIEALIEGGVE 120

Query: 139 SYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVVDCANGASYKVAPEVFWE 198
             L+  D IG AKR+D    RY+E VK + PR + L GL++V+DCANGA+++VAPE  WE
Sbjct: 121 --LNPADKIGRAKRIDDGRFRYVERVKSSFPRQMRLDGLKVVIDCANGAAHRVAPETLWE 178

Query: 199 LGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIALDGDGDRVIIVDEKGAI 258
           LGA+V+ IG  PNG NIN +CGST+       V E  A +GI LDGD DRVI++DE G +
Sbjct: 179 LGAEVIEIGVSPNGFNINENCGSTHPERAAAAVVEHGAHVGICLDGDADRVILIDETGKV 238

Query: 259 VNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLGLSLKRTEVGDRYIMEYM 318
            +GDQ MAL+A  W +   L    +V TVMSN+GLE F+ G GL L+RT VGDRY++E M
Sbjct: 239 GDGDQFMALMASRWAAEDRLANGTLVATVMSNLGLEHFLQGKGLRLERTSVGDRYVVERM 298

Query: 319 KNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKPVSTICHCFEEYPQFLRS 378
           +  GFN+GGEQSGHI+++D+ +TGDGL+A LQ L  + + +K  S + + FE  PQ L++
Sbjct: 299 REGGFNLGGEQSGHIVMTDHATTGDGLMAGLQFLAEMIRSEKTSSELLNNFEPVPQLLKN 358

Query: 379 VSVKDTSI-LNSSSIVQAIADAESELRGIDRLIVRASGTESLIRIMAEGDDLSRIKRIVD 437
           V      + L  + +  AIA AE++L G  RL++R SGTE L+R+MAE +D   ++R VD
Sbjct: 359 VRFSAGQVPLEDAQVQGAIAQAEADLAGQGRLLIRKSGTEPLVRVMAEHEDAQLMERAVD 418


>gi|291279424|ref|YP_003496259.1| phosphoglucosamine mutase [Deferribacter desulfuricans SSM1]
 gi|290754126|dbj|BAI80503.1| phosphoglucosamine mutase [Deferribacter desulfuricans SSM1]
          Length = 453

 Score =  442 bits (1136), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 218/441 (49%), Positives = 310/441 (70%), Gaps = 3/441 (0%)

Query: 3   RRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSL 62
           R+FFGTDGIRG++N +P+  +F +++G A+  +F+   +  ++VIGKDTR+SGYM EN++
Sbjct: 2   RKFFGTDGIRGRANIYPMVSDFALKLGKAIATIFKNGNRKHKIVIGKDTRISGYMFENAI 61

Query: 63  VAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVS 122
           V+G  + G+DA +LG +P+PA+A +T+SLRAD GV+ISASHNPY DNGIK FGPDGYK++
Sbjct: 62  VSGICSVGVDAVLLGVLPTPAIAFITKSLRADAGVVISASHNPYYDNGIKFFGPDGYKLN 121

Query: 123 TDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVVD 182
            ++E  IE L+E D  ++     +IG A R++    RY+E+VK T  RD+ L+GL+IV+D
Sbjct: 122 DELELEIEKLIEKD--NFDLSPSNIGKAYRIETAIGRYVEYVKSTFDRDIDLKGLKIVID 179

Query: 183 CANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIAL 242
           CANGA+YKVAP    ELGADV+VI DKPNG NIN  CG+ N   LQ +V +  AD+GI+ 
Sbjct: 180 CANGATYKVAPMAISELGADVIVINDKPNGFNINDGCGAVNPEKLQGEVIKNNADLGISF 239

Query: 243 DGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLGL 302
           DGDGDRVI VDEKG +V+GD IM + A       LL  + +V TVMSNIG E  +   G+
Sbjct: 240 DGDGDRVIFVDEKGEVVDGDYIMGICANYMNKQGLLNNSTVVATVMSNIGFENSLKREGI 299

Query: 303 SLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKPV 362
            + R++VGDRY++E M   G+N+GGEQSGHII SDY +TGDGL++ALQ+L+ + +  + +
Sbjct: 300 KIIRSQVGDRYVLEEMLKGGYNLGGEQSGHIIFSDYNTTGDGLISALQLLKVLVKSGETL 359

Query: 363 STICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADA-ESELRGIDRLIVRASGTESLIR 421
           + I    E YPQ L+++ V +   L   S ++ + D  E+EL+G  R++VR SGTE+ +R
Sbjct: 360 NRIKKFIEVYPQKLKNLPVDEKVPLEKLSKLKNVIDEIENELQGDGRVLVRYSGTENKLR 419

Query: 422 IMAEGDDLSRIKRIVDDLAKV 442
           IM E     +I   +D + +V
Sbjct: 420 IMVEAIYEDKIDMYIDRICEV 440


>gi|218885167|ref|YP_002434488.1| phosphoglucosamine mutase [Desulfovibrio vulgaris str. 'Miyazaki
           F']
 gi|226722735|sp|B8DN76|GLMM_DESVM RecName: Full=Phosphoglucosamine mutase
 gi|218756121|gb|ACL07020.1| phosphoglucosamine mutase [Desulfovibrio vulgaris str. 'Miyazaki
           F']
          Length = 450

 Score =  441 bits (1135), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 213/445 (47%), Positives = 311/445 (69%), Gaps = 2/445 (0%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M +R FGTDG+RG+ N +P+T +  +R+G+A G  FR   +  RVVIGKDTRLSGY+ E+
Sbjct: 1   MGKRLFGTDGLRGQVNIYPMTADVALRLGLAAGTHFRNGNRRHRVVIGKDTRLSGYVFES 60

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +L AG  AAGMD +++GP+P+PA+A LTR++RAD+GV+ISASHNP+ DNGIK F  DG+K
Sbjct: 61  ALTAGLCAAGMDVYLVGPLPTPAIAFLTRNMRADLGVVISASHNPFMDNGIKFFDKDGFK 120

Query: 121 VSTDIEDRI-ETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRI 179
           +  ++E++I + +L+ D        + +G A +++    RYI ++K + P  +TL G+R+
Sbjct: 121 LPDEMENKITDMVLDPDWQWDYPAPERVGRAAKIEDSPGRYIVYLKNSFPAHLTLDGMRV 180

Query: 180 VVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIG 239
           V+DCANGA+YKVAP    ELGA+V+ IG +PNG+NIN  CGS        KV E RAD+G
Sbjct: 181 VLDCANGANYKVAPLALEELGAEVIKIGTEPNGLNINHQCGSLYPGVAAGKVLETRADVG 240

Query: 240 IALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAG 299
           +ALDGD DR+I+VDEKG +++GDQIMAL A + +    LR N +V TVMSN+ LE ++  
Sbjct: 241 LALDGDADRLIVVDEKGTVLDGDQIMALCADDMLRRGALRNNTLVATVMSNMALEVYMKE 300

Query: 300 LGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYD 359
            G  L RT VGDRY++E M+  G N+GGEQSGH+I  D+G+TGDGL+AALQ+LR +++ D
Sbjct: 301 RGCKLLRTPVGDRYVVEAMRREGANLGGEQSGHLIFMDHGTTGDGLMAALQILRIMRERD 360

Query: 360 KPVSTICHCFEEYPQFLRSVSV-KDTSILNSSSIVQAIADAESELRGIDRLIVRASGTES 418
           +P+S +    + +PQ L +V V +         ++  +A  E+EL    R+++R SGTE+
Sbjct: 361 RPLSELAGQLQLFPQELINVHVERKIPFEQCQPVLDGVAKVEAELGDRGRVLLRYSGTEA 420

Query: 419 LIRIMAEGDDLSRIKRIVDDLAKVI 443
           + R+M EG+D  ++KR+   LA+ +
Sbjct: 421 VCRVMVEGEDPEQVKRLASLLAETV 445


>gi|332704378|ref|ZP_08424466.1| phosphoglucosamine mutase [Desulfovibrio africanus str. Walvis Bay]
 gi|332554527|gb|EGJ51571.1| phosphoglucosamine mutase [Desulfovibrio africanus str. Walvis Bay]
          Length = 450

 Score =  441 bits (1134), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 213/445 (47%), Positives = 311/445 (69%), Gaps = 2/445 (0%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M ++ FGTDG+RG  NT+P+ P   +R+G+A G  FR   +  +VVIGKDTRLSGY+ E 
Sbjct: 1   MAKKLFGTDGMRGTVNTYPMVPEIALRLGLAAGKYFRNGARRHKVVIGKDTRLSGYVFET 60

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +L +G  A+GM   ++GP+P+PA++ LTR++RAD+G++ISASHNP+QDNGIK F  +G+K
Sbjct: 61  ALTSGLCASGMHVMLVGPMPTPAISFLTRNMRADIGIVISASHNPFQDNGIKFFDRNGFK 120

Query: 121 VSTDIEDRIETLLEDDLTSY-LSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRI 179
           +  ++E+ I  ++  + T +     D +G A +++    RYI  +K +LP+ VTL G RI
Sbjct: 121 LPDEVEEEITAMVLAEGTDWDYPSSDKVGRAFKIEDSPGRYIVSLKNSLPQAVTLDGFRI 180

Query: 180 VVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIG 239
           V+DCANGA+YKVAP +F ELGA+V+ +G +PNG+NIN  CGS +   L  KV E ++ IG
Sbjct: 181 VLDCANGATYKVAPLLFEELGAEVIKLGVEPNGLNINEKCGSLHPEVLAAKVRETQSGIG 240

Query: 240 IALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAG 299
           +ALDGDGDR+I+VDEKG +++GDQIMA+ A++      L GN +V TVMSN+ LE F+  
Sbjct: 241 LALDGDGDRLIVVDEKGTVLDGDQIMAICAKDLAERGELPGNLLVATVMSNMALEVFMQD 300

Query: 300 LGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYD 359
           LG  L RT VGDRY+ E ++     +GGEQSGHII S Y +TGDG++AALQ+LR +++  
Sbjct: 301 LGGRLLRTPVGDRYVAEALRRENGVLGGEQSGHIIFSRYATTGDGILAALQLLRIMQERG 360

Query: 360 KPVSTICHCFEEYPQFLRSVS-VKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTES 418
           KP+S +    E YPQ L +V  V+ T      ++ +A+ DAE +L G  R+++R SGTE 
Sbjct: 361 KPLSELAKLLEPYPQTLINVRVVRKTPFEEVPAVQKALVDAEQKLGGRGRVLLRYSGTEP 420

Query: 419 LIRIMAEGDDLSRIKRIVDDLAKVI 443
           L R+M EG+D + +K++ ++L  V+
Sbjct: 421 LARVMVEGEDKALVKQLSEELVGVV 445


>gi|254441374|ref|ZP_05054867.1| phosphoglucosamine mutase [Octadecabacter antarcticus 307]
 gi|198251452|gb|EDY75767.1| phosphoglucosamine mutase [Octadecabacter antarcticus 307]
          Length = 451

 Score =  441 bits (1134), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 225/449 (50%), Positives = 304/449 (67%), Gaps = 6/449 (1%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFR--GKKKHRRVVIGKDTRLSGYML 58
           M R+FFGTDG+RG +N +P+T    ++IG A G  FR  G   HR VVIGKDTRLSGYM 
Sbjct: 1   MARKFFGTDGVRGTANKYPMTAEMGLKIGAAAGRYFRNDGSNGHR-VVIGKDTRLSGYMF 59

Query: 59  ENSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDG 118
           E++L AG T+ GM+  +LGPIP+P V +LT S+RAD+G+MISASHNP  DNGIK FGPDG
Sbjct: 60  ESALTAGLTSTGMNVLLLGPIPTPGVGLLTTSMRADLGIMISASHNPAVDNGIKFFGPDG 119

Query: 119 YKVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLR 178
           YK+S + E  IE LLE  +    +   +IG AKR+D    RY E +K T P  + L G++
Sbjct: 120 YKLSDEAEVEIERLLEGTIEPAQAS--NIGRAKRIDDGRFRYAERLKGTFPHGMRLDGIK 177

Query: 179 IVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADI 238
           +V+DCANGA YKVAPEV WELGA V+ +G  P+G NIN  CGST   +    +    AD+
Sbjct: 178 VVIDCANGAGYKVAPEVLWELGATVIPVGTNPDGFNINDGCGSTAPRTAAETIVTHGADV 237

Query: 239 GIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIA 298
           GI LDGD DRV+I+D+ G + +GDQIM L A  W     L    +V TVMSN+GLER++ 
Sbjct: 238 GICLDGDADRVMILDQHGNVADGDQIMGLFANRWAKTDRLNKGTLVATVMSNLGLERYLN 297

Query: 299 GLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQY 358
             GL L+RT+VGDRY++E M+  GFN+GGEQSGHI+++D+ +TGDGL+A LQ L  + + 
Sbjct: 298 DKGLVLERTDVGDRYVVEAMRAGGFNLGGEQSGHIVMTDFATTGDGLLAGLQFLAAMIET 357

Query: 359 DKPVSTICHCFEEYPQFLRSVSVKDTS-ILNSSSIVQAIADAESELRGIDRLIVRASGTE 417
            KP S +   FE  PQ L++V   D +  L+ +++   IA AE+ L G  RL++R SGTE
Sbjct: 358 GKPASELIRVFETVPQMLKNVRYSDGADPLDQAAVKAVIAAAEASLVGKGRLLIRKSGTE 417

Query: 418 SLIRIMAEGDDLSRIKRIVDDLAKVIPMI 446
            LIR+MAE ++ + + ++VD +   +  +
Sbjct: 418 PLIRVMAECEEDALLAKVVDGIVAQVEAV 446


>gi|220904977|ref|YP_002480289.1| phosphoglucosamine mutase [Desulfovibrio desulfuricans subsp.
           desulfuricans str. ATCC 27774]
 gi|254798575|sp|B8J1K3|GLMM_DESDA RecName: Full=Phosphoglucosamine mutase
 gi|219869276|gb|ACL49611.1| phosphoglucosamine mutase [Desulfovibrio desulfuricans subsp.
           desulfuricans str. ATCC 27774]
          Length = 450

 Score =  439 bits (1129), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 226/446 (50%), Positives = 303/446 (67%), Gaps = 4/446 (0%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M  R FGTDG+RG  NT+P+T +  +R+G+A G  FR  +   +VVIGKDTRLSGYM E+
Sbjct: 1   MADRLFGTDGLRGTVNTYPMTVDVALRLGLAAGIRFRRGQHQHKVVIGKDTRLSGYMFES 60

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +L AG  AAGM   + GP+P+PA++ LTRS+RAD+GV+ISASHNP+QDNGIK F  DGYK
Sbjct: 61  ALTAGLCAAGMHVIMTGPLPTPAISFLTRSMRADLGVVISASHNPFQDNGIKFFDADGYK 120

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDS--IGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLR 178
           +    ED I  ++ D   S+    DS  +G A +++    RYI + K   P  +TL GLR
Sbjct: 121 LPDMAEDEIAAMVLDAGFSW-PYPDSRGVGRATKIEDAGGRYIVYTKNCFPAHLTLSGLR 179

Query: 179 IVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADI 238
           IVVDCANGASYKVAP    ELGA+V  IG  P+G NIN  CGS +   +  KV EVRADI
Sbjct: 180 IVVDCANGASYKVAPLALEELGAEVFRIGTGPDGTNINEHCGSLHPDVVAAKVREVRADI 239

Query: 239 GIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIA 298
           G+ALDGD DR+I+VDE+G +++GDQIMAL A+  M+   L GN +V T MSN+ LE F+ 
Sbjct: 240 GLALDGDADRLIVVDERGVVLDGDQIMALCAQAMMARGELPGNLLVATAMSNMALELFMR 299

Query: 299 GLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQY 358
             G  L RT+VGDRY+ME M+  G  +GGEQSGH+I   Y +TGDGL+AALQ+LR +++ 
Sbjct: 300 DHGGQLLRTKVGDRYVMEAMRREGAMLGGEQSGHLIFHRYSTTGDGLLAALQILRIMREK 359

Query: 359 DKPVSTICHCFEEYPQFLRSVSV-KDTSILNSSSIVQAIADAESELRGIDRLIVRASGTE 417
           ++P+S +      +PQ L +V V K        +I +A+A  E EL G  R+++R SGTE
Sbjct: 360 ERPLSELAGLLTPFPQKLINVRVEKRLPFEERPAIGEAVAQVEKELGGRGRVLLRYSGTE 419

Query: 418 SLIRIMAEGDDLSRIKRIVDDLAKVI 443
           +L R+M EG+   R++   +DLA+V+
Sbjct: 420 ALCRVMVEGEHEDRVRTYAEDLAQVV 445


>gi|323698293|ref|ZP_08110205.1| phosphoglucosamine mutase [Desulfovibrio sp. ND132]
 gi|323458225|gb|EGB14090.1| phosphoglucosamine mutase [Desulfovibrio desulfuricans ND132]
          Length = 450

 Score =  438 bits (1126), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 218/444 (49%), Positives = 306/444 (68%), Gaps = 4/444 (0%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           MK+R FGTDG+RG+ N FP+TP   +R+G+A G  FR   KH RVVIGKDTRLSGY+ E 
Sbjct: 1   MKQRLFGTDGLRGQGNIFPMTPEIALRLGLAAGQYFRNGDKHHRVVIGKDTRLSGYVFET 60

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +L +G  A GMD F++GP+P+PA++ LTR++RAD+GV+ISASHNP+ DNGIK F  +G+K
Sbjct: 61  ALTSGLCANGMDVFLVGPMPTPAISFLTRNMRADLGVVISASHNPFMDNGIKFFDRNGFK 120

Query: 121 VSTDIEDRIETLL--EDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLR 178
           +  ++ED I  L+  +D    Y    D +G A R+     RYI ++K +    +TL GL+
Sbjct: 121 LPDEVEDEISELVLGQDTKWDYPPAED-VGRAHRIADARGRYIVYLKNSFSPHLTLDGLK 179

Query: 179 IVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADI 238
           IV+DCA+GA+Y VAP+V  ELGA+VV +G  P+G+NIN  CGS     + R V E  AD+
Sbjct: 180 IVLDCAHGAAYGVAPDVLEELGAEVVKVGVNPDGLNINRKCGSLYPEVIARMVVEEGADL 239

Query: 239 GIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIA 298
           GIALDGD DR+I+ DE G I++GDQIMAL A E M    L GN +V TVMSN+ LE F+ 
Sbjct: 240 GIALDGDADRLIVCDENGRILDGDQIMALCALELMEKDRLPGNMLVATVMSNMALELFMT 299

Query: 299 GLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQY 358
             G  L RT+VGDRY++E M+  G  +GGEQSGH+I  D+ +TGDGL+AALQ+LR +++ 
Sbjct: 300 EHGGRLLRTDVGDRYVVEAMRREGATLGGEQSGHLIFMDHATTGDGLLAALQLLRIMRER 359

Query: 359 DKPVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQ-AIADAESELRGIDRLIVRASGTE 417
           ++P+S +    E +PQ LR+V VK     + +  VQ A+   E+ L+G  R+++R SGTE
Sbjct: 360 ERPLSELAGLLEPFPQVLRNVHVKRKVPFDQAPEVQEAVRRVEAALKGKGRVLLRYSGTE 419

Query: 418 SLIRIMAEGDDLSRIKRIVDDLAK 441
           ++ R+M EG D   ++++  D+ +
Sbjct: 420 AVCRVMVEGQDPELVEKLTGDIVE 443


>gi|212703549|ref|ZP_03311677.1| hypothetical protein DESPIG_01594 [Desulfovibrio piger ATCC 29098]
 gi|212673049|gb|EEB33532.1| hypothetical protein DESPIG_01594 [Desulfovibrio piger ATCC 29098]
          Length = 450

 Score =  437 bits (1125), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 219/445 (49%), Positives = 299/445 (67%), Gaps = 2/445 (0%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M  R FGTDG+RG  N +P+T +  +R+G+A G  FR      RVVIGKDTRLSGYM E+
Sbjct: 1   MAERLFGTDGLRGPVNIYPMTVDVALRLGLAAGVRFRKGSHQHRVVIGKDTRLSGYMFES 60

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +L AG  AAGM   + GP+P+PA++ LTR++RAD+GV+ISASHNPY DNGIK F  DG+K
Sbjct: 61  ALTAGLCAAGMHVIMTGPLPTPAISFLTRNMRADLGVVISASHNPYSDNGIKFFDADGFK 120

Query: 121 VSTDIEDRIETL-LEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRI 179
           +  ++E+ I  + L+ D+       + +G A +++    RYI + K   P  +TL GLRI
Sbjct: 121 LPDEVENEISAMVLDPDMRWPYPDSNRVGRASKIEDAGGRYIVYTKSCFPAHLTLSGLRI 180

Query: 180 VVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIG 239
           V+DCANGA+YKVAP    ELGA+V  +G  PNG NIN  CGS +  +L  KV EVRAD+G
Sbjct: 181 VIDCANGAAYKVAPLALEELGAEVFRLGTNPNGTNINDHCGSLHPETLAAKVREVRADVG 240

Query: 240 IALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAG 299
           +ALDGD DR+I+VDEKG +++GDQ+MAL A+  M    L GN +V T MSN+ LE F+  
Sbjct: 241 LALDGDADRLIVVDEKGNVLDGDQLMALGAQAMMERGELPGNMLVATAMSNLALEIFMKE 300

Query: 300 LGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYD 359
              +L RT+VGDRY+ME M+  G  +GGEQSGH+I   Y +TGDGL+AALQ+LR +++ +
Sbjct: 301 RAGTLLRTKVGDRYVMEAMRKTGAMLGGEQSGHLIYRQYSTTGDGLLAALQLLRIVREKE 360

Query: 360 KPVSTICHCFEEYPQFLRSVSV-KDTSILNSSSIVQAIADAESELRGIDRLIVRASGTES 418
           KP+S +      +PQ L +V V K        +I +A+AD E  L G  R+++R SGTE+
Sbjct: 361 KPLSELAGLLHLFPQKLINVRVEKKLPFEERPAIGKAVADVEKALAGRGRVLLRYSGTEA 420

Query: 419 LIRIMAEGDDLSRIKRIVDDLAKVI 443
           L R+M E +D  ++ R   DLA V+
Sbjct: 421 LCRVMVEAEDEDKVVRYARDLADVV 445


>gi|95930468|ref|ZP_01313204.1| phosphoglucosamine mutase [Desulfuromonas acetoxidans DSM 684]
 gi|95133508|gb|EAT15171.1| phosphoglucosamine mutase [Desulfuromonas acetoxidans DSM 684]
          Length = 456

 Score =  437 bits (1124), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 220/445 (49%), Positives = 302/445 (67%), Gaps = 2/445 (0%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M ++FFGTDG+RG +N +P+T    M++G AV YLF+G  K RR+VIGKDTRLSGYM+EN
Sbjct: 1   MTKKFFGTDGVRGVANVYPMTTEIAMQLGRAVAYLFKGSDKRRRIVIGKDTRLSGYMIEN 60

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           ++ +G  + G+D  ++GP+P+P +A +T S+RAD GV+ISASHNPYQDNGIK F  +G K
Sbjct: 61  AMASGICSMGVDVQLVGPLPTPGIAFITNSMRADAGVVISASHNPYQDNGIKFFSNEGLK 120

Query: 121 VSTDIEDRIETLL-EDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRI 179
           +  ++E R+E L+  ++L       D +G A R+D    RYI  +K T PRD+ L+G++I
Sbjct: 121 LPDEMELRLEQLMFSEELDVLRPTADEVGRAFRIDDATGRYIVFLKYTFPRDLDLRGMKI 180

Query: 180 VVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIG 239
           VVDCANGA+YKVAP VF ELGADVV IG  PNG NIN  CGS     L   V E  AD+G
Sbjct: 181 VVDCANGAAYKVAPAVFEELGADVVRIGVSPNGTNINAGCGSLYPAELADAVKEHGADVG 240

Query: 240 IALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAG 299
           +ALDGD DRVI VDE G  V+GD IMA+ A   +    L  N +V TVMSN+GL+  +  
Sbjct: 241 VALDGDADRVIFVDETGREVDGDHIMAICATHMLGEGTLAHNTLVATVMSNMGLDIALRR 300

Query: 300 LGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYD 359
            G ++ +T VGDRY++E M   G+N+GGEQSGH+I  D+ +TGDG+++ALQ L  +++  
Sbjct: 301 AGGTVVKTGVGDRYVVEEMLKKGYNLGGEQSGHMIFFDHNTTGDGVLSALQTLAIMQRTG 360

Query: 360 KPVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADA-ESELRGIDRLIVRASGTES 418
           KP+S +       PQ L +V VK+   L +   VQ + DA   EL    R+++R SGTE 
Sbjct: 361 KPLSQLAGVMTALPQLLVNVRVKEKVDLATVPAVQRVIDACNEELGETGRVLIRYSGTEP 420

Query: 419 LIRIMAEGDDLSRIKRIVDDLAKVI 443
           L+RIM EG++  +I+R+ DD+A  +
Sbjct: 421 LLRIMLEGENDQQIQRLADDIADAV 445


>gi|91762262|ref|ZP_01264227.1| phosphoglucomutase/phosphomannomutase family protein MrsA
           [Candidatus Pelagibacter ubique HTCC1002]
 gi|91718064|gb|EAS84714.1| phosphoglucomutase/phosphomannomutase family protein MrsA
           [Candidatus Pelagibacter ubique HTCC1002]
          Length = 443

 Score =  436 bits (1120), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 208/437 (47%), Positives = 303/437 (69%), Gaps = 3/437 (0%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRV-VIGKDTRLSGYMLE 59
           M +++FGTDGIRG  N+  I  +   + G+A G  F+ +KK +++ +I KDTRLSGY LE
Sbjct: 1   MAKKYFGTDGIRGAVNSKNINGDMFFKFGLATGTYFKTQKKKKQIAIIAKDTRLSGYSLE 60

Query: 60  NSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGY 119
            +LV+G T+AGM  + LGP+P+  +AMLT+S++A++G+MI+ASHNPY DNG+KLFGPDG 
Sbjct: 61  PALVSGLTSAGMHVYTLGPLPTNGLAMLTKSMKANMGIMITASHNPYHDNGLKLFGPDGL 120

Query: 120 KVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRI 179
           K+S  IE +IETL++  +   LS    +G  KR++  +  YI+ +K  LP+D  L+GLRI
Sbjct: 121 KLSNKIEKKIETLIDQKIEKSLSKPKKLGRVKRLENANKDYIKILKNNLPKDFNLRGLRI 180

Query: 180 VVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIG 239
           V+DCANGA YK  PE+   LGA V  IG  PNG+NIN +CGST    ++  V + +A IG
Sbjct: 181 VIDCANGAGYKAGPELLKSLGAKVFSIGINPNGLNINKNCGSTFPNKIRLAVKKYKAHIG 240

Query: 240 IALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAG 299
           I+LDGD DR+I+ DEKG +++GDQI+A IA  W    +L+G G+V T+MSN GLE+F   
Sbjct: 241 ISLDGDADRIIMCDEKGIVIDGDQIIAAIAMRWKRKKMLKG-GVVGTLMSNYGLEKFFKL 299

Query: 300 LGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYD 359
             +   R+ VGDR++ E M+ N FN+GGEQSGHIIL  + +TGDGL+ AL+VL  +++  
Sbjct: 300 YNIKFLRSNVGDRFVKEKMQKNNFNLGGEQSGHIILGKFATTGDGLLVALEVLFSLRK-G 358

Query: 360 KPVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESL 419
           K  S+  + F + PQ L ++ VKD +I+ +  I  +I  AE  ++G  R++VR+SGTES 
Sbjct: 359 KKASSFFNTFNKTPQILENIDVKDKNIIKNIDIKNSIKLAEKLIKGQGRILVRSSGTESK 418

Query: 420 IRIMAEGDDLSRIKRIV 436
           IR+M E D++  +++ +
Sbjct: 419 IRVMGESDNIKLLQKCL 435


>gi|71083308|ref|YP_266027.1| phosphoglucomutase/phosphomannomutase family protein MrsA
           [Candidatus Pelagibacter ubique HTCC1062]
 gi|84029247|sp|Q4FN15|GLMM_PELUB RecName: Full=Phosphoglucosamine mutase
 gi|71062421|gb|AAZ21424.1| phosphoglucomutase/phosphomannomutase family protein MrsA
           [Candidatus Pelagibacter ubique HTCC1062]
          Length = 443

 Score =  434 bits (1115), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 208/437 (47%), Positives = 302/437 (69%), Gaps = 3/437 (0%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRV-VIGKDTRLSGYMLE 59
           M +++FGTDGIRG  N+  I  +   + G+A G  F+ +KK +++ +I KDTRLSGY LE
Sbjct: 1   MAKKYFGTDGIRGAVNSKNINGDMFFKFGLATGTYFKTQKKKKQIAIIAKDTRLSGYSLE 60

Query: 60  NSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGY 119
            +LV+G T+AGM  + LGP+P+  +AMLT+S++A++G+MI+ASHNPY DNG+KLFGPDG 
Sbjct: 61  PALVSGLTSAGMHVYTLGPLPTNGLAMLTKSMKANMGIMITASHNPYHDNGLKLFGPDGL 120

Query: 120 KVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRI 179
           K+S  IE +IETL++  +   LS    +G  KR++  +  YI+ +K  LP+D  L+GLRI
Sbjct: 121 KLSNKIEKKIETLIDQKIEKSLSKPKKLGRVKRLETANKDYIKILKNNLPKDFNLRGLRI 180

Query: 180 VVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIG 239
           V+DCANGA YK  PE+   LGA V  IG  PNG+NIN +CGST    ++  V   +A IG
Sbjct: 181 VIDCANGAGYKAGPELLKSLGAKVFSIGINPNGLNINKNCGSTFPNKIRLAVKRYKAHIG 240

Query: 240 IALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAG 299
           I+LDGD DR+I+ DEKG +++GDQI+A IA  W    +L+G G+V T+MSN GLE+F   
Sbjct: 241 ISLDGDADRIIMCDEKGIVIDGDQIIAAIAMRWKRKKMLKG-GVVGTLMSNYGLEKFFKL 299

Query: 300 LGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYD 359
             +   R+ VGDR++ E M+ N FN+GGEQSGHIIL  + +TGDGL+ AL+VL  +++  
Sbjct: 300 HNIKFLRSNVGDRFVKEKMQKNNFNLGGEQSGHIILGKFATTGDGLLVALEVLFSLRK-G 358

Query: 360 KPVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESL 419
           K  S+  + F + PQ L ++ VKD +I+ +  I  +I  AE  ++G  R++VR+SGTES 
Sbjct: 359 KKASSFFNTFNKTPQILENIDVKDKNIIKNIDIKNSIKLAEKLIKGQGRILVRSSGTESK 418

Query: 420 IRIMAEGDDLSRIKRIV 436
           IR+M E D++  +++ +
Sbjct: 419 IRVMGESDNIKLLQKCL 435


>gi|42523409|ref|NP_968789.1| phosphoglucosamine mutase [Bdellovibrio bacteriovorus HD100]
 gi|81617316|sp|Q6MLS4|GLMM_BDEBA RecName: Full=Phosphoglucosamine mutase
 gi|39575615|emb|CAE79782.1| phosphoglucosamine mutase [Bdellovibrio bacteriovorus HD100]
          Length = 457

 Score =  433 bits (1113), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 218/449 (48%), Positives = 307/449 (68%), Gaps = 7/449 (1%)

Query: 2   KRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKH-----RRVVIGKDTRLSGY 56
           K R FGTDGIRG +N +P+TP+ +++IG A+GYL R + +      R+VVIGKDTRLSGY
Sbjct: 4   KTRLFGTDGIRGTANQYPMTPDMVVKIGQAIGYLLRKEAEEKSSSVRKVVIGKDTRLSGY 63

Query: 57  MLENSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGP 116
           M+E +L +G  + G+   ++GP+P+P +  LTR++RA  G++ISASHNP+ DNGIK+FG 
Sbjct: 64  MIEQALASGLNSMGVFVQLVGPLPTPGIGYLTRTMRAAAGIVISASHNPFHDNGIKVFGS 123

Query: 117 DGYKVSTDIEDRIETL-LEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQ 175
           DG+K+S ++E  IE L LE+DLT  L     IG  +R++    RYI +VK T P + TL 
Sbjct: 124 DGFKISEEMEREIERLVLEEDLTPLLPPSKEIGRTRRIEDSQGRYIVYVKGTFPLEYTLD 183

Query: 176 GLRIVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVR 235
           G+RIV+D ANGASYKVAP +F ELGA+V+ +GD PNG NIN   G+     L   V   R
Sbjct: 184 GMRIVLDTANGASYKVAPSIFQELGAEVIQLGDDPNGTNINDKVGALYPQKLAESVLHYR 243

Query: 236 ADIGIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLER 295
           AD+GI+LDGD DRVI+VDEKG IVNGD+I+A+ A       LL+G+ +V T MSN GLE+
Sbjct: 244 ADVGISLDGDADRVIMVDEKGEIVNGDRILAICALHMKERGLLKGDTLVATQMSNFGLEK 303

Query: 296 FIAGLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYI 355
            +   G+ L +T VGD+Y++E M+ +G+N+GGEQSGHII  D+ +TGDG +AAL VL  +
Sbjct: 304 RMNEAGIKLVKTGVGDKYVVEEMRKHGYNLGGEQSGHIIFLDHTTTGDGCIAALSVLAVM 363

Query: 356 KQYDKPVSTICHCFEEYPQFLRSVSVKDTSILNS-SSIVQAIADAESELRGIDRLIVRAS 414
           KQ  K +S + H FE+ PQ L +  VK  + L+  +     I + E +L G  R+ VR S
Sbjct: 364 KQTGKKMSDLNHVFEDVPQILINCRVKRRAELSELAGYNDMIRNIEKKLAGNGRVFVRFS 423

Query: 415 GTESLIRIMAEGDDLSRIKRIVDDLAKVI 443
           GTE +IR++ EG + ++I +  +++A  +
Sbjct: 424 GTEPVIRVLVEGTEKAQITQFAEEIASFL 452


>gi|94501389|ref|ZP_01307909.1| phosphoglucosamine mutase [Oceanobacter sp. RED65]
 gi|94426502|gb|EAT11490.1| phosphoglucosamine mutase [Oceanobacter sp. RED65]
          Length = 443

 Score =  433 bits (1113), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 209/443 (47%), Positives = 318/443 (71%), Gaps = 5/443 (1%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M R++FGTDGIRG+    PITP F+M++G A G +F  + K R+++IGKDTR+SGYM E+
Sbjct: 1   MSRKYFGTDGIRGRVGESPITPEFVMKLGWAAGRVFASQGK-RKILIGKDTRISGYMFES 59

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +L AG +AAG+D  ILGP+P+P +A LTR+  AD G++ISASHNPY DNGIK F  DG K
Sbjct: 60  ALEAGLSAAGVDIGILGPMPTPGIAYLTRTFHADAGIVISASHNPYYDNGIKFFSADGSK 119

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +    E +IE LL+  +    S  D +G AKR++    RYIE  K T+   ++L+G+R+V
Sbjct: 120 LDDATEQQIEELLDQPMEVMNS--DRLGKAKRIEDAAGRYIEFCKSTV-FGLSLKGMRVV 176

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           +DCA+GA+Y++AP VF ELGADV VIG++P+G+NIN   GST+  SLQ+KV E+RAD+G+
Sbjct: 177 LDCAHGATYQIAPAVFTELGADVFVIGNEPDGLNINNQVGSTSPKSLQQKVVELRADLGV 236

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           A DGDGDRV++VD KG +V+GD+I+ +IAR+      L+G G+V T+MSN+G+E  +  +
Sbjct: 237 AFDGDGDRVVMVDHKGEVVDGDEIIYMIARQQYETDTLQG-GVVGTLMSNMGMELALKDM 295

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           G+   R +VGDRY+++ +  + +++GGE SGHI+  +  +TGDG+VAALQ L+ ++ + K
Sbjct: 296 GIPFVRAKVGDRYVLQQLAEHNWSLGGESSGHILCLNSTTTGDGIVAALQALKSLQSHGK 355

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
            +        ++PQ +++V V D SI++S+ +++A+  AE+E+ G  R+++R SGTE ++
Sbjct: 356 NLHEYKQGMSKFPQVMKNVKVVDKSIVDSAEVLKAVEQAETEMAGKGRVLLRPSGTEPVV 415

Query: 421 RIMAEGDDLSRIKRIVDDLAKVI 443
           R+M EG D + +  +VD L +++
Sbjct: 416 RVMVEGQDKTLVNLLVDRLVQIV 438


>gi|303327627|ref|ZP_07358068.1| phosphoglucosamine mutase [Desulfovibrio sp. 3_1_syn3]
 gi|302862567|gb|EFL85500.1| phosphoglucosamine mutase [Desulfovibrio sp. 3_1_syn3]
          Length = 450

 Score =  431 bits (1109), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 220/445 (49%), Positives = 295/445 (66%), Gaps = 2/445 (0%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M  R FGTDG+RG  N  P+T +  +R+G+A G  FR      +VVIGKDTRLSGYM E+
Sbjct: 1   MAERLFGTDGLRGTVNNAPMTVDVALRLGLAAGVRFRRGPHQHKVVIGKDTRLSGYMFES 60

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +L AG  AAGM   + GP+P+PA++ LTRS+RAD+GV+ISASHNP+ DNGIK F  DGYK
Sbjct: 61  ALTAGLCAAGMHVIMTGPLPTPAISFLTRSMRADLGVVISASHNPFSDNGIKFFDADGYK 120

Query: 121 VSTDIEDRI-ETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRI 179
           +    E+ I E +L  D+         +G A +++    RYI + K   P  +TL GLRI
Sbjct: 121 LPDQTENEIAEMVLNPDMAWPYPDPRQVGRATKIEDAGGRYIVYTKSCFPTQLTLSGLRI 180

Query: 180 VVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIG 239
           VVDCANGASYKVAP    ELGA+V  +   P+G NIN  CGS     +  KV EVRAD+G
Sbjct: 181 VVDCANGASYKVAPLALEELGAEVFRLSTAPDGTNINDHCGSLYPEVVAAKVREVRADVG 240

Query: 240 IALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAG 299
           +ALDGD DR+I+VDE G +++GDQ+MAL A+  M+   L GN +V TVMSN+ LE F+  
Sbjct: 241 LALDGDADRLIVVDEHGNVLDGDQLMALCAQSMMARGELPGNMLVATVMSNLALEIFMRE 300

Query: 300 LGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYD 359
            G +L RT+VGDRY++E M+  G  +GGEQSGH+I   Y +TGDGL+AALQ+LR +++ +
Sbjct: 301 HGGTLLRTKVGDRYVVEAMRREGAMLGGEQSGHLIFRGYSTTGDGLLAALQILRIMREKE 360

Query: 360 KPVSTICHCFEEYPQFLRSVSV-KDTSILNSSSIVQAIADAESELRGIDRLIVRASGTES 418
           KP+S +      +PQ L +V V K        +I +A+A  E EL G  R+++R SGTE+
Sbjct: 361 KPLSELAGLLTPFPQRLVNVRVEKRLPFEERPAIGEAVAKVEKELAGRGRVLLRYSGTEA 420

Query: 419 LIRIMAEGDDLSRIKRIVDDLAKVI 443
           L RIM EG+D  +++    DLA V+
Sbjct: 421 LCRIMVEGEDEDKVRAFAADLADVV 445


>gi|254455911|ref|ZP_05069340.1| phosphoglucosamine mutase [Candidatus Pelagibacter sp. HTCC7211]
 gi|207082913|gb|EDZ60339.1| phosphoglucosamine mutase [Candidatus Pelagibacter sp. HTCC7211]
          Length = 443

 Score =  430 bits (1106), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 210/444 (47%), Positives = 305/444 (68%), Gaps = 3/444 (0%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRV-VIGKDTRLSGYMLE 59
           M +++FGTDGIRG+ N+  I  +   + G+A G  FR +KK ++  +I KDTRLSGY LE
Sbjct: 1   MSKKYFGTDGIRGRVNSKNINGDMFFKFGLASGTYFRSQKKIKQTAIIAKDTRLSGYTLE 60

Query: 60  NSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGY 119
            +LV+G T+AGM  + LGP+P+  +AMLT+S+RA++G+MI+ASHNP+QDNG+KLFGPDG 
Sbjct: 61  PALVSGLTSAGMHVYTLGPLPTNGLAMLTKSMRANMGIMITASHNPHQDNGLKLFGPDGM 120

Query: 120 KVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRI 179
           K+S  IE +IE L++  ++ +LS    +G  KR++     Y++ +K+   +D  L+GLRI
Sbjct: 121 KLSDKIEKKIENLIDKKVSIHLSQPKKLGRVKRLETGTKDYLKILKKNFTKDFNLKGLRI 180

Query: 180 VVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIG 239
           V+DCANGA YK  PE+   LGA V+ IG KPNG+NIN  CGST    ++  V + +A +G
Sbjct: 181 VIDCANGAGYKAGPELLNSLGAKVITIGVKPNGLNINKRCGSTYPNKIKSAVIKNKAHLG 240

Query: 240 IALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAG 299
           I+LDGD DR+I+ DEKG I++GDQI+A +A  W S  +L+G G+V T+MSN GLE+F   
Sbjct: 241 ISLDGDADRIIMCDEKGNIIDGDQIIAALATRWKSKKMLKG-GVVGTLMSNYGLEKFFKS 299

Query: 300 LGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYD 359
             +   R  VGDRY+ E MK   FN+GGEQSGHIIL  + +TGDGL+ AL+ L  I++  
Sbjct: 300 EKIRFIRANVGDRYVKEKMKKKNFNLGGEQSGHIILGKFATTGDGLLVALEALFTIRK-G 358

Query: 360 KPVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESL 419
           K  S   + F++ PQ L ++ VK+ +I+N     ++I  AE  ++G  R++VR SGTES 
Sbjct: 359 KKASIYFNKFKKTPQILENIEVKNKNIINHPDTKKSIKIAEKLIKGQGRIVVRKSGTESK 418

Query: 420 IRIMAEGDDLSRIKRIVDDLAKVI 443
           IR+M E ++   +K+ VD +++ I
Sbjct: 419 IRVMGESENKELLKKCVDLISRKI 442


>gi|258405843|ref|YP_003198585.1| phosphoglucosamine mutase [Desulfohalobium retbaense DSM 5692]
 gi|257798070|gb|ACV69007.1| phosphoglucosamine mutase [Desulfohalobium retbaense DSM 5692]
          Length = 450

 Score =  429 bits (1104), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 211/445 (47%), Positives = 310/445 (69%), Gaps = 2/445 (0%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M +  FGTDG+RG+ N +P+ P  ++R+G+A G  FR   K  RVVIGKDTRLSGY+ E+
Sbjct: 1   MSQELFGTDGLRGQVNIYPMQPEIVLRLGLAAGQYFRNGAKRHRVVIGKDTRLSGYVFES 60

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +L +GF AAGMD F++GP+P+PA++ LT+++RAD+GV+ISASHNP+ DNGIK F  DGYK
Sbjct: 61  ALTSGFCAAGMDVFLVGPMPTPAISFLTKNMRADLGVVISASHNPFMDNGIKFFDSDGYK 120

Query: 121 VSTDIEDRIETLLEDDLTSY-LSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRI 179
           ++  +E  I +L+ D  T++ +   + IG A ++     RYI  +K + P  +TL G+++
Sbjct: 121 LADSVEKEISSLVLDPSTNWEIPDSEQIGRAYKIQDSPGRYIVALKNSFPPQMTLDGMKV 180

Query: 180 VVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIG 239
           V+DCANGASY+VAP V  ELGA VV +G++P+G+NIN  CGS       +KV E  ADIG
Sbjct: 181 VLDCANGASYRVAPLVLEELGAKVVKVGNEPDGLNINRQCGSLYPEVTAQKVVETGADIG 240

Query: 240 IALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAG 299
           +ALDGD DR+I+VDEKG I++GDQIMA+ AR++++   L GN +V TVMSN+ LE F+  
Sbjct: 241 LALDGDADRLIVVDEKGRILDGDQIMAVCARDFLNKGDLPGNTLVATVMSNMALEVFMQE 300

Query: 300 LGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYD 359
            G  L RT VGDR ++E M+++G  +GGEQSGH+I   + +TGDG++AALQ+LR +++ D
Sbjct: 301 CGGRLVRTPVGDRNVVEAMRHHGTILGGEQSGHLIFLRHSTTGDGVLAALQLLRIMREQD 360

Query: 360 KPVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQ-AIADAESELRGIDRLIVRASGTES 418
           +P+S +    + +PQ L +V V+     +    VQ  + +AE  L    R+++R SGTE+
Sbjct: 361 RPISELAGLLQPFPQELINVHVERKVPFDEVPAVQKGVTEAEKRLGDRGRVLLRYSGTEA 420

Query: 419 LIRIMAEGDDLSRIKRIVDDLAKVI 443
           + R+M EG+D   +  +  DLA+ +
Sbjct: 421 VARVMVEGEDGELVASLAGDLAETL 445


>gi|237809593|ref|YP_002894033.1| phosphoglucosamine mutase [Tolumonas auensis DSM 9187]
 gi|237501854|gb|ACQ94447.1| phosphoglucosamine mutase [Tolumonas auensis DSM 9187]
          Length = 445

 Score =  429 bits (1103), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 207/451 (45%), Positives = 309/451 (68%), Gaps = 9/451 (1%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M R++FGTDG+RG    FPITP+F +++G A G +       R V+IGKDTR+SGYMLE+
Sbjct: 1   MNRKYFGTDGVRGLVGQFPITPDFALKLGWAAGKVLAASGT-REVIIGKDTRISGYMLES 59

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           ++ +GF AAG++  + GP+P+PA+A L R+ RAD GV+ISASHNPY DNGIK F   G K
Sbjct: 60  AMASGFAAAGVNVALTGPLPTPAIAYLARTFRADAGVVISASHNPYHDNGIKFFSGAGVK 119

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDS--IGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLR 178
           ++    D +E  LE  LT  L C DS  +G A+R+     RY+E  K   P  ++L+GLR
Sbjct: 120 LN----DEVELALEAQLTQDLQCVDSAHLGKARRITDAIGRYVEFCKSQFPAHLSLEGLR 175

Query: 179 IVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADI 238
           +VVDCA+GA+Y++AP V  ELGA+V  IG +P+G+NIN  CG+T++++L  KV E+RAD+
Sbjct: 176 VVVDCAHGATYQIAPAVLRELGAEVFTIGVEPSGVNINEHCGATDLVALSAKVQELRADV 235

Query: 239 GIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIA 298
           G ALDGDGDR+++VD  G +V+GDQI+ ++AR W     LRG G+V T M+N+GLE+ + 
Sbjct: 236 GFALDGDGDRIMLVDHLGRVVDGDQILFILARHWHERGELRG-GVVGTQMANLGLEKALN 294

Query: 299 GLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQY 358
           GLG+   R++VGDRY++E +   G+ +GGE SGHI+   + +TGDG++A LQVLR + + 
Sbjct: 295 GLGIPFARSKVGDRYVVELLHELGWQLGGENSGHILSLSHTTTGDGIIAGLQVLRTMVER 354

Query: 359 DKPVSTICHCFEEYPQFLRSVSVK-DTSILNSSSIVQAIADAESELRGIDRLIVRASGTE 417
            + ++T C      PQ L ++  +     L S ++ QA+A AE+   G  R+++R SGTE
Sbjct: 355 GQNLATCCEGMTLMPQVLINIRYQGQHDPLTSDAVRQAMAQAEAVFAGQGRILLRKSGTE 414

Query: 418 SLIRIMAEGDDLSRIKRIVDDLAKVIPMIDS 448
            L+R+MAEG++ ++++ + + +A  I  + +
Sbjct: 415 PLLRVMAEGENETQVREMAEQIAASIRTVTA 445


>gi|197119012|ref|YP_002139439.1| phosphoglucosamine mutase [Geobacter bemidjiensis Bem]
 gi|226722752|sp|B5EHA7|GLMM_GEOBB RecName: Full=Phosphoglucosamine mutase
 gi|197088372|gb|ACH39643.1| phosphoglucosamine mutase [Geobacter bemidjiensis Bem]
          Length = 454

 Score =  429 bits (1102), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 211/443 (47%), Positives = 304/443 (68%), Gaps = 2/443 (0%)

Query: 3   RRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSL 62
           ++ FGTDG+RG +N +P+T    M+IG A  Y+F+  KK  R+VIGKDTRLSGYMLE++L
Sbjct: 2   KKLFGTDGVRGVANVYPMTAEMAMQIGRAAAYIFKNGKKRHRIVIGKDTRLSGYMLESAL 61

Query: 63  VAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVS 122
           +AG  + G+D  ++GP+P+P +A +T S+RAD GV+ISASHNP++DNGIK F  DG+K+ 
Sbjct: 62  MAGICSMGVDVLLVGPLPTPGIANITSSMRADAGVVISASHNPFEDNGIKFFSRDGFKLP 121

Query: 123 TDIEDRIETLL-EDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVV 181
            + E  +E L+    + S       +G A R+D    R++  +K T P+D+ L GL+IV+
Sbjct: 122 DETELMMEELIFSKRIDSLRPTAKEVGKAYRIDDAQGRFVVFLKSTFPKDLDLSGLKIVL 181

Query: 182 DCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIA 241
           DCANGA+YKVAP VF ELGA+V+ IG KPNG NIN DCGS +   + + V E  AD+G+A
Sbjct: 182 DCANGAAYKVAPAVFEELGAEVISIGVKPNGTNINADCGSLHPEVMSQAVKEHGADLGVA 241

Query: 242 LDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLG 301
           LDGD DRVI VDE G +V+GD+IMA+ A E +   +L+ N +V TVMSN+GL+  +   G
Sbjct: 242 LDGDADRVIFVDEYGNVVDGDRIMAICATEMIRQGILKQNTLVATVMSNMGLDIAMKRAG 301

Query: 302 LSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKP 361
             + +T VGDRY++E M   G+N+GGEQSGH+I  D+ +TGDG+++ALQVL  ++++ K 
Sbjct: 302 GQVIKTAVGDRYVVEEMLKGGYNLGGEQSGHMIFLDHNTTGDGVLSALQVLAIMQRHQKR 361

Query: 362 VSTICHCFEEYPQFLRSVSVKDTS-ILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
           +S +    E  PQ L +V + + S I+    I + I D E +L+G  R+++R SGTE L+
Sbjct: 362 LSELALVMEPLPQVLVNVRLAEKSDIMQVPEIAKLINDVEEKLKGEGRVLIRYSGTEPLL 421

Query: 421 RIMAEGDDLSRIKRIVDDLAKVI 443
           RIM EG D   I+   +D+A ++
Sbjct: 422 RIMLEGSDEGDIRCWANDIASIV 444


>gi|253700223|ref|YP_003021412.1| phosphoglucosamine mutase [Geobacter sp. M21]
 gi|259647722|sp|C6E5P5|GLMM_GEOSM RecName: Full=Phosphoglucosamine mutase
 gi|251775073|gb|ACT17654.1| phosphoglucosamine mutase [Geobacter sp. M21]
          Length = 454

 Score =  428 bits (1101), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 212/443 (47%), Positives = 302/443 (68%), Gaps = 2/443 (0%)

Query: 3   RRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSL 62
           ++ FGTDG+RG +N +P+T    M+IG A  Y+F+  KK  R+VIGKDTRLSGYMLE++L
Sbjct: 2   KKLFGTDGVRGVANVYPMTAEMAMQIGRAAAYIFKNGKKRHRIVIGKDTRLSGYMLESAL 61

Query: 63  VAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVS 122
           +AG  + G+D  ++GP+P+P +A +T S+RAD GV+ISASHNP++DNGIK F  DG+K+ 
Sbjct: 62  MAGICSMGVDVLLVGPLPTPGIANITSSMRADAGVVISASHNPFEDNGIKFFSRDGFKLP 121

Query: 123 TDIEDRIETLL-EDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVV 181
            + E  +E L+    + S       +G A R+D    R++  +K T P+D+ L GL+IV+
Sbjct: 122 DETELLMEELIFSKRIDSLRPTAKEVGKAYRIDDAQGRFVVFLKSTFPKDLDLSGLKIVL 181

Query: 182 DCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIA 241
           DCANGA+YKVAP VF ELGA+V+ IG KPNG NIN DCGS +   + R V E  AD+GIA
Sbjct: 182 DCANGAAYKVAPAVFEELGAEVISIGVKPNGTNINADCGSLHPEVMSRAVKENGADLGIA 241

Query: 242 LDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLG 301
           LDGD DRVI VDE G +V+GD+IMA+ A E +    L+ N +V TVMSN+GL+  +   G
Sbjct: 242 LDGDADRVIFVDEYGNVVDGDRIMAICATEMLRQGTLKQNTLVATVMSNMGLDIAMKRAG 301

Query: 302 LSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKP 361
             + +T VGDRY++E M   G+N+GGEQSGH+I  D+ +TGDG+++ALQVL  ++++ K 
Sbjct: 302 GQVVKTAVGDRYVVEEMLKGGYNLGGEQSGHMIFLDHNTTGDGVLSALQVLAIMQRHQKR 361

Query: 362 VSTICHCFEEYPQFLRSVSVKDTS-ILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
           +S +    +  PQ L +V + + S I+    I + I D E  L+G  R+++R SGTE L+
Sbjct: 362 LSELALVMDPLPQVLVNVRLAEKSDIMQVPEIAKMINDVEERLKGEGRVLIRYSGTEPLL 421

Query: 421 RIMAEGDDLSRIKRIVDDLAKVI 443
           RIM EG D   I+   +D+A ++
Sbjct: 422 RIMLEGSDEGDIRCWANDIASIV 444


>gi|78356562|ref|YP_388011.1| phosphoglucosamine mutase [Desulfovibrio desulfuricans subsp.
           desulfuricans str. G20]
 gi|123552628|sp|Q311T0|GLMM_DESDG RecName: Full=Phosphoglucosamine mutase
 gi|78218967|gb|ABB38316.1| phosphoglucosamine mutase [Desulfovibrio desulfuricans subsp.
           desulfuricans str. G20]
          Length = 450

 Score =  427 bits (1098), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 212/445 (47%), Positives = 301/445 (67%), Gaps = 2/445 (0%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M  R FGTDG+RG+ N +P+ P+  +R+G+A G  FR   K  RVVIGKDTRLSGY+ E 
Sbjct: 1   MTTRLFGTDGLRGQVNIYPMVPDMALRLGLAAGTFFRNGNKRHRVVIGKDTRLSGYVFEM 60

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +L +G  AAGMD F++GP+P+PAVA LTR++RAD+GV+ISASHNP+ DNGIK F  DG+K
Sbjct: 61  ALTSGLCAAGMDVFLVGPLPTPAVAFLTRNMRADLGVVISASHNPFHDNGIKFFDKDGFK 120

Query: 121 VSTDIEDRI-ETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRI 179
           +    ED I E +L  +        + +G A ++     RYI ++K + P  +TL G+++
Sbjct: 121 LPDSQEDAITEMVLNQNHRWDYPEPERVGRAHKIQDAPGRYIVYLKNSFPSTLTLDGMKV 180

Query: 180 VVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIG 239
           V+DCANGA+Y+VAP    ELGA+V+ IG  P+G+NIN  CGS       ++V E  ADIG
Sbjct: 181 VLDCANGANYRVAPLALEELGAEVIRIGTSPDGLNINHKCGSLYPELAAQRVRETGADIG 240

Query: 240 IALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAG 299
           +ALDGD DR+I+VDEKG +++GDQIMA+ A + M    L  N +V TVMSN+ LE F+  
Sbjct: 241 LALDGDADRLIVVDEKGTVLDGDQIMAICAMDMMEKGRLPENRLVATVMSNMALEVFMKE 300

Query: 300 LGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYD 359
            G SL RT VGDR+++E M+  G  +GGEQSGH++  +YG+TGDGL+AALQ+LR +++ +
Sbjct: 301 RGGSLLRTPVGDRHVVEAMRRTGAAMGGEQSGHLVFMEYGTTGDGLLAALQLLRIMREKN 360

Query: 360 KPVSTICHCFEEYPQFLRSVSV-KDTSILNSSSIVQAIADAESELRGIDRLIVRASGTES 418
           +P+S +      +PQ L +V V +         I +A+  AE EL G  R+++R SGTES
Sbjct: 361 RPLSELAGLLTPFPQQLINVHVQRKIPFEQCPEIGRAVEQAEKELAGRGRVLLRYSGTES 420

Query: 419 LIRIMAEGDDLSRIKRIVDDLAKVI 443
           + R+M EG+D + + R+   LA+ +
Sbjct: 421 VARVMVEGEDDALVGRLAAGLAETL 445


>gi|317484647|ref|ZP_07943550.1| phosphoglucosamine mutase [Bilophila wadsworthia 3_1_6]
 gi|316924121|gb|EFV45304.1| phosphoglucosamine mutase [Bilophila wadsworthia 3_1_6]
          Length = 450

 Score =  427 bits (1097), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 217/445 (48%), Positives = 306/445 (68%), Gaps = 2/445 (0%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M  R FGTDG+RG+ N +P+TP   +R+G+A G  +R K +  RVVIGKDTRLSGY+ EN
Sbjct: 1   MSVRLFGTDGMRGRVNKYPMTPEVALRLGLAAGTFYRDKNRRSRVVIGKDTRLSGYVFEN 60

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +L AG  AAGMD F++GP+P+PA++ LT ++RADVGV+ISASHNP+ DNGIK F  +G+K
Sbjct: 61  ALAAGLLAAGMDVFLVGPLPTPAISFLTTNMRADVGVVISASHNPFSDNGIKFFDAEGFK 120

Query: 121 VSTDIEDRI-ETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRI 179
           +    EDR+ E +L+ +         + G A ++     RYI ++K + P  ++L+GLR+
Sbjct: 121 IPDADEDRMTEMVLDPNFDWNYPEPANTGRAYKIKDAPGRYIVYLKNSFPAHLSLEGLRV 180

Query: 180 VVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIG 239
           V+DCANGA+Y+VAP    ELGA+VV IG +PNG+NIN  CGS    ++  KV E RADIG
Sbjct: 181 VIDCANGANYRVAPLALEELGAEVVKIGTEPNGLNINYRCGSLYPEAVAAKVRETRADIG 240

Query: 240 IALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAG 299
           +ALDGD DR+I+VDEKG +++GDQIMAL A++ M    L GN +V TVMSN+ LE F+  
Sbjct: 241 LALDGDADRLIVVDEKGTVLDGDQIMALCAQDLMQQGKLPGNILVATVMSNMALEVFMKE 300

Query: 300 LGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYD 359
            G +L RT VGDR+++  M+  G  +GGEQSGH+I  +Y +TGDGL+AALQ+LR ++Q  
Sbjct: 301 RGGTLIRTNVGDRHVVAAMRQQGALLGGEQSGHLIFREYSTTGDGLLAALQILRIMRQRK 360

Query: 360 KPVSTICHCFEEYPQFLRSVSVKDT-SILNSSSIVQAIADAESELRGIDRLIVRASGTES 418
           +P+S +      YPQ LR+V V+       ++ I  A+A  E  L G  R+++R SGTE 
Sbjct: 361 RPLSELAGLLVPYPQELRNVHVEHKIPFEENAEIADAVARIEEGLEGRGRVLLRYSGTEP 420

Query: 419 LIRIMAEGDDLSRIKRIVDDLAKVI 443
           L R+M EG D  +++   ++LA ++
Sbjct: 421 LCRVMVEGQDADKVRVYANELAGIV 445


>gi|77166025|ref|YP_344550.1| phosphoglucosamine mutase [Nitrosococcus oceani ATCC 19707]
 gi|254436368|ref|ZP_05049874.1| phosphoglucosamine mutase [Nitrosococcus oceani AFC27]
 gi|84029244|sp|Q3J826|GLMM_NITOC RecName: Full=Phosphoglucosamine mutase
 gi|76884339|gb|ABA59020.1| phosphoglucosamine mutase [Nitrosococcus oceani ATCC 19707]
 gi|207088058|gb|EDZ65331.1| phosphoglucosamine mutase [Nitrosococcus oceani AFC27]
          Length = 451

 Score =  426 bits (1095), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 217/444 (48%), Positives = 314/444 (70%), Gaps = 5/444 (1%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M++++FGTDGIRGK    PITP+F++ +G AVG +   + +  +V+IGKDTR+SGYM E+
Sbjct: 1   MEKKYFGTDGIRGKVGERPITPDFILHLGWAVGRVL-AQGRQSKVLIGKDTRISGYMFES 59

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +L AG +AAG+D  +LGP+P+PA+A LTR+L A  G++ISASHNPY DNGIK F   G K
Sbjct: 60  ALQAGLSAAGVDIRLLGPMPTPAIAYLTRTLHAKAGIVISASHNPYYDNGIKFFSSAGTK 119

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +  +IE  IE  LE  + +  S    +G A+RV     RYIE  K T P  V L  LR+V
Sbjct: 120 LPDEIEVAIEAELEKPMQTATS--SRLGKAERVVDAAGRYIEFCKSTGPASVDLSELRLV 177

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           +DCA+GA+Y+VAPEVF E+GAD+ VIG  PNG+NIN +CGST + SLQ KV E +AD+GI
Sbjct: 178 LDCAHGATYQVAPEVFAEMGADITVIGASPNGLNINENCGSTALESLQHKVLECKADVGI 237

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           ALDGDGDRVI++D++G IV+GD I+ +IAR     S L G  +V T+MSN+GLE+ +A L
Sbjct: 238 ALDGDGDRVIMIDQRGEIVDGDDILYIIARARQRTSKLTG-AVVGTLMSNLGLEKALATL 296

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           G+ L R++VGDRY++E ++ NG+++GGE SGHII  D  +TGDG+V+ALQVL  +     
Sbjct: 297 GIPLMRSQVGDRYVLEMLQCNGYSLGGESSGHIICLDRTTTGDGIVSALQVLVEMVATGH 356

Query: 361 PVSTICHCFEEYPQFLRSVSV-KDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESL 419
            +  +     +YPQ L +V V +  ++ ++++I+ A+ +AE++L    R+++R SGTE +
Sbjct: 357 SLYELKSGVVKYPQCLINVQVARSINLHDNNAIINAMQEAENQLGDEGRVLLRPSGTEPV 416

Query: 420 IRIMAEGDDLSRIKRIVDDLAKVI 443
           +R+M EG D+S++  +   LA+ +
Sbjct: 417 VRVMVEGRDISQVNSLAQQLAQEV 440


>gi|224417846|ref|ZP_03655852.1| putative phospho-sugar mutase [Helicobacter canadensis MIT 98-5491]
 gi|253827185|ref|ZP_04870070.1| phosphoglucosamine mutase [Helicobacter canadensis MIT 98-5491]
 gi|313141388|ref|ZP_07803581.1| phosphoglucosamine mutase [Helicobacter canadensis MIT 98-5491]
 gi|253510591|gb|EES89250.1| phosphoglucosamine mutase [Helicobacter canadensis MIT 98-5491]
 gi|313130419|gb|EFR48036.1| phosphoglucosamine mutase [Helicobacter canadensis MIT 98-5491]
          Length = 445

 Score =  425 bits (1092), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 206/437 (47%), Positives = 295/437 (67%), Gaps = 5/437 (1%)

Query: 4   RFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSLV 63
           + FGTDG+RG++    +     +++GIA G  +R   K  R+++GKDTR SGYMLEN+LV
Sbjct: 2   KLFGTDGVRGEAGV-KLNAFCALKLGIAAGIYYREHSKTNRILVGKDTRRSGYMLENALV 60

Query: 64  AGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVST 123
           +G TA G +   +GP+P+PA+A LT  +R D G+M+SASHNP+ DNGIK FG  GYK+  
Sbjct: 61  SGLTAVGYEVIQIGPMPTPAIAYLTEDMRCDGGIMVSASHNPFMDNGIKFFGKSGYKIDE 120

Query: 124 DIEDRIETLLEDD--LTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVV 181
             E+ IE +  ++  L S       IG +KR+D V  RYI H+K + P+D++L G+R+V+
Sbjct: 121 KDEEMIEKIYHNESLLESAQKSGKEIGSSKRIDDVVGRYIVHIKNSFPKDLSLHGIRVVL 180

Query: 182 DCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIA 241
           DCANGA+YKVAP +F ELGA+V VI D PNG NIN +CG+T  L LQ +V +VRADIG A
Sbjct: 181 DCANGAAYKVAPTIFSELGAEVFVINDSPNGFNINENCGATQPLMLQEEVRKVRADIGFA 240

Query: 242 LDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLG 301
           LDGD DR+++VDEKG +V+GD+++ ++A     ++ L+ N  V T+MSN  LE F+   G
Sbjct: 241 LDGDADRLVVVDEKGEVVHGDKLIGVLALAAKQNNTLKNNTAVATIMSNYALEEFLKENG 300

Query: 302 LSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKP 361
           + L R+ VGD+Y++E M  N  N GGEQSGHII SD+  TGDGLV+ALQ + YI Q  K 
Sbjct: 301 IKLIRSNVGDKYVLENMLANNLNFGGEQSGHIIFSDFAKTGDGLVSALQTMAYILQSKKT 360

Query: 362 VSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLIR 421
            S    CF+ YPQ L++++V+    L++    Q +   E E + I R ++R SGTE+ +R
Sbjct: 361 ASKALDCFKLYPQILKNINVQSKPNLDTLENYQTLL-KEIESKKI-RHLIRYSGTENKLR 418

Query: 422 IMAEGDDLSRIKRIVDD 438
           I+ EG D   +++++ +
Sbjct: 419 ILLEGKDTKTLEKVLQE 435


>gi|303248137|ref|ZP_07334402.1| phosphoglucosamine mutase [Desulfovibrio fructosovorans JJ]
 gi|302490536|gb|EFL50444.1| phosphoglucosamine mutase [Desulfovibrio fructosovorans JJ]
          Length = 450

 Score =  425 bits (1092), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 217/445 (48%), Positives = 305/445 (68%), Gaps = 2/445 (0%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M+++ FGTDG+RGK N +P+TP+ +MR+G+AVG + R   +  +V+IGKDTRLSGY+ E 
Sbjct: 1   MEKKLFGTDGLRGKVNVYPMTPDVVMRLGLAVGQVLRNGGRRHKVLIGKDTRLSGYIYEY 60

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +L +GF AAGMD  ++GP+P+PA++ LTR +RADVGV+ISASHNPY DNGIK F   G+K
Sbjct: 61  ALASGFCAAGMDVILVGPLPTPAISFLTRDMRADVGVVISASHNPYTDNGIKFFDHMGFK 120

Query: 121 VSTDIEDRIETLLEDDLTSY-LSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRI 179
           +   +EDRI  L+E    ++ L   + +G A ++     RY   +K T+P DV+   ++I
Sbjct: 121 LPDAVEDRIAGLVEGCGQNWQLPAPEEVGRASKIHDSIGRYNVFLKNTVPLDVSFDNMKI 180

Query: 180 VVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIG 239
           V+DCANGA+Y+VAPEVF ELGA+VV IG +P+G NIN   GS +   + R V    ADIG
Sbjct: 181 VLDCANGAAYRVAPEVFEELGAEVVKIGVEPDGTNINRGVGSLHPEGVARAVVAHGADIG 240

Query: 240 IALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAG 299
           IALDGD DRVI+ DEKG I++GDQIMA+ A ++M    L GN +V TVMSN+ LE F+  
Sbjct: 241 IALDGDADRVIVADEKGRILDGDQIMAICALDFMERGKLPGNLLVATVMSNMALELFMKS 300

Query: 300 LGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYD 359
              +L RT VGDRY++E M+  G  +GGEQSGH+I  ++ +TGDG +AALQ++R + Q  
Sbjct: 301 HNGTLLRTPVGDRYVVEAMRGKGAVLGGEQSGHLIFLNHSTTGDGTLAALQLMRIMVQRG 360

Query: 360 KPVSTICHCFEEYPQFLRSVSV-KDTSILNSSSIVQAIADAESELRGIDRLIVRASGTES 418
           KP+S +      +PQ L +V V +        +I +A A+AE EL G  R+++R SGTES
Sbjct: 361 KPLSELATLVSPFPQELVNVPVARKIPFSEVPAIERATAEAERELAGRGRVLLRYSGTES 420

Query: 419 LIRIMAEGDDLSRIKRIVDDLAKVI 443
           L R+M E +D   + R+   LA+++
Sbjct: 421 LARVMVEAEDPGLVTRLSQGLAEIV 445


>gi|298527834|ref|ZP_07015238.1| phosphoglucosamine mutase [Desulfonatronospira thiodismutans
           ASO3-1]
 gi|298511486|gb|EFI35388.1| phosphoglucosamine mutase [Desulfonatronospira thiodismutans
           ASO3-1]
          Length = 451

 Score =  424 bits (1090), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 205/445 (46%), Positives = 309/445 (69%), Gaps = 2/445 (0%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M+++ FGTDG+RG++N FP+ P  ++R+G+A G  FR   +  RV+IGKDTRLSGY+ EN
Sbjct: 1   MRKKLFGTDGLRGQANIFPMLPEIVLRLGLAAGQYFRNGHRRHRVLIGKDTRLSGYVFEN 60

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +L +GF A+GMD F++GP+P+PA++ LT+++RAD+GV+ISASHNP+ DNGIK F   G+K
Sbjct: 61  ALTSGFCASGMDVFLVGPMPTPAISFLTKNMRADLGVVISASHNPFMDNGIKFFDHKGFK 120

Query: 121 VSTDIEDRI-ETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRI 179
           +S  +E+ I E +L  D+       ++IG A+++     RYI H+K +LP  ++LQG+++
Sbjct: 121 LSDQVEEDISELVLSPDVNWKHPQPEAIGRARKIVDSPGRYIVHLKNSLPNTMSLQGMKV 180

Query: 180 VVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIG 239
           V+DCA+GA+Y+VAP +F ELGA V++ G +P+G+NIN  CGS         V E  AD+G
Sbjct: 181 VIDCAHGATYRVAPLIFEELGAKVIMAGTEPDGVNINKKCGSLYPEVAASMVLEHGADLG 240

Query: 240 IALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAG 299
           + LDGDGDR+I +DE G I++GDQIMA+ A + M    L GN +V+TVMSN+ LE F+  
Sbjct: 241 LTLDGDGDRLIAIDENGVILDGDQIMAICAMDLMERDALPGNLLVSTVMSNMALEVFMQE 300

Query: 300 LGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYD 359
            G  L RT+VGDRY++E M+  G  +GGEQSGH+I  DY +TGDG++A +++L+ + Q +
Sbjct: 301 HGGRLLRTKVGDRYVVEAMRKEGAVLGGEQSGHLIFLDYATTGDGILAGIKLLKIMLQKN 360

Query: 360 KPVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQ-AIADAESELRGIDRLIVRASGTES 418
           +P+S +      +PQ L +V V+          VQ A+ DAE++L    R+++R SGTES
Sbjct: 361 RPLSELSRLLTPFPQRLINVHVERKMPFEEVQQVQEAVKDAEAQLGSKGRVLLRYSGTES 420

Query: 419 LIRIMAEGDDLSRIKRIVDDLAKVI 443
           + R+M EG D + ++ +   LA+ +
Sbjct: 421 VARVMVEGQDDTLVEDMAIKLARAV 445


>gi|300113262|ref|YP_003759837.1| phosphoglucosamine mutase [Nitrosococcus watsonii C-113]
 gi|299539199|gb|ADJ27516.1| phosphoglucosamine mutase [Nitrosococcus watsonii C-113]
          Length = 451

 Score =  424 bits (1090), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 220/443 (49%), Positives = 311/443 (70%), Gaps = 7/443 (1%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVG-YLFRGKKKHRRVVIGKDTRLSGYMLE 59
           M++++FGTDGIRG+   +PITP+F++ +G AVG  L RG++   +V+IGKDTR+SGYM E
Sbjct: 1   MEKKYFGTDGIRGQVGEYPITPDFILHLGWAVGRVLARGRQS--KVLIGKDTRISGYMFE 58

Query: 60  NSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGY 119
           ++L AG +AAG+D  +LGP+P+PA+A LTR+L A  G++ISASHNPY DNGIK F   G 
Sbjct: 59  SALQAGLSAAGVDIRLLGPMPTPAIAYLTRTLHAKAGIVISASHNPYYDNGIKFFSSAGT 118

Query: 120 KVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRI 179
           K+  +IE  IE  LE  + + +S    +G A+RV     RYIE  K T P  V L GLR+
Sbjct: 119 KLPDEIEVAIEAELEKPMQTTVS--SCLGKAERVVDAAGRYIEFCKSTGPASVDLSGLRL 176

Query: 180 VVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIG 239
           VVDCA+GA+Y+VAPEVF E+GAD+ VIG  P+G+NIN +CGST + SLQ KV E  AD G
Sbjct: 177 VVDCAHGATYQVAPEVFAEMGADITVIGVSPDGLNINENCGSTALESLQHKVLECNADAG 236

Query: 240 IALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAG 299
           IALDGDGDRVI++D +G IV+GD I+ +IAR     S L G  +V T+MSN+GLE+ +A 
Sbjct: 237 IALDGDGDRVIMIDHRGEIVDGDDILYIIARARQRTSKLMG-AVVGTLMSNLGLEKALAA 295

Query: 300 LGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYD 359
           LG+ L R++VGDRY++E ++ NG+++GGE SGHII  D  +TGDG+V+ALQVL  +    
Sbjct: 296 LGIPLMRSQVGDRYVLEMLQCNGYSLGGESSGHIICLDRTTTGDGIVSALQVLVEMVAMG 355

Query: 360 KPVSTICHCFEEYPQFLRSVSV-KDTSILNSSSIVQAIADAESELRGIDRLIVRASGTES 418
             +  +     +YPQ L +V V +  +  N+++I+ A+   E++L    R+++R SGTE 
Sbjct: 356 HSLYELKSGVVKYPQCLINVQVARAINFSNNNAIISAVQAIENQLGDEGRVLLRPSGTEP 415

Query: 419 LIRIMAEGDDLSRIKRIVDDLAK 441
           ++R+M EG D S++  +   LA+
Sbjct: 416 VVRVMVEGRDTSQVNTLAQQLAQ 438


>gi|291287212|ref|YP_003504028.1| phosphoglucosamine mutase [Denitrovibrio acetiphilus DSM 12809]
 gi|290884372|gb|ADD68072.1| phosphoglucosamine mutase [Denitrovibrio acetiphilus DSM 12809]
          Length = 454

 Score =  424 bits (1090), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 219/445 (49%), Positives = 300/445 (67%), Gaps = 10/445 (2%)

Query: 3   RRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLF-RGKKKHRRVVIGKDTRLSGYMLENS 61
           R++FGTDG+RGK+N FP+T  F +R+G AV   F  G KK  +VVIGKDTR+SGYM E++
Sbjct: 2   RKYFGTDGVRGKANEFPMTATFALRLGQAVAKQFSNGGKKIHKVVIGKDTRVSGYMFESA 61

Query: 62  LVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKV 121
           LV+G T+ G+DA ++G +P+PA++ +TRSLRAD GV+ISASHNPY DNGIK F  DGYK+
Sbjct: 62  LVSGITSMGLDAVLVGVLPTPAISFITRSLRADAGVVISASHNPYYDNGIKFFSGDGYKL 121

Query: 122 STDIEDRIETLLEDDLTS--YLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRI 179
             + E  IE   ++ + +       D IG A RVD    RY+E  K T  +D+ L G+R+
Sbjct: 122 PDETEISIEQTTDEMIQNGEIPISTDRIGKAYRVDTAIGRYVEFSKSTFDKDIDLSGMRL 181

Query: 180 VVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIG 239
           VVDC+NGA+YKVAP  F EL A + V+G++P+G+NIN  CGS    ++  KV E  AD+G
Sbjct: 182 VVDCSNGANYKVAPMAFEELAAKINVMGNEPDGMNINSGCGSVYPEAMCAKVKEKGADLG 241

Query: 240 IALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAG 299
           I+ DGDGDRVI  DE G +V+GD IM + A+   S   L  N +V TVMSN G E+ +  
Sbjct: 242 ISFDGDGDRVIFSDENGEMVDGDIIMGICAKYMNSLGYLNKNTMVCTVMSNFGFEKSMLE 301

Query: 300 LGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYD 359
            G+ L RT+VGDRY+M  M  NG+N+GGEQSGHII SDY +TGDGLV+A+Q+L+ I +  
Sbjct: 302 AGVKLVRTDVGDRYVMAEMLKNGYNLGGEQSGHIIFSDYNTTGDGLVSAMQLLKVIVRSG 361

Query: 360 KPVSTICHCFEEYPQFLRSVSVKDT----SILNSSSIVQAIADAESELRGIDRLIVRASG 415
           KP+S +      YPQ L++  V+       +  +S  +QA+     EL G  R++VR SG
Sbjct: 362 KPLSELKKFITLYPQVLKNFKVQKKIPVDYLERTSKEIQAV---NKELDGTGRVLVRYSG 418

Query: 416 TESLIRIMAEGDDLSRIKRIVDDLA 440
           TE+ +R+M EG+DLSRI    +++ 
Sbjct: 419 TENKLRVMLEGEDLSRITEYAENIG 443


>gi|149925150|ref|ZP_01913454.1| phosphoglucosamine mutase [Plesiocystis pacifica SIR-1]
 gi|149813982|gb|EDM73623.1| phosphoglucosamine mutase [Plesiocystis pacifica SIR-1]
          Length = 453

 Score =  423 bits (1088), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 217/440 (49%), Positives = 291/440 (66%), Gaps = 5/440 (1%)

Query: 2   KRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENS 61
           +R+ FGTDGIRG++N  P+TP   MR G+AV   F    +  +VV+GKDTR SGYM E +
Sbjct: 4   QRKLFGTDGIRGRANVHPMTPEVAMRFGMAVAAHF---GREGKVVVGKDTRRSGYMFEMA 60

Query: 62  LVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKV 121
           L +G  A G+D  + GP+P+P VA L  S+RAD GV+ISASHNP++DNG KLF  DG+K+
Sbjct: 61  LASGLCALGVDVMLTGPLPTPGVAHLASSMRADAGVVISASHNPFEDNGFKLFANDGFKL 120

Query: 122 STDIEDRIETLLE-DDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
              +E  IE L+E   +   L+  +SIG A R++    RYI HVK  LP++  L GLRIV
Sbjct: 121 PDTVESHIEALMERGAVDDRLAHGESIGKAWRLEDAGGRYITHVKHALPQEYELDGLRIV 180

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           VDCANGA+YK+AP VF ELGADVV  G +P+G NIN   G+ +   L   V E RADIG+
Sbjct: 181 VDCANGAAYKIAPAVFEELGADVVRTGVRPDGTNINAGVGAMHPEHLSHMVREYRADIGV 240

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           ALDGD DR ++ D KG IV+GD ++A+I R+    S LRGN +V TVMSNIGLER +A +
Sbjct: 241 ALDGDADRAVVCDAKGKIVDGDVLLAIIGRDLAERSALRGNAVVATVMSNIGLERSLAEV 300

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           G+ L RT VGDRY++E M++ G N+GGEQSGHII  D+ +TGDGLV+AL +L  + + ++
Sbjct: 301 GVGLHRTPVGDRYVVEAMRSRGCNLGGEQSGHIISLDHSTTGDGLVSALSLLAVMVRAER 360

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTSILNS-SSIVQAIADAESELRGIDRLIVRASGTESL 419
           P++ +      YPQ  RS  V     L   + + + IA  E  L    R++VR SGTES 
Sbjct: 361 PLAELAAVMTRYPQVSRSYLVPRKVPLGELTRLAKVIAGVEERLADEGRVVVRYSGTESK 420

Query: 420 IRIMAEGDDLSRIKRIVDDL 439
           +R+M EG D   I    +++
Sbjct: 421 LRVMVEGGDERSITEQAEEI 440


>gi|253999577|ref|YP_003051640.1| phosphoglucosamine mutase [Methylovorus sp. SIP3-4]
 gi|253986256|gb|ACT51113.1| phosphoglucosamine mutase [Methylovorus sp. SIP3-4]
          Length = 452

 Score =  423 bits (1088), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 215/450 (47%), Positives = 304/450 (67%), Gaps = 10/450 (2%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRG------KKKHRRVVIGKDTRLS 54
           M R++FGTDGIRG+    PITP+F+MR+G A G +  G      K  H  V+IGKDTR+S
Sbjct: 1   MTRKYFGTDGIRGRVGDAPITPDFVMRLGYAAGRVLTGLDSHLAKDAHPTVLIGKDTRIS 60

Query: 55  GYMLENSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLF 114
           GYMLE++L AG +AAG+D  + GP+P+PAVA LTR+LRA  G++ISASHNP++DNGIK F
Sbjct: 61  GYMLESALQAGLSAAGVDVLLTGPMPTPAVAYLTRALRAQAGIVISASHNPFEDNGIKFF 120

Query: 115 GPDGYKVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTL 174
             +G K+  ++E  IE  L+  L    S    +G AKR+     RYIE  K T P  + L
Sbjct: 121 SAEGTKLPDEVELAIEAALDQPLQVMPSA--GLGKAKRITDAAGRYIEFCKSTFPAALDL 178

Query: 175 QGLRIVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEV 234
           +GLRIV+DCANGA+Y VAP VF ELGA++V IG +P+G+NINLDCGST+  +L R V E 
Sbjct: 179 RGLRIVLDCANGATYHVAPPVFHELGAEIVTIGYQPDGLNINLDCGSTHPQALCRAVIEH 238

Query: 235 RADIGIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLE 294
           +AD+GIA DGDGDRV++VD +G +++GDQ++ +IA +      L G G+V T+M+N+ LE
Sbjct: 239 KADLGIAFDGDGDRVVMVDSQGRLLDGDQLLYIIAMQRKQRGRLEG-GVVGTLMTNLALE 297

Query: 295 RFIAGLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRY 354
             +A   +   R +VGDRY++E +    + +GGE SGHI+  D  S+GDG++AALQVL  
Sbjct: 298 HALAKADIPFLRAKVGDRYVLELLNEQDWQLGGENSGHILCLDKHSSGDGIIAALQVLHA 357

Query: 355 IKQYDKPVSTICHCFEEYPQFLRSVSVK-DTSILNSSSIVQAIADAESELRGIDRLIVRA 413
           ++     + T+      YPQ L +V V     +    +I QA+ADAE +L+G  R+++R 
Sbjct: 358 MRTAGCSLDTLGAGLTLYPQVLINVKVAGKVDLAAQPAIQQAVADAEQKLQGRGRVLLRP 417

Query: 414 SGTESLIRIMAEGDDLSRIKRIVDDLAKVI 443
           SGTE  IR+M EG+D + ++R+ + +A V+
Sbjct: 418 SGTEPKIRVMVEGEDGALVQRLAEQIATVV 447


>gi|237753218|ref|ZP_04583698.1| phosphoglucosamine mutase [Helicobacter winghamensis ATCC BAA-430]
 gi|229375485|gb|EEO25576.1| phosphoglucosamine mutase [Helicobacter winghamensis ATCC BAA-430]
          Length = 445

 Score =  423 bits (1088), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 204/439 (46%), Positives = 298/439 (67%), Gaps = 13/439 (2%)

Query: 4   RFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSLV 63
           + FGTDG+RG++    +     +++GIA G  +R   K  R+++GKDTR SGYMLEN+LV
Sbjct: 2   KLFGTDGVRGEAGV-KLDAFCALKLGIAAGIYYREHAKTNRILVGKDTRRSGYMLENALV 60

Query: 64  AGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVST 123
           +G TA G +   +GP+P+PA+A LT  +R D G+M+SASHNP+ DNGIK FG  GYK+  
Sbjct: 61  SGLTAVGYEVIQIGPMPTPAIAYLTEDMRCDGGIMVSASHNPFMDNGIKFFGRSGYKIDE 120

Query: 124 DIEDRIETLLED--DLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVV 181
             E  IE + +D   L +       IG +KR+D V  RYI H+K + P+D++L G+R+V+
Sbjct: 121 KDEGEIERIYKDLNMLETAQKRGKEIGSSKRIDDVVGRYIVHIKNSFPKDLSLYGIRVVL 180

Query: 182 DCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIA 241
           DCANGA+YKVAP +F ELGA+V VI D+PNG NIN +CG+T  L LQ +V  VRADIG A
Sbjct: 181 DCANGAAYKVAPTIFSELGAEVFVINDEPNGFNINENCGATQPLMLQEEVRRVRADIGFA 240

Query: 242 LDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLG 301
           LDGD DR+++VDEKG +++GD+++ ++A       +L+ N +V T+MSN  LE F+   G
Sbjct: 241 LDGDADRLVVVDEKGEVIHGDKLIGVLALAAKESKMLKNNAVVATIMSNYALEEFLKSHG 300

Query: 302 LSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKP 361
           ++L R+ VGD+Y++E M +   N GGEQSGHII SD+  TGDGLV+ALQ + YI +  KP
Sbjct: 301 IALVRSNVGDKYVLEAMLDKNLNFGGEQSGHIIFSDFAKTGDGLVSALQTMAYILKSKKP 360

Query: 362 VSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGID----RLIVRASGTE 417
            S   +CF  YPQ L+++SV      NS   ++++ + ++ L+ I+    R ++R SGTE
Sbjct: 361 ASKALNCFNLYPQILKNLSV------NSKPSLESLENYQNFLKSIEAHNIRHLIRYSGTE 414

Query: 418 SLIRIMAEGDDLSRIKRIV 436
           + +RI+ EG D+  + +++
Sbjct: 415 NKLRILLEGKDVKLLDKVM 433


>gi|117619850|ref|YP_857799.1| phosphoglucosamine mutase [Aeromonas hydrophila subsp. hydrophila
           ATCC 7966]
 gi|158705793|sp|A0KNE8|GLMM_AERHH RecName: Full=Phosphoglucosamine mutase
 gi|117561257|gb|ABK38205.1| phosphoglucosamine mutase [Aeromonas hydrophila subsp. hydrophila
           ATCC 7966]
          Length = 444

 Score =  423 bits (1087), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 210/446 (47%), Positives = 307/446 (68%), Gaps = 9/446 (2%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M R++FGTDG+RGK   +PITP+F+M++G A G +   KK  R+V+IGKDTR+SGYMLE+
Sbjct: 1   MARKYFGTDGVRGKVGEYPITPDFVMKLGWAAGKVLS-KKGTRKVLIGKDTRISGYMLES 59

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +L AG +AAG+ A ++GP+P+PAVA LTR+ RA+ G++ISASHNPY DNGIK F  DG  
Sbjct: 60  ALEAGLSAAGLKAILMGPMPTPAVAYLTRTFRAEAGIVISASHNPYYDNGIKFFSADG-- 117

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDS--IGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLR 178
             T + D +E  +E +L   L C +S  +G A R+D    RYIE  K T P +++L+GL+
Sbjct: 118 --TKLPDEVEMAIEAELDHELKCVESAELGKALRIDDAAGRYIEFCKSTFPSNLSLEGLK 175

Query: 179 IVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADI 238
           +VVDC +GA+Y +AP VF ELGA+V+ IG  P+G+NIN   GST   +L  KV E +AD+
Sbjct: 176 MVVDCGHGATYHIAPSVFRELGAEVIAIGCSPDGLNINDGVGSTAPEALAAKVLECKADL 235

Query: 239 GIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIA 298
           G+A DGDGDR+++VD  G I++GD+I+ +IAR+ + +  L+G G+V T+M+N+GLE  + 
Sbjct: 236 GVAFDGDGDRLVMVDNTGYIIDGDEILYIIARDALRNGRLKG-GVVGTLMANMGLELALQ 294

Query: 299 GLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQY 358
            LG+   R +VGDRY++E M   G+ +GGE SGHII  D  +TGDG+VAALQVL  I   
Sbjct: 295 TLGIPFARAKVGDRYVLEMMNEKGWRIGGENSGHIICLDQTTTGDGIVAALQVLTAICTA 354

Query: 359 DKPVSTICHCFEEYPQFLRSVSVKD-TSILNSSSIVQAIADAESELRGIDRLIVRASGTE 417
           + P++ +     ++PQ L +V   +    L + ++ Q +A  E EL G  R+++R SGTE
Sbjct: 355 EMPLAKLRSGMNKFPQVLVNVRFAEGRDPLAADAVQQEVAKVEQELAGRGRVLLRKSGTE 414

Query: 418 SLIRIMAEGDDLSRIKRIVDDLAKVI 443
            LIR+M EG+   +++ +   +A+ +
Sbjct: 415 PLIRVMVEGEHEQQVRDMAQRIAQQV 440


>gi|313201612|ref|YP_004040270.1| phosphoglucosamine mutase [Methylovorus sp. MP688]
 gi|312440928|gb|ADQ85034.1| phosphoglucosamine mutase [Methylovorus sp. MP688]
          Length = 452

 Score =  423 bits (1087), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 215/450 (47%), Positives = 304/450 (67%), Gaps = 10/450 (2%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRG------KKKHRRVVIGKDTRLS 54
           M R++FGTDGIRG+    PITP+F+MR+G A G +  G      K  H  V+IGKDTR+S
Sbjct: 1   MTRKYFGTDGIRGRVGDAPITPDFVMRLGYAAGRVLTGLDSHLAKDAHPTVLIGKDTRIS 60

Query: 55  GYMLENSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLF 114
           GYMLE++L AG +AAG+D  + GP+P+PAVA LTR+LRA  G++ISASHNP++DNGIK F
Sbjct: 61  GYMLESALQAGLSAAGVDVLLTGPMPTPAVAYLTRALRAQAGIVISASHNPFEDNGIKFF 120

Query: 115 GPDGYKVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTL 174
             +G K+  ++E  IE  L+  L    S    +G AKR+     RYIE  K T P  + L
Sbjct: 121 SAEGTKLPDEVELAIEAALDQPLQVMPSA--GLGKAKRITDAAGRYIEFCKSTFPAALDL 178

Query: 175 QGLRIVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEV 234
           +GLRIV+DCANGA+Y VAP VF ELGA++V IG +P+G+NINLDCGST+  +L R V E 
Sbjct: 179 RGLRIVLDCANGATYHVAPPVFHELGAEIVTIGYQPDGLNINLDCGSTHPQALCRAVIEH 238

Query: 235 RADIGIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLE 294
           +AD+GIA DGDGDRV++VD +G +++GDQ++ +IA +      L G G+V T+M+N+ LE
Sbjct: 239 KADLGIAFDGDGDRVVMVDSQGRLLDGDQLLYIIAMQRKQRGRLDG-GVVGTLMTNLALE 297

Query: 295 RFIAGLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRY 354
             +A   +   R +VGDRY++E +    + +GGE SGHI+  D  S+GDG++AALQVL  
Sbjct: 298 HALAKADIPFLRAKVGDRYVLELLNEQDWQLGGENSGHILCLDKHSSGDGIIAALQVLHA 357

Query: 355 IKQYDKPVSTICHCFEEYPQFLRSVSVK-DTSILNSSSIVQAIADAESELRGIDRLIVRA 413
           ++     + T+      YPQ L +V V     +    +I QA+ADAE +L+G  R+++R 
Sbjct: 358 MRTAGCSLDTLGAGLTLYPQVLINVKVAGKVDLAAQPAIQQAVADAEQQLQGRGRVLLRP 417

Query: 414 SGTESLIRIMAEGDDLSRIKRIVDDLAKVI 443
           SGTE  IR+M EG+D + ++R+ + +A V+
Sbjct: 418 SGTEPKIRVMVEGEDGALVQRLAEQIATVV 447


>gi|256823579|ref|YP_003147542.1| phosphoglucosamine mutase [Kangiella koreensis DSM 16069]
 gi|256797118|gb|ACV27774.1| phosphoglucosamine mutase [Kangiella koreensis DSM 16069]
          Length = 443

 Score =  423 bits (1087), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 208/443 (46%), Positives = 309/443 (69%), Gaps = 7/443 (1%)

Query: 2   KRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENS 61
           +R++FGTDGIRG    FPITP F++++G A G +  GKK   ++VIGKDTR+SGYM E+ 
Sbjct: 3   ERKYFGTDGIRGTVGDFPITPEFVLKLGWAAGKVL-GKKG--KIVIGKDTRISGYMFESV 59

Query: 62  LVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKV 121
           L AG TAAG+ +F++GP+P+PA+A LTR+ RAD G++ISASHNP+QDNGIK F   G K+
Sbjct: 60  LEAGLTAAGVSSFLVGPMPTPAIAYLTRTFRADAGIVISASHNPFQDNGIKFFSAAGTKL 119

Query: 122 STDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVV 181
              +E  IE LLE ++TS  S  + +G A R++    RYIE  K ++P D  L G++IV+
Sbjct: 120 PDSVELEIEALLEQEMTSLPS--EKLGKAYRIEDAAARYIEFCKASVPNDFNLDGMKIVL 177

Query: 182 DCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIA 241
           DCANGA+Y +AP VF ELGA V+  G +PNG+NIN +CG+T++  L + V E +AD+GIA
Sbjct: 178 DCANGATYHIAPYVFKELGAKVIKTGVEPNGLNINHECGATHLEPLCKAVVEHQADLGIA 237

Query: 242 LDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLG 301
            DGDGDR+++VD  G ++NGDQ+M L+A        L+G G+V T+M+N+ +E  +  L 
Sbjct: 238 FDGDGDRLMMVDANGTVINGDQLMFLMAYHLQQKGQLKG-GVVGTLMTNMAIENALIELD 296

Query: 302 LSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKP 361
           +  +R++VGDRY+ME ++ N + +GGE SGH+I  DY STGDG+VAALQVLR +++ +K 
Sbjct: 297 IPFERSKVGDRYVMESLQKNDWLIGGESSGHLIHLDYNSTGDGIVAALQVLRVVREQEKG 356

Query: 362 VSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIA-DAESELRGIDRLIVRASGTESLI 420
           +  +   F  +PQ + ++ V D   + +   +Q +A + ++EL    R+++RASGTE LI
Sbjct: 357 IGELVAKFPLFPQTMINIRVTDAKAVIADENLQRLAQEVDAELADQGRVLLRASGTEPLI 416

Query: 421 RIMAEGDDLSRIKRIVDDLAKVI 443
           R+M E +D +   ++ + LA+ +
Sbjct: 417 RVMVEANDANLATKMAEKLAQKV 439


>gi|317152971|ref|YP_004121019.1| phosphoglucosamine mutase [Desulfovibrio aespoeensis Aspo-2]
 gi|316943222|gb|ADU62273.1| phosphoglucosamine mutase [Desulfovibrio aespoeensis Aspo-2]
          Length = 450

 Score =  422 bits (1086), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 215/443 (48%), Positives = 299/443 (67%), Gaps = 2/443 (0%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           MK+R FGTDG+RG+ N FP+TP   +++G+A G  FR      RVVIGKDTRLSGY+ E 
Sbjct: 1   MKQRLFGTDGLRGQGNIFPMTPEIALKLGLAAGQYFRNGSGRNRVVIGKDTRLSGYVFET 60

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +L +G  A GMD F++GP+P+PA++ LTR++RAD+GV+ISASHNP+ DNGIK F  +G+K
Sbjct: 61  ALTSGLCANGMDVFLVGPLPTPAISFLTRNMRADLGVVISASHNPFMDNGIKFFDREGFK 120

Query: 121 VSTDIEDRIETLLEDDLTSY-LSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRI 179
           +  ++ED I  L+  +   +     + IG A R+     RYI ++K +    +TL GL++
Sbjct: 121 LPDEVEDEISELVMAEHPRWEYPAPEDIGKAHRIVDAQGRYIVYLKNSFSPRLTLDGLKV 180

Query: 180 VVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIG 239
           V+DCA+GA+Y VAP V  ELGA V+ IG  P+G+NIN  CGS     +   V +  ADIG
Sbjct: 181 VLDCAHGAAYGVAPMVLEELGATVIKIGVSPDGLNINHKCGSLYPEVVSNIVVDEGADIG 240

Query: 240 IALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAG 299
           IALDGD DR+I+ DEKG I++GDQIMAL A E M    L  N +V+TVMSN+ LE F+  
Sbjct: 241 IALDGDADRLIVCDEKGRILDGDQIMALSALEMMEKGRLPKNMLVSTVMSNMALELFMRQ 300

Query: 300 LGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYD 359
            G +L RT VGDRY++E M+  G  +GGEQSGH+I  D+ +TGDGL+AALQ+LR + + D
Sbjct: 301 HGGTLLRTAVGDRYVVEAMRREGARLGGEQSGHLIFMDHSTTGDGLLAALQLLRIMVEKD 360

Query: 360 KPVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQA-IADAESELRGIDRLIVRASGTES 418
           KP+S +    E +PQ LR+V V+       +  +QA +A  E  L G  R+++R SGTE+
Sbjct: 361 KPLSELAGLLEPFPQMLRNVHVERKIPFAQAPGLQAEVARVEQALHGKGRVLLRYSGTEA 420

Query: 419 LIRIMAEGDDLSRIKRIVDDLAK 441
           + R+M EG DL  ++R V +L +
Sbjct: 421 VCRVMVEGPDLDTVQRHVMELVE 443


>gi|320353175|ref|YP_004194514.1| phosphoglucosamine mutase [Desulfobulbus propionicus DSM 2032]
 gi|320121677|gb|ADW17223.1| phosphoglucosamine mutase [Desulfobulbus propionicus DSM 2032]
          Length = 450

 Score =  422 bits (1086), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 212/448 (47%), Positives = 300/448 (66%), Gaps = 4/448 (0%)

Query: 3   RRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSL 62
           ++ FGTDG+RG +N +P+T    M+IG A+ ++ + + K   +VIGKDTRLSGYM+EN+L
Sbjct: 2   KKLFGTDGVRGVANIYPMTSEIAMQIGRAIAFIVKNQVKGNTIVIGKDTRLSGYMIENAL 61

Query: 63  VAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVS 122
            AG  + G++  ++GP+P+P +A +T S+RAD GV+ISASHNP+QDNGIK+F  DGYK+ 
Sbjct: 62  AAGICSMGVNVQLVGPLPTPGIAFITTSMRADAGVVISASHNPFQDNGIKIFSADGYKLP 121

Query: 123 TDIEDRIETLL-EDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVV 181
            ++E  IE L+    + +     D IG A R++    RYI ++K T PRD  L    IV+
Sbjct: 122 DELEADIEDLIFSQKMAALRPVADEIGKASRIEDAGGRYIVYLKNTFPRDYVLDDFHIVL 181

Query: 182 DCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIA 241
           DCA+GA+YKVAP VF ELGA V  IG  P+G NIN +CG+ +   +  KV ++ ADIG+A
Sbjct: 182 DCAHGATYKVAPHVFTELGARVTAIGVDPDGKNINHECGALHPEVMAAKVKQLGADIGLA 241

Query: 242 LDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLG 301
           LDGDGDR+I+ DE G IV+GD IMA+ A + M    L+   +V TVMSN+GLE+ I  +G
Sbjct: 242 LDGDGDRLIVCDEHGTIVDGDHIMAICAADLMHRRKLKKKTLVATVMSNMGLEQAIKSMG 301

Query: 302 LSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKP 361
             L RT+VGDRY++E M+  G+N GGEQSGH++  D+ +TGDG +AALQ+L  + + +KP
Sbjct: 302 GQLVRTQVGDRYVVEAMRAKGYNFGGEQSGHLVFLDHNTTGDGTLAALQLLAIMIKKNKP 361

Query: 362 VSTICHCFEEYPQFLRSVSVKDTSILNS--SSIVQAIADAESELRGIDRLIVRASGTESL 419
           +S +      +PQ L++V +  T I         +A+  AE +L G  R++VRASGTE +
Sbjct: 362 LSELATIMATFPQVLQNVRMA-TRIPPEHIPGFPEALDKAERKLEGRGRILVRASGTEPV 420

Query: 420 IRIMAEGDDLSRIKRIVDDLAKVIPMID 447
           IR+M EG+D   I  I  DL +VI   D
Sbjct: 421 IRVMTEGEDEQEITAIAHDLCEVIRKAD 448


>gi|330814388|ref|YP_004358627.1| dihydropteroate synthase [Candidatus Pelagibacter sp. IMCC9063]
 gi|327487483|gb|AEA81888.1| dihydropteroate synthase [Candidatus Pelagibacter sp. IMCC9063]
          Length = 442

 Score =  422 bits (1085), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 213/424 (50%), Positives = 290/424 (68%), Gaps = 3/424 (0%)

Query: 3   RRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGK-KKHRRVVIGKDTRLSGYMLENS 61
           +++FGTDGIRG  N   IT     + G+A G  F+ K KK    +I KDTR+SGYMLE +
Sbjct: 2   KKYFGTDGIRGVVNQGNITGEHFYKFGLAAGSFFKIKDKKKHLAIIAKDTRVSGYMLEPA 61

Query: 62  LVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKV 121
           LV+G T+AGMD    GPIP+  +AMLTRS++AD+G+MI+ASHNPY DNG+KLFGP+G K+
Sbjct: 62  LVSGLTSAGMDVITFGPIPTNGLAMLTRSMKADMGIMITASHNPYTDNGLKLFGPNGLKL 121

Query: 122 STDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVV 181
           S  +E RIE L++   +  L     +G  KR++  + RYIE +K   P D  L+G+RIVV
Sbjct: 122 SDKVEKRIEILIDAKQSKLLVPVKELGRVKRLEDGNSRYIEILKSNFPNDFDLKGMRIVV 181

Query: 182 DCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIA 241
           DCANGA YK AP++  ELGA V  IG  PNGININ  CGST   +L++ V + +AD+GIA
Sbjct: 182 DCANGAGYKAAPKILEELGAKVFAIGVDPNGININQKCGSTYPQTLRQGVKKHKADLGIA 241

Query: 242 LDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLG 301
           LDGD DRVI+ DEKGA+++GDQI+ +IA  W   ++L+G G+V T+MSN+GLER+     
Sbjct: 242 LDGDADRVILCDEKGAVIDGDQIIGMIATRWHKKNILKG-GVVGTLMSNLGLERYFEKEN 300

Query: 302 LSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKP 361
           +   R++VGDRY+ E M+   +N+GGEQSGH+IL D+ +TGDGL+ AL+VL  +++  K 
Sbjct: 301 IPFVRSDVGDRYVKETMQAMKYNLGGEQSGHVILGDFTTTGDGLLVALEVLFSMRKGTKS 360

Query: 362 VSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLIR 421
            S +   F+  PQ L +  V D +I++S     AI  A+  L    RL+VR SGTES +R
Sbjct: 361 -SKLLKVFKPVPQILENKEVADKNIIHSKDCKIAIKKAKELLGTEGRLLVRKSGTESKVR 419

Query: 422 IMAE 425
           IM E
Sbjct: 420 IMGE 423


>gi|302342203|ref|YP_003806732.1| phosphoglucosamine mutase [Desulfarculus baarsii DSM 2075]
 gi|301638816|gb|ADK84138.1| phosphoglucosamine mutase [Desulfarculus baarsii DSM 2075]
          Length = 456

 Score =  422 bits (1085), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 220/452 (48%), Positives = 299/452 (66%), Gaps = 15/452 (3%)

Query: 2   KRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFR-GKKKHRRVVIGKDTRLSGYMLEN 60
           + R FGTDG+RG +N  P+T    + IG  V  +FR GK KH+ V+IGKDTRLSGYM EN
Sbjct: 4   QARIFGTDGVRGVANVHPMTVEMALAIGQGVAAVFRRGKAKHK-VIIGKDTRLSGYMFEN 62

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +LVAG  + G DA ++GP+P+PA+A LTRS+RAD G++ISASHNPY+DNGIK+F  DGYK
Sbjct: 63  ALVAGICSMGGDALLMGPMPTPAIAFLTRSMRADAGIVISASHNPYEDNGIKIFARDGYK 122

Query: 121 VSTDIEDRIETLLEDDLTSYLSC--------YDSIGHAKRVDGVHDRYIEHVKRTLPRDV 172
               + D  ETL+E+      SC           +G A+R+D    RYI   KRT P ++
Sbjct: 123 ----LPDETETLIENYALCAASCRAPEQAPEAGKVGRARRIDDAAGRYIVFAKRTFPDEL 178

Query: 173 TLQGLRIVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVH 232
           TL GLRIV+DCANGA+Y+VAP VF ELGADV++ G +P+G NIN  CG+ +  +    V 
Sbjct: 179 TLDGLRIVIDCANGATYRVAPAVFAELGADVILSGVEPDGRNINAQCGALHPENTAALVR 238

Query: 233 EVRADIGIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIG 292
           +  AD+G+A DGDGDR+I+VDEKG +V+GDQIMA+ A   M   +L    +V TVMSN+G
Sbjct: 239 QHEADLGLAFDGDGDRLIMVDEKGQVVDGDQIMAVCADYLMDQGVLNHATVVATVMSNLG 298

Query: 293 LERFIAGLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVL 352
           LE  +   G+ + RT+VGDRY++E M+  G+N+GGEQSGHI+  D+ +TGDG+V+ALQVL
Sbjct: 299 LELCLRERGVRMLRTKVGDRYVVEAMRQGGYNLGGEQSGHILFLDHNTTGDGVVSALQVL 358

Query: 353 RYIKQYDKPVSTICHCFEEYPQFLRSVSVKD-TSILNSSSIVQAIADAESELRGIDRLIV 411
             + +  K +S +       PQ L +V V+  T I     +V AI   E  L    RL+V
Sbjct: 359 AIMVRTGKRLSELAAVMTRLPQVLINVPVRQRTPIAQVPGLVAAIKTQEERLGQTGRLLV 418

Query: 412 RASGTESLIRIMAEGDDLSRIKRIVDDLAKVI 443
           R SGTE+ +RIM E  D+  +    ++L +V+
Sbjct: 419 RYSGTEAKLRIMVEAADVDLMNEAAEELRRVV 450


>gi|115379384|ref|ZP_01466489.1| phosphoglucosamine mutase [Stigmatella aurantiaca DW4/3-1]
 gi|310821981|ref|YP_003954339.1| phosphoglucosamine mutase [Stigmatella aurantiaca DW4/3-1]
 gi|115363614|gb|EAU62744.1| phosphoglucosamine mutase [Stigmatella aurantiaca DW4/3-1]
 gi|309395053|gb|ADO72512.1| Phosphoglucosamine mutase [Stigmatella aurantiaca DW4/3-1]
          Length = 463

 Score =  422 bits (1084), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 209/443 (47%), Positives = 298/443 (67%), Gaps = 2/443 (0%)

Query: 3   RRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSL 62
           +R FGTDG+RG +N +P+T    M++G A+ YL R      RV+IGKDTRLSGYMLE +L
Sbjct: 16  QRLFGTDGVRGVANVYPMTAEVAMQLGRALAYLIRNGPHRHRVIIGKDTRLSGYMLEQAL 75

Query: 63  VAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVS 122
            AG T+ G+D ++ GP+P+P ++ LT S+RAD G +ISASHNPYQDNGIK F  DG+K+ 
Sbjct: 76  SAGITSMGVDVWLTGPLPTPGISNLTTSMRADAGAVISASHNPYQDNGIKFFWRDGFKLP 135

Query: 123 TDIEDRIETLLEDD-LTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVV 181
            + E +IE LL    + +     D+IG A R+D    RYI  +K T PR++TL+G+ IVV
Sbjct: 136 DETEAKIEELLSTGAMDTIRPTADNIGRAFRLDDARGRYIVFLKATFPRELTLEGMTIVV 195

Query: 182 DCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIA 241
           DCANGA+YK AP V  ELGA V+ +G  P+G NIN  CG+ +  +L + V    A +G+A
Sbjct: 196 DCANGAAYKTAPAVLEELGAKVITLGVSPDGKNINEKCGALHPENLAQAVVAHGARLGLA 255

Query: 242 LDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLG 301
           LDGD DR+I+VDEKG +V+GD IMA+   E ++   L+ N +V TVMSNIGLER +A  G
Sbjct: 256 LDGDADRLIVVDEKGKVVDGDAIMAICTSELVARQELKKNTLVATVMSNIGLERAVARFG 315

Query: 302 LSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKP 361
           + + RT VGDRY++E M+ +G+N+GGEQSGH++  D+ +TGDG +AALQ+L  + +  KP
Sbjct: 316 VKVARTRVGDRYVVEEMRKHGYNLGGEQSGHLLFLDHATTGDGTLAALQLLAVMCRQGKP 375

Query: 362 VSTICHCFEEYPQFLRSVSVKDTSILNS-SSIVQAIADAESELRGIDRLIVRASGTESLI 420
           +S +   FE  PQ L +++V+    L     +++ I   E  L    R++VR SGTE  +
Sbjct: 376 LSELASIFEPVPQTLVNITVRHKRELGELPEVMKVIQSVEQRLGNEGRVLVRFSGTEPKV 435

Query: 421 RIMAEGDDLSRIKRIVDDLAKVI 443
           RI+ EG+D  R + +  ++A+ +
Sbjct: 436 RILIEGEDGKRNEELAREIAEAL 458


>gi|153005195|ref|YP_001379520.1| phosphoglucosamine mutase [Anaeromyxobacter sp. Fw109-5]
 gi|205830873|sp|A7HCU0|GLMM_ANADF RecName: Full=Phosphoglucosamine mutase
 gi|152028768|gb|ABS26536.1| phosphoglucosamine mutase [Anaeromyxobacter sp. Fw109-5]
          Length = 469

 Score =  421 bits (1083), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 211/446 (47%), Positives = 299/446 (67%), Gaps = 6/446 (1%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           + RR FGTDG+RG +N  P+T    +++G A+ Y+ R      R+VIGKDTRLSGYMLE 
Sbjct: 16  IARRLFGTDGVRGVANVHPMTAEMALQLGRALAYVVRNGSHRHRIVIGKDTRLSGYMLEQ 75

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           ++ +G ++ G+D  + GP+P+P +A LT S+RAD GV+ISASHNPYQDNGIK F  DG+K
Sbjct: 76  AIASGISSMGVDVMLSGPLPTPGIAFLTESMRADAGVVISASHNPYQDNGIKFFSRDGFK 135

Query: 121 VSTDIEDRIETLL--EDDLTSYLSCYDS---IGHAKRVDGVHDRYIEHVKRTLPRDVTLQ 175
           +   +E +IE L+  E  L  + +   +   IG AKR+D    RY+  +K   P+D+TL 
Sbjct: 136 LPDAVELQIEQLVLGESGLEEFHALRPTATRIGKAKRIDDAIGRYVVFLKSIFPKDLTLD 195

Query: 176 GLRIVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVR 235
           GL IVVDCA+GA+Y VAP VF ELGA V+ +  KP+G NIN  CG+ +  S+ + + + R
Sbjct: 196 GLTIVVDCAHGAAYHVAPAVFEELGAKVIALNVKPDGKNINDGCGAVHPESMAKAIQKHR 255

Query: 236 ADIGIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLER 295
           A +G+ALDGD DRVI+ DE+G IV+GD IMAL+ R+ +    L    +V TVMSN+GLER
Sbjct: 256 AHLGLALDGDADRVILADEQGRIVDGDAIMALVGRDLIRQKTLAKRTVVATVMSNLGLER 315

Query: 296 FIAGLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYI 355
            +AG G  + RT VGDRY++E M+ +G+N GGEQSGH+I  D+ +TGDG+ AAL VL  +
Sbjct: 316 ALAGAGGRVVRTAVGDRYVVEEMRRSGYNFGGEQSGHLIFLDHVTTGDGVAAALNVLAVM 375

Query: 356 KQYDKPVSTICHCFEEYPQFLRSVSVKDTSILNS-SSIVQAIADAESELRGIDRLIVRAS 414
           ++  +P+S +  CFE  PQ L +V+VK+   L+    + + I   E  L    R++VR S
Sbjct: 376 QREGRPLSELARCFEPVPQALVNVAVKERRPLSDLPEVARVIGSVEKALGKDGRVLVRFS 435

Query: 415 GTESLIRIMAEGDDLSRIKRIVDDLA 440
           GTE+ +R++ EG D  RI+   D++A
Sbjct: 436 GTENKVRVLVEGTDGKRIRAQADEIA 461


>gi|322420020|ref|YP_004199243.1| phosphoglucosamine mutase [Geobacter sp. M18]
 gi|320126407|gb|ADW13967.1| phosphoglucosamine mutase [Geobacter sp. M18]
          Length = 454

 Score =  421 bits (1083), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 210/443 (47%), Positives = 303/443 (68%), Gaps = 6/443 (1%)

Query: 3   RRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSL 62
           ++ FGTDG+RG +N +P+T    M+IG A  Y+F+  KK  R+VIGKDTRLSGYMLE++L
Sbjct: 2   KKLFGTDGVRGVANVYPMTAEMAMQIGRAAAYIFKNGKKRHRIVIGKDTRLSGYMLESAL 61

Query: 63  VAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVS 122
           +AG  + G+D  ++GP+P+P +A +T S+RAD GV+ISASHNP++DNGIK F  DG+K+ 
Sbjct: 62  MAGICSMGVDVLLVGPLPTPGIANITSSMRADAGVVISASHNPFEDNGIKFFSRDGFKLP 121

Query: 123 TDIEDRIETLL-EDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVV 181
            + E  IE L+    + S       +G A R+D    R++  +K T P+D+ L GL+IV+
Sbjct: 122 DETELMIEELIFSKRIDSLRPTAKEVGKAYRIDDAQGRFVVFLKSTFPKDLDLSGLKIVL 181

Query: 182 DCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTN--VLSLQRKVHEVRADIG 239
           DCANGA+YKVAP VF ELGA+V+ IG +PNG NIN DCGS +  V+S   K+H   AD+G
Sbjct: 182 DCANGAAYKVAPAVFEELGAEVITIGVRPNGTNINADCGSLHPEVMSEAVKLHG--ADLG 239

Query: 240 IALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAG 299
           IALDGD DRVI VDE G +V+GD+IMA+ A E +    L+ N +V TVMSN+GL+  +  
Sbjct: 240 IALDGDADRVIFVDEYGNVVDGDKIMAICATEMLKQGTLKRNTLVATVMSNMGLDLAMKR 299

Query: 300 LGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYD 359
            G  + +T VGDRY++E M   G+N+GGEQSGH+I  D+ +TGDG+++ALQVL  +++  
Sbjct: 300 AGGEVIKTAVGDRYVVEEMLKGGYNLGGEQSGHMIFLDHNTTGDGILSALQVLAIMQRRQ 359

Query: 360 KPVSTICHCFEEYPQFLRSVSV-KDTSILNSSSIVQAIADAESELRGIDRLIVRASGTES 418
           K +S +       PQ L +V + + T ++    + + I D E  L+G  R+++R SGTE 
Sbjct: 360 KRLSELALVMHSLPQVLVNVRLSQKTDVMQVPELAKLINDVEERLKGEGRVLIRWSGTEP 419

Query: 419 LIRIMAEGDDLSRIKRIVDDLAK 441
           L+RIM EG+D + I+   +++A+
Sbjct: 420 LLRIMLEGNDETSIRDWANEIAQ 442


>gi|304310502|ref|YP_003810100.1| Phosphoglucosamine mutase [gamma proteobacterium HdN1]
 gi|301796235|emb|CBL44443.1| Phosphoglucosamine mutase [gamma proteobacterium HdN1]
          Length = 448

 Score =  421 bits (1082), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 204/444 (45%), Positives = 303/444 (68%), Gaps = 4/444 (0%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M +R+FGTDGIRG    FPITP+FM+++G A G +F G+    +++IGKDTR+SGYM E+
Sbjct: 1   MSKRYFGTDGIRGAVGQFPITPDFMLKLGWAAGKVFTGQHTRPKILIGKDTRVSGYMFES 60

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +L AG +AAG+D  +LGP+P+P +A LTR+ RA  G++ISASHNP+QDNGIK F  +G K
Sbjct: 61  TLEAGLSAAGVDVVLLGPMPTPGIAYLTRTFRAAAGIVISASHNPHQDNGIKFFSSEGKK 120

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +  +IE  IE +L+ ++T   S  + IG  ++++    RYIE  K T+PR++TL+GL+IV
Sbjct: 121 LDDNIEHAIERMLDAEMTVVAS--EEIGKTRKLEDARGRYIEFCKSTMPRELTLKGLKIV 178

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           +DCANGA+Y VAP VF ELGA++V +G KPNG+NIN  CGST+  +LQ+ V E +AD+GI
Sbjct: 179 LDCANGATYHVAPSVFEELGAEIVTLGVKPNGLNINEKCGSTSPKTLQQAVLEHKADLGI 238

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           A DGDGDRV++VD  G +V+GD+++ +I         L G G+V T+MSN GLE+ +  L
Sbjct: 239 AFDGDGDRVVMVDHDGEVVDGDELLYIITYGRSVRGEL-GGGVVGTLMSNFGLEKALVRL 297

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
            +   R +VGDRY+ME +    + +GGE SGH++  D  +TGDG+++ALQVL  +    K
Sbjct: 298 DVPFVRAKVGDRYVMEQLSQRNWLLGGESSGHLVCLDKTTTGDGIISALQVLAVVIGTGK 357

Query: 361 PVSTICHCFEEYPQFLRSVSVKDT-SILNSSSIVQAIADAESELRGIDRLIVRASGTESL 419
           P++ +     + PQ + +V + +   I N  S+  A+AD E  L    R+++R SGTE +
Sbjct: 358 PLALLKRGMTKMPQTMINVRLPEKRDIANEPSVCAAVADVEKRLGSRGRVLLRPSGTEPV 417

Query: 420 IRIMAEGDDLSRIKRIVDDLAKVI 443
           IR+M EG+D   +++    ++  +
Sbjct: 418 IRVMVEGEDAVEVQQFAQQISDTV 441


>gi|77918607|ref|YP_356422.1| phosphoglucosamine mutase [Pelobacter carbinolicus DSM 2380]
 gi|123574577|sp|Q3A5V5|GLMM_PELCD RecName: Full=Phosphoglucosamine mutase
 gi|77544690|gb|ABA88252.1| phosphoglucosamine mutase [Pelobacter carbinolicus DSM 2380]
          Length = 460

 Score =  421 bits (1081), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 214/446 (47%), Positives = 298/446 (66%), Gaps = 3/446 (0%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHR-RVVIGKDTRLSGYMLE 59
           MK++ FGTDG+RG +N +P+T    M++G A  ++F+     R R+VIGKDTRLSGYM+E
Sbjct: 4   MKKKLFGTDGVRGVANIYPMTTEIAMQLGRAAAHIFKKDHTRRHRIVIGKDTRLSGYMIE 63

Query: 60  NSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGY 119
           N+LVAG  + G+D  ++GP+P+P +A +T S+RAD GV+ISASHNPYQDNGIK F  DG+
Sbjct: 64  NALVAGICSMGVDVLLVGPLPTPGIAFITSSMRADAGVVISASHNPYQDNGIKFFSADGF 123

Query: 120 KVSTDIEDRIETLL-EDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLR 178
           K+    E  IE L+  +++ S     D +G A R+D    RYI  +K + P+D+ L GL+
Sbjct: 124 KLPDTTELEIEKLIFGNEIDSLRPVADEVGKAFRMDDAGGRYIVFLKNSFPQDLDLNGLK 183

Query: 179 IVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADI 238
           IV+DCANGA+YKVAP V  ELGA+VV +G KPNG NIN  CGS    SL + V E  A +
Sbjct: 184 IVLDCANGAAYKVAPAVLEELGAEVVTLGVKPNGSNINAGCGSLYPESLAKAVKEHGAHL 243

Query: 239 GIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIA 298
           G+ALDGD DRVI VDE+G  V+GDQIMA+ + + M    L  N +V+TVMSN+GL+  + 
Sbjct: 244 GMALDGDADRVIFVDEQGQEVDGDQIMAICSLDMMKQGKLAHNTLVSTVMSNMGLDIALR 303

Query: 299 GLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQY 358
             G  + +T VGDRY++E M+  G+N+GGEQSGH+I  DY +TGDG+V+ALQ+L  +++ 
Sbjct: 304 NAGGQVVKTAVGDRYVVEEMRRGGYNLGGEQSGHMIFLDYNTTGDGMVSALQLLAIMQRT 363

Query: 359 DKPVSTICHCFEEYPQFLRSVSVKDTSILN-SSSIVQAIADAESELRGIDRLIVRASGTE 417
            KP+S +       PQ L +V V     +N    I + +   E +L    R+++R SGTE
Sbjct: 364 GKPLSELAGVMTALPQVLINVRVASRQDINIVPEIARTVKAVEEKLADTGRVLIRYSGTE 423

Query: 418 SLIRIMAEGDDLSRIKRIVDDLAKVI 443
            L+RIM EG D + I  +  ++A VI
Sbjct: 424 PLLRIMLEGQDEAEITGLAQEIADVI 449


>gi|254491822|ref|ZP_05105001.1| phosphoglucosamine mutase [Methylophaga thiooxidans DMS010]
 gi|224463300|gb|EEF79570.1| phosphoglucosamine mutase [Methylophaga thiooxydans DMS010]
          Length = 448

 Score =  420 bits (1080), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 224/446 (50%), Positives = 300/446 (67%), Gaps = 5/446 (1%)

Query: 2   KRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENS 61
           +RR+FGTDGIRGK     ITP+F++++G AVG +   K+K+ RV+IGKDTR+SGYM E++
Sbjct: 4   QRRYFGTDGIRGKVGDGAITPDFVLKLGWAVGRVL-AKEKNSRVIIGKDTRISGYMFESA 62

Query: 62  LVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKV 121
           L AG +AAG+D ++LGP+P+PAVA LTR+  A  G++ISASHNPY DNGIK F  +G K+
Sbjct: 63  LQAGLSAAGVDIYLLGPMPTPAVAYLTRTFHAQAGIVISASHNPYHDNGIKFFSAEGTKL 122

Query: 122 STDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVV 181
              IE  IE +L+  L +  S    +G A R+     RYIE  K T+P  V L GL+IVV
Sbjct: 123 PDSIEHEIEAMLDQPLKTVDST--RLGKAHRIADAPGRYIEFCKSTIPSGVDLDGLKIVV 180

Query: 182 DCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIA 241
           DCA+GA+Y VAP+VF ELGADVVV+G +P+G NIN  CGST    LQ+ V E +AD+G+A
Sbjct: 181 DCAHGATYHVAPDVFRELGADVVVMGAEPDGFNINQHCGSTEPRLLQQAVLENKADLGLA 240

Query: 242 LDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLG 301
           LDGDGDR+I+VD +G IV+GD+++ +IAR    +     N IV T MSN+GLE  +A   
Sbjct: 241 LDGDGDRIIMVDHRGEIVDGDELLFIIARARQRNGDKSSN-IVGTQMSNLGLEHALAKFN 299

Query: 302 LSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKP 361
           L L R +VGDRY+ME +K  G  +GGE SGHII  D  STGDG+VAALQVL  I+Q    
Sbjct: 300 LLLHRAQVGDRYVMEKLKQVGGLIGGEASGHIICLDKTSTGDGIVAALQVLAEIRQTGDN 359

Query: 362 VSTICHCFEEYPQFLRSVSV-KDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
           +  +     +YPQ L +V V K   I  +  I  A+A  E  L    R+++R SGTE +I
Sbjct: 360 LHALRSVVTKYPQQLINVKVSKMVDIAGNQDIASAVASVEKRLGDEGRVLLRPSGTEPVI 419

Query: 421 RIMAEGDDLSRIKRIVDDLAKVIPMI 446
           R+M EG D +  K++  +LA +I  +
Sbjct: 420 RVMVEGRDATLTKKLAQELADIIQAV 445


>gi|145298039|ref|YP_001140880.1| phosphoglucosamine mutase [Aeromonas salmonicida subsp. salmonicida
           A449]
 gi|158705794|sp|A4SJR0|GLMM_AERS4 RecName: Full=Phosphoglucosamine mutase
 gi|142850811|gb|ABO89132.1| phosphoglucosamine mutase [Aeromonas salmonicida subsp. salmonicida
           A449]
          Length = 444

 Score =  420 bits (1080), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 209/446 (46%), Positives = 308/446 (69%), Gaps = 9/446 (2%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M R++FGTDG+RGK   FPITP+F+M++G A G +   KK  ++V+IGKDTR+SGYMLE+
Sbjct: 1   MARKYFGTDGVRGKVGEFPITPDFVMKLGWAAGKVLS-KKGTKKVLIGKDTRISGYMLES 59

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +L AG +AAG+ A ++GP+P+PAVA LTR+ RA+ G++ISASHNP+ DNGIK F  DG K
Sbjct: 60  ALEAGLSAAGLKAILMGPMPTPAVAYLTRTFRAEAGIVISASHNPFYDNGIKFFSADGTK 119

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDS--IGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLR 178
           +  D+E  IE  L+ ++     C +S  +G A R++    RYIE  K T P +++L+GL+
Sbjct: 120 LPDDVEMAIEAELDHEI----KCVESADLGKAVRIEDAAGRYIEFCKSTFPSNLSLEGLK 175

Query: 179 IVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADI 238
           +VVDC NGA+Y +AP VF ELGA+V+ IG  P+G+NIN   GST   +L  KV E +AD+
Sbjct: 176 MVVDCGNGATYHIAPSVFRELGAEVIAIGCSPDGLNINDGVGSTAPDALAAKVLECKADL 235

Query: 239 GIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIA 298
           G+A DGDGDR+++VD  G I++GD+I+ +IAR+ + +  L+G G+V T+M+N+GLE  + 
Sbjct: 236 GVAFDGDGDRLVMVDHTGYIIDGDEILYIIARDALRNGRLKG-GVVGTLMANMGLELALQ 294

Query: 299 GLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQY 358
            LG+   R +VGDRY++E M   G+ +GGE SGHII  D  +TGDG+VAALQVL  I   
Sbjct: 295 TLGIPFARAKVGDRYVLEMMNEKGWRIGGENSGHIICLDQTTTGDGIVAALQVLMAICTA 354

Query: 359 DKPVSTICHCFEEYPQFLRSVSVKD-TSILNSSSIVQAIADAESELRGIDRLIVRASGTE 417
           + P++ +     ++PQ L +V   +    L + ++ Q +A  E EL G  R+++R SGTE
Sbjct: 355 EMPLAKLRSGMSKFPQVLVNVRFAEGKDPLAADAVNQEVAKVEQELAGRGRVLLRKSGTE 414

Query: 418 SLIRIMAEGDDLSRIKRIVDDLAKVI 443
            LIR+M EG+   +++ +   +A+ +
Sbjct: 415 PLIRVMVEGEHEQQVRDMAQRIAQQV 440


>gi|256828072|ref|YP_003156800.1| phosphoglucosamine mutase [Desulfomicrobium baculatum DSM 4028]
 gi|256577248|gb|ACU88384.1| phosphoglucosamine mutase [Desulfomicrobium baculatum DSM 4028]
          Length = 449

 Score =  420 bits (1080), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 212/442 (47%), Positives = 297/442 (67%), Gaps = 2/442 (0%)

Query: 4   RFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSLV 63
           R FGTDGIRG+ N+ P+ P  ++R+G+A G  FR   K  RVVIGKDTRLSGY+ E++L 
Sbjct: 3   RLFGTDGIRGRVNSHPMQPELVLRLGLAAGQYFRNGNKRHRVVIGKDTRLSGYVFESALT 62

Query: 64  AGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVST 123
           +GF AAGMD F++GP+P+PA++ LTR++RAD+GV+ISASHNPY DNGIK F  DG+K++ 
Sbjct: 63  SGFCAAGMDVFLVGPLPTPAISFLTRNMRADLGVVISASHNPYMDNGIKFFNKDGFKLAD 122

Query: 124 DIEDRIETLLED-DLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVVD 182
            +ED I  ++   D       +D +G A+++     RYI  +K + P  +TL GL IV+D
Sbjct: 123 RVEDEIAAMVTSPDFVWKCPDHDQVGRARKIQDSPGRYIVELKHSFPAGMTLDGLTIVLD 182

Query: 183 CANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIAL 242
           CA+GA+Y+VAP +F ELGA V+ +G +P+G+NIN  CGS +   L  KV E RADIG+AL
Sbjct: 183 CAHGAAYRVAPLIFEELGARVITLGIEPDGLNINKGCGSLHPEVLAAKVREHRADIGLAL 242

Query: 243 DGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLGL 302
           DGD DR+I+VDE G I++GDQIMA+ A E M+   L  N +V TVMSN+ LE F+   G 
Sbjct: 243 DGDADRLIVVDEYGTILDGDQIMAVCADEMMARGTLAENTLVATVMSNMALEVFMQERGG 302

Query: 303 SLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKPV 362
            L RT+VGDRY++E M+  G+ +GGEQSGH++   + +TGDG +AALQ+L  +    KP+
Sbjct: 303 RLLRTKVGDRYVVEEMRKGGYLLGGEQSGHLVFMQHSTTGDGTLAALQLLSIMVGRQKPI 362

Query: 363 STICHCFEEYPQFLRSVSVKDTSILNSSSIVQ-AIADAESELRGIDRLIVRASGTESLIR 421
           S I      YPQ L ++ VK     ++  +++ A+  AE  L    R+++R SGTESL R
Sbjct: 363 SEIAGLLTPYPQKLVNLKVKKKVPFDTVPVIKDAVRHAEDRLGRTGRVLLRYSGTESLAR 422

Query: 422 IMAEGDDLSRIKRIVDDLAKVI 443
           IM E  D + +  +   L   +
Sbjct: 423 IMVEAQDQALVDELCASLTAAV 444


>gi|90022363|ref|YP_528190.1| phosphoglucosamine mutase [Saccharophagus degradans 2-40]
 gi|123276501|sp|Q21H51|GLMM_SACD2 RecName: Full=Phosphoglucosamine mutase
 gi|89951963|gb|ABD81978.1| phosphoglucosamine mutase [Saccharophagus degradans 2-40]
          Length = 446

 Score =  420 bits (1079), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 219/449 (48%), Positives = 302/449 (67%), Gaps = 14/449 (3%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLF---RGKKKHRRVVIGKDTRLSGYM 57
           M R++FGTDGIRG      ITP F +++G AVG +     G K    V+IGKDTR+SGYM
Sbjct: 1   MARKYFGTDGIRGLVGEGVITPQFFLQLGWAVGKVLAQQNGDKSGGLVLIGKDTRISGYM 60

Query: 58  LENSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPD 117
            E++L AG  +AG+D  +LGP+P+PA+A LTR+ +A  G++ISASHNPY DNGIKLF  D
Sbjct: 61  FESALEAGLISAGVDVGLLGPMPTPAIAYLTRTFQASAGIVISASHNPYTDNGIKLFNTD 120

Query: 118 GYKVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGL 177
           G    T + D +E  +ED L   ++    +G A+R+     RYIE  K +LP    L+GL
Sbjct: 121 G----TKLPDDVELAIEDQLDRAMTTASKLGKARRIADAEGRYIEFCKGSLPWGFNLRGL 176

Query: 178 RIVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRAD 237
            IVVDCANGA+Y+VAP+VF ELGA+V+ I +KP+G+NINLDCGST +  LQ+ V E  AD
Sbjct: 177 NIVVDCANGATYEVAPKVFGELGANVIPIANKPDGLNINLDCGSTKLNQLQKHVLETGAD 236

Query: 238 IGIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRG--NGIVTTVMSNIGLER 295
           +GIA DGDGDRV+ VDEKG +++GDQ++ +IA    SH    G  +G+V T+MSN G E 
Sbjct: 237 MGIAFDGDGDRVMFVDEKGEVLDGDQLLFIIA----SHKHKNGGCSGVVGTLMSNFGFEL 292

Query: 296 FIAGLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYI 355
            +   G+  +R +VGDRY++E MKNNG+ VGGE SGHI+ SD  +TGDG++AALQVL  +
Sbjct: 293 GLKNQGIPFERAKVGDRYVIEAMKNNGWQVGGESSGHIVCSDVTTTGDGIIAALQVLLAL 352

Query: 356 KQYDKPVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQ-AIADAESELRGIDRLIVRAS 414
           K   + +  +    ++ PQ + +V V +   L+S   VQ AIA AE  L G  R+++RAS
Sbjct: 353 KAEKQSLHQLKLRMQKMPQVMINVRVTNKVDLDSHEQVQAAIASAEKRLDGKGRVLLRAS 412

Query: 415 GTESLIRIMAEGDDLSRIKRIVDDLAKVI 443
           GTE +IR+M EG +   +  +  +LA ++
Sbjct: 413 GTEPVIRVMVEGQEHQLVASLAQELADIV 441


>gi|258592311|emb|CBE68620.1| phosphoglucosamine mutase [NC10 bacterium 'Dutch sediment']
          Length = 449

 Score =  419 bits (1078), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 212/443 (47%), Positives = 299/443 (67%), Gaps = 2/443 (0%)

Query: 3   RRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSL 62
           R+ FGTDGIRG +N  P+TP  M+++G A  +L RG  +   +VIGKDTRL+GYMLE +L
Sbjct: 2   RQLFGTDGIRGVANREPMTPETMVKVGRAAAHLLRGATERPTIVIGKDTRLTGYMLETAL 61

Query: 63  VAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVS 122
            AG T+ G+D  ++GP+P+P +A +TRSLRAD GV+ISASHNPY+DNGIK F  +G K+ 
Sbjct: 62  TAGITSMGVDVLLVGPLPTPGIAFITRSLRADAGVVISASHNPYEDNGIKFFSHEGLKLP 121

Query: 123 TDIEDRIETLLED-DLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVV 181
             +E RIE L+ + ++    +    IG A RV     RYIE  K TLP+ +TL+G+R+VV
Sbjct: 122 DAMEQRIEELIRNGEIDGIRTAPSEIGKAYRVGDAVGRYIEFAKNTLPKGMTLKGMRVVV 181

Query: 182 DCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIA 241
           DCANGA+YKV+P V  EL A+VV +  +P+G NIN  CGS +   ++R V + +A +G A
Sbjct: 182 DCANGAAYKVSPAVLKELNAEVVSLNVEPDGTNINKGCGSLHPEEVRRAVVKHKAHVGFA 241

Query: 242 LDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLG 301
            DGD DRV+ VDE+G +++GD I+AL A +      LR N IV TVMSNIGL+  +   G
Sbjct: 242 HDGDADRVVFVDERGELMDGDHILALCALDLKREGRLRENTIVATVMSNIGLDLAMQEAG 301

Query: 302 LSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKP 361
           + + RT VGDRY++E M    + +GGEQSGHII  ++ +TGDGLV ALQVL  +++  KP
Sbjct: 302 IKIVRTAVGDRYVLEKMLAERYMLGGEQSGHIIFLEHHTTGDGLVTALQVLATMQRCGKP 361

Query: 362 VSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQ-AIADAESELRGIDRLIVRASGTESLI 420
           +S +  C   YPQ L +  V+  +++     VQ AI  AE+ + G  R++VR SGTE + 
Sbjct: 362 LSELKACMTSYPQVLINAPVRRRAVVEELPRVQEAIRSAETSMGGRGRILVRLSGTEPVA 421

Query: 421 RIMAEGDDLSRIKRIVDDLAKVI 443
           RIM EG++ ++I+R+  ++A  I
Sbjct: 422 RIMVEGEESAKIERLAREIALAI 444


>gi|262277484|ref|ZP_06055277.1| phosphoglucosamine mutase [alpha proteobacterium HIMB114]
 gi|262224587|gb|EEY75046.1| phosphoglucosamine mutase [alpha proteobacterium HIMB114]
          Length = 442

 Score =  419 bits (1077), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 208/442 (47%), Positives = 301/442 (68%), Gaps = 3/442 (0%)

Query: 3   RRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRV-VIGKDTRLSGYMLENS 61
           +++FGTDGIRGK N   I      + G+A    F   KK++ V +I KDTRLSGY LE +
Sbjct: 2   KKYFGTDGIRGKVNQGLINGEKFFKFGLAAATYFTNPKKNKPVAIIAKDTRLSGYTLEPA 61

Query: 62  LVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKV 121
           LV+G T+AGM+ +  GP+P+ A+AM+T+ ++A++G+MI+ASHNPY DNG+KLFGPDG K+
Sbjct: 62  LVSGLTSAGMNVYTFGPMPTNALAMITKRMKANMGIMITASHNPYDDNGMKLFGPDGMKL 121

Query: 122 STDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVV 181
           S  IE +IE +++ +   +L   + +G  KR++   D YI+ +K+  P++  L+ L+IV+
Sbjct: 122 SDKIEKKIEKIIDTNTQKHLINAEKLGRVKRLETGTDLYIDILKKNFPKNFNLKKLKIVL 181

Query: 182 DCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIA 241
           DCANGA YK  P++   LGA V+ IG +PNG+NIN +CGST    +Q  V + +A IGIA
Sbjct: 182 DCANGAGYKAGPKLLRSLGAKVIAIGTEPNGLNINKNCGSTFPNKIQSAVKKYKAHIGIA 241

Query: 242 LDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLG 301
           LDGD DR+II DEKG I++GDQI+A++A  W    LL+G G+V T+MSN GLE++     
Sbjct: 242 LDGDADRIIICDEKGKIIDGDQIIAMLATRWRKKRLLKG-GVVGTLMSNYGLEKYFKNQK 300

Query: 302 LSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKP 361
           +  KR +VGDRY+ E MK N FN+GGEQSGHIIL  + +TGDGL+ AL+VL  +++  K 
Sbjct: 301 IKFKRADVGDRYVKEVMKKNNFNLGGEQSGHIILGKFATTGDGLLVALEVLFSLRK-SKK 359

Query: 362 VSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLIR 421
            S + + F+  PQ L +V VKD +I+NS    +AI  A   ++G  R++VR SGTE  IR
Sbjct: 360 TSNLFNLFKLTPQILENVMVKDKNIINSPKCKKAINQANKLMKGQGRMLVRKSGTEPKIR 419

Query: 422 IMAEGDDLSRIKRIVDDLAKVI 443
           IM E D+   +++ +  + K +
Sbjct: 420 IMGESDNKKLLQKCISIIKKTV 441


>gi|152979087|ref|YP_001344716.1| phosphoglucosamine mutase [Actinobacillus succinogenes 130Z]
 gi|171704300|sp|A6VP84|GLMM_ACTSZ RecName: Full=Phosphoglucosamine mutase
 gi|150840810|gb|ABR74781.1| phosphoglucosamine mutase [Actinobacillus succinogenes 130Z]
          Length = 444

 Score =  419 bits (1077), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 208/445 (46%), Positives = 304/445 (68%), Gaps = 9/445 (2%)

Query: 2   KRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENS 61
           +R++FGTDG+RGK  +FPITP+F +++G A G +       ++V+IGKDTR+SGYMLE++
Sbjct: 3   ERKYFGTDGVRGKVGSFPITPDFALKLGWAAGKVL-ATHGSKKVLIGKDTRISGYMLESA 61

Query: 62  LVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKV 121
           L AG TAAG+ A  +GP+P+PAVA LTR+ RA+ GV+ISASHNPY DNGIK F  +G K+
Sbjct: 62  LEAGLTAAGLSAVFVGPMPTPAVAYLTRTFRAEAGVVISASHNPYDDNGIKFFSAEGTKL 121

Query: 122 STDIEDRIETLLEDDLTSYLSCYDS--IGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRI 179
             D+E+ IE LLE  +     C +S  +G A R++    RYIE  K T P  ++L+G +I
Sbjct: 122 PDDVEEAIEALLEQPM----DCVESAELGKASRINDAAGRYIEFCKSTFPTSLSLEGYKI 177

Query: 180 VVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIG 239
           VVDCA+GA+Y +AP V  ELGA+++ IG KPNG+NIN  CG+T++ +L+ KV E+ AD+G
Sbjct: 178 VVDCAHGATYHIAPSVLRELGAEIIEIGTKPNGLNINEKCGATDIEALRHKVLEIGADVG 237

Query: 240 IALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAG 299
           +A DGDGDR+++VD  G  V+GDQI+ +IARE +    L+G G+V T+MSN+ LE  +  
Sbjct: 238 LAYDGDGDRIMMVDHLGNKVDGDQILYIIARETLRAGHLKG-GVVGTLMSNMSLEIALKQ 296

Query: 300 LGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYD 359
           LG+   R  VGDRY++E M+ NG+ +GGE SGHII+ D  +TGDG++A+L VL  + Q+ 
Sbjct: 297 LGIPFLRANVGDRYVLEKMQENGWKLGGENSGHIIILDKNTTGDGIIASLAVLTAMAQHK 356

Query: 360 KPVSTICHCFEEYPQFLRSVSVK-DTSILNSSSIVQAIADAESELRGIDRLIVRASGTES 418
             +  +    + +PQ L +V      + LNS  +    A+ E  L G  R+++R SGTE 
Sbjct: 357 LSLHELTGAVKLFPQVLINVRFAGGENPLNSEKVKAVAAEVEQRLAGKGRILLRKSGTEP 416

Query: 419 LIRIMAEGDDLSRIKRIVDDLAKVI 443
           LIR+M E +D    ++  +++A+ +
Sbjct: 417 LIRVMVECEDAVLAQKSAEEIAEAV 441


>gi|153869549|ref|ZP_01999124.1| Phosphoglucosamine mutase [Beggiatoa sp. PS]
 gi|152073958|gb|EDN70869.1| Phosphoglucosamine mutase [Beggiatoa sp. PS]
          Length = 453

 Score =  419 bits (1076), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 209/443 (47%), Positives = 304/443 (68%), Gaps = 4/443 (0%)

Query: 2   KRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENS 61
           KR++FGTDGIRG   T PITP F++++G AVG + +  +   +V+IGKDTR+SGYM E++
Sbjct: 4   KRKYFGTDGIRGTVGTPPITPEFVLKLGWAVGRVLKNGQNKNKVLIGKDTRISGYMFESA 63

Query: 62  LVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKV 121
           L AG +AAGMD  +LGP+P+PA+A LTR+  A  G++ISASHNP+QDNGIK F  +G K+
Sbjct: 64  LQAGLSAAGMDIRLLGPMPTPAIAYLTRTFHAVAGIVISASHNPFQDNGIKFFSSNGMKL 123

Query: 122 STDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVV 181
             ++E  IE  +E+ L +     + +G A+R++    RYIE  K T+P D+TL+GL+IVV
Sbjct: 124 PDEVELAIEAEMENSLQTV--APNQLGKAERIEDAPGRYIEFCKSTIPYDITLKGLKIVV 181

Query: 182 DCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIA 241
           DCA+GA+Y VAP VF ELGA V  IG +PNG NIN   G+T   +LQ  V    AD+GIA
Sbjct: 182 DCAHGATYHVAPSVFRELGASVETIGTQPNGFNINAGFGATQPQTLQTAVLYQNADLGIA 241

Query: 242 LDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLG 301
           LDGDGDRV++VD KG +++GD+++ +IA+      LLR   +V TVMSN+GLE+ +   G
Sbjct: 242 LDGDGDRVLMVDAKGEVIDGDELLFIIAQARHKAGLLR-EPVVGTVMSNLGLEQALEKKG 300

Query: 302 LSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKP 361
           ++ +R  VGDRY++E ++ +G N+GGE SGHII  D  +TGDG++ ALQVL  I +   P
Sbjct: 301 IAFQRAAVGDRYVLEMLQQSGGNLGGESSGHIICLDRTTTGDGIITALQVLAVIMETGLP 360

Query: 362 VSTICHCFEEYPQFLRSVSVKD-TSILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
           +  +     + PQ + +VS+     I++  +I +A+ +AE +L    R+++R SGTE LI
Sbjct: 361 LHVLKTGMLKCPQKMINVSITPGLDIISQPAIQEAVHEAERQLNSQGRILLRPSGTEPLI 420

Query: 421 RIMAEGDDLSRIKRIVDDLAKVI 443
           R+M EG D  +++ +   LA+V+
Sbjct: 421 RVMVEGIDGQQVETVAHQLAEVV 443


>gi|121998547|ref|YP_001003334.1| phosphoglucosamine mutase [Halorhodospira halophila SL1]
 gi|158705797|sp|A1WXX0|GLMM_HALHL RecName: Full=Phosphoglucosamine mutase
 gi|121589952|gb|ABM62532.1| phosphoglucosamine mutase [Halorhodospira halophila SL1]
          Length = 455

 Score =  418 bits (1074), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 213/443 (48%), Positives = 306/443 (69%), Gaps = 4/443 (0%)

Query: 2   KRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENS 61
           +R +FGTDGIRG+    PITP+F++R+G A G +  G+ + R+VVIGKDTRLSGYM E++
Sbjct: 4   ERSYFGTDGIRGRVGEAPITPDFVLRLGWAAGRVLAGEGQ-RKVVIGKDTRLSGYMFESA 62

Query: 62  LVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKV 121
           L AGF AAG+ + +LGP+P+PA+A LTR+L A  GV+ISASHNP+ DNGIK FGPDGYK+
Sbjct: 63  LEAGFAAAGVHSLMLGPMPTPAIAYLTRTLHARAGVVISASHNPHHDNGIKFFGPDGYKL 122

Query: 122 STDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVV 181
               E+ IE LL+D     + C + +G A R++    RYIE  K ++ R + L+GLR+VV
Sbjct: 123 DDATEEAIERLLQDGPPQMVRC-EELGRATRINDAVGRYIEFCKGSVQRQIDLRGLRVVV 181

Query: 182 DCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIA 241
           DCA+GA+Y+ AP V  ELGADVVVIG++P+G+NIN+D GS +   L ++V E  AD+G+A
Sbjct: 182 DCAHGATYQAAPAVLAELGADVVVIGNEPDGLNINVDHGSQHPERLCQRVVEASADVGVA 241

Query: 242 LDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLG 301
            DGDGDRVI+VD  G +++GD ++ +IA   ++   +RG  +V T M+N+GLE  +  LG
Sbjct: 242 FDGDGDRVIMVDRYGRVIDGDGLLYIIATARVARGQVRG-AVVGTQMTNLGLEVALQELG 300

Query: 302 LSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKP 361
           L L+RT VGDRY++E +   G  +GGE SGHII  D  +TGDGL++ALQVL  +    +P
Sbjct: 301 LVLERTRVGDRYVLERLLQVGGTLGGESSGHIICLDRTTTGDGLISALQVLEAMVTTGRP 360

Query: 362 VSTICHCFEEYPQFLRSVSV-KDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
           +  +      YPQ L +V V +   ++   ++ +A+ +AE +L    R+++R SGTE L+
Sbjct: 361 LDELVAGMHYYPQRLVNVPVSRGPDVIRLPAVTEAVEEAEHQLGDHGRVLLRPSGTEPLL 420

Query: 421 RIMAEGDDLSRIKRIVDDLAKVI 443
           R+M EG D  ++ R+ D LA  +
Sbjct: 421 RVMVEGADEGQVNRLADWLAVTV 443


>gi|196231007|ref|ZP_03129867.1| phosphoglucosamine mutase [Chthoniobacter flavus Ellin428]
 gi|196224837|gb|EDY19347.1| phosphoglucosamine mutase [Chthoniobacter flavus Ellin428]
          Length = 474

 Score =  417 bits (1073), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 209/447 (46%), Positives = 294/447 (65%), Gaps = 9/447 (2%)

Query: 3   RRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFR------GKKKHRR-VVIGKDTRLSG 55
           R+ FGTDG+RG +N  P+T    +++G A  ++F       G+   R  +VIGKDTRLSG
Sbjct: 19  RKIFGTDGVRGTANIEPVTAETALKLGRAAAHVFAQMSVLAGRSGGRTTIVIGKDTRLSG 78

Query: 56  YMLENSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFG 115
           YMLEN+L AG  + G D  ++GP+P+P VA +TRSLRAD G+++SASHNPY+DNGIK F 
Sbjct: 79  YMLENALAAGVMSLGADVLLIGPLPTPGVAYITRSLRADAGIVLSASHNPYEDNGIKFFR 138

Query: 116 PDGYKVSTDIEDRIETLL-EDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTL 174
           PDGYK+  +IE RIE L+   ++ S       IG A R+D    RY+E  K++ PR  TL
Sbjct: 139 PDGYKLDDEIEQRIEHLVFSGEIESIRPTAGKIGRATRIDDALGRYVEFAKQSFPRGRTL 198

Query: 175 QGLRIVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEV 234
            G+R+ VD ANGA+YK  P +  ELGAD++V  + PNG NIN +CGST+   +QR V E 
Sbjct: 199 DGMRVAVDVANGAAYKSTPCILRELGADIIVAHNTPNGRNINRECGSTHPEEIQRIVKET 258

Query: 235 RADIGIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLE 294
           RA +GI+ DGD DRV++ DE G +V+GD+IMA+ A +++    L  N +V TVMSN GL+
Sbjct: 259 RAQVGISHDGDADRVLLCDEHGEVVDGDEIMAIAALDFLKRGCLAQNTLVATVMSNFGLD 318

Query: 295 RFIAGLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRY 354
             +      + RT+VGDRY++E M     NVGGEQSGH+I  D+ +TGDG+V+ALQ+LR 
Sbjct: 319 ETLQKHSGRVLRTKVGDRYVIEAMMKEELNVGGEQSGHMIFRDFSTTGDGIVSALQILRI 378

Query: 355 IKQYDKPVSTICHCFEEYPQFLRSVSVKDTSILNS-SSIVQAIADAESELRGIDRLIVRA 413
           + +  KP+S +  C  +YPQ  R++ V++   L S  ++ + + + E EL G  R+++R 
Sbjct: 379 MAETGKPLSELKACLAKYPQAQRNLKVREKKPLESLPTVTKLVEETEKELAGAGRVLLRY 438

Query: 414 SGTESLIRIMAEGDDLSRIKRIVDDLA 440
           SGTE  IR++ EG D  RI    D +A
Sbjct: 439 SGTEPKIRLLIEGRDGDRINLQADRIA 465


>gi|220917556|ref|YP_002492860.1| phosphoglucosamine mutase [Anaeromyxobacter dehalogenans 2CP-1]
 gi|219955410|gb|ACL65794.1| phosphoglucosamine mutase [Anaeromyxobacter dehalogenans 2CP-1]
          Length = 496

 Score =  417 bits (1073), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 208/445 (46%), Positives = 297/445 (66%), Gaps = 10/445 (2%)

Query: 6   FGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSLVAG 65
           FGTDG+RG +N  P+T    +++G A+ Y+ R      R+VIGKDTRLSGYMLE ++ +G
Sbjct: 44  FGTDGVRGVANVHPMTAEMALQLGRALAYIVRSGPHRHRIVIGKDTRLSGYMLEQAIASG 103

Query: 66  FTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVSTDI 125
            ++ G+D  + GP+P+P +A +T S+RAD GV+ISASHNPYQDNGIK F  DG+K+  ++
Sbjct: 104 ISSMGVDVMLCGPLPTPGIAFVTHSMRADAGVVISASHNPYQDNGIKFFSRDGFKLPDEL 163

Query: 126 EDRIETLL----EDD-----LTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQG 176
           E +IE L+    EDD       +       IG AKR+D    RY + +K   P+++TL+G
Sbjct: 164 ELQIERLVLDAGEDDAGAEEFRALRPTATRIGKAKRIDDAIGRYAQFLKTIFPKELTLEG 223

Query: 177 LRIVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRA 236
           L +VVDCA+GA+Y VAP VF ELGA V+ +  KP+G NIN  CG+ +  S+ R V    A
Sbjct: 224 LTVVVDCAHGAAYHVAPVVFEELGAKVIPLNVKPDGKNINDACGAVHPESMARTVKRHGA 283

Query: 237 DIGIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERF 296
           ++G+ALDGD DRVI+ DE G +V+GD IMAL+ R+ ++   L    +V TVMSN+GLER 
Sbjct: 284 NLGLALDGDADRVILADEHGNVVDGDAIMALVGRDLLARKALAKKTVVATVMSNLGLERA 343

Query: 297 IAGLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIK 356
           +A LG  + RT VGDRY++E M+ +G++ GGEQSGH++  D+ +TGDG+ A L VL  + 
Sbjct: 344 LAPLGGKVVRTAVGDRYVVEEMRRSGYSFGGEQSGHLVFLDHVTTGDGVAAGLNVLAVMV 403

Query: 357 QYDKPVSTICHCFEEYPQFLRSVSVKDT-SILNSSSIVQAIADAESELRGIDRLIVRASG 415
           +  KP+S +  CFE  PQ L +V V++   +    S+V+AIA AE  L    R++VRASG
Sbjct: 404 REGKPLSELARCFEPVPQALVNVEVREKRPVAELPSVVKAIAAAEKALGAEGRVLVRASG 463

Query: 416 TESLIRIMAEGDDLSRIKRIVDDLA 440
           TE+ +R++ EG D  R + + D +A
Sbjct: 464 TENKVRVLVEGPDAKRARALADGIA 488


>gi|197122773|ref|YP_002134724.1| phosphoglucosamine mutase [Anaeromyxobacter sp. K]
 gi|196172622|gb|ACG73595.1| phosphoglucosamine mutase [Anaeromyxobacter sp. K]
          Length = 496

 Score =  417 bits (1072), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 208/445 (46%), Positives = 297/445 (66%), Gaps = 10/445 (2%)

Query: 6   FGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSLVAG 65
           FGTDG+RG +N  P+T    +++G A+ Y+ R      R+VIGKDTRLSGYMLE ++ +G
Sbjct: 44  FGTDGVRGVANVHPMTAEMALQLGRALAYIVRSGPHRHRIVIGKDTRLSGYMLEQAIASG 103

Query: 66  FTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVSTDI 125
            ++ G+D  + GP+P+P +A +T S+RAD GV+ISASHNPYQDNGIK F  DG+K+  ++
Sbjct: 104 ISSMGVDVMLCGPLPTPGIAFVTHSMRADAGVVISASHNPYQDNGIKFFSRDGFKLPDEL 163

Query: 126 EDRIETLL----EDD-----LTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQG 176
           E +IE L+    EDD       +       IG AKR+D    RY + +K   P+++TL+G
Sbjct: 164 ELQIERLVLDAGEDDAGAEEFRALRPTATRIGKAKRIDDAIGRYAQFLKTIFPKELTLEG 223

Query: 177 LRIVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRA 236
           L +VVDCA+GA+Y VAP VF ELGA V+ +  KP+G NIN  CG+ +  S+ R V    A
Sbjct: 224 LTVVVDCAHGAAYHVAPVVFEELGAKVIPLNVKPDGKNINDACGAVHPESMARTVKRHGA 283

Query: 237 DIGIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERF 296
           ++G+ALDGD DRVI+ DE G +V+GD IMAL+ R+ ++   L    +V TVMSN+GLER 
Sbjct: 284 NLGLALDGDADRVILADEHGNVVDGDAIMALVGRDLLARKALAKKTVVATVMSNLGLERA 343

Query: 297 IAGLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIK 356
           +A LG  + RT VGDRY++E M+ +G++ GGEQSGH++  D+ +TGDG+ A L VL  + 
Sbjct: 344 LAPLGGKVVRTAVGDRYVVEEMRRSGYSFGGEQSGHLVFLDHVTTGDGVAAGLNVLAVMV 403

Query: 357 QYDKPVSTICHCFEEYPQFLRSVSVKDT-SILNSSSIVQAIADAESELRGIDRLIVRASG 415
           +  KP+S +  CFE  PQ L +V V++   +    S+V+AIA AE  L    R++VRASG
Sbjct: 404 REGKPLSELARCFEPVPQALVNVEVREKRPVAELPSVVKAIAAAEKALGAEGRVLVRASG 463

Query: 416 TESLIRIMAEGDDLSRIKRIVDDLA 440
           TE+ +R++ EG D  R + + D +A
Sbjct: 464 TENKVRVLVEGPDAKRARALADGIA 488


>gi|297539171|ref|YP_003674940.1| phosphoglucosamine mutase [Methylotenera sp. 301]
 gi|297258518|gb|ADI30363.1| phosphoglucosamine mutase [Methylotenera sp. 301]
          Length = 451

 Score =  417 bits (1071), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 212/449 (47%), Positives = 299/449 (66%), Gaps = 9/449 (2%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFR------GKKKHRRVVIGKDTRLS 54
           M +++FGTDGIRGK    PITP+F+MR+G A G +         K  H  V+IGKDTR+S
Sbjct: 1   MSKKYFGTDGIRGKVGEHPITPDFVMRLGYAAGKVLTSVNNNLAKGAHPAVLIGKDTRIS 60

Query: 55  GYMLENSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLF 114
           GYMLE +L AG +AAG+D  + GP+P+PAVA LTR+LRA  G++ISASHNP+ DNGIK F
Sbjct: 61  GYMLEAALEAGLSAAGVDVLLTGPMPTPAVAYLTRALRAQAGIVISASHNPFYDNGIKFF 120

Query: 115 GPDGYKVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTL 174
             +G K+  DIE  IE  LE  +    S    +G A+R+D    RYIE  K T P D+ L
Sbjct: 121 SSEGAKLPDDIEHAIEAELEKPMQVMESA--KLGKARRIDDAAGRYIEFCKSTFPNDLDL 178

Query: 175 QGLRIVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEV 234
           +GL+IV+DCA+GA+Y VAP VF ELGA++V IG+KP+G+NIN   GST+  +LQ+ V E 
Sbjct: 179 RGLKIVLDCAHGATYHVAPNVFHELGAEIVCIGNKPDGLNINEQVGSTHPQALQKAVLEY 238

Query: 235 RADIGIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLE 294
           +AD+GIA DGDGDRV++VD +G +++GDQ++ +IA    +   L G GI  T+M+N+ LE
Sbjct: 239 QADLGIAFDGDGDRVMMVDAQGNLLDGDQLLYIIAIGLHAVGGLNG-GIAGTLMTNLALE 297

Query: 295 RFIAGLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRY 354
                  +   R +VGDRY++E +  N + +GGE SGHI+  D  ++GD ++AALQVL  
Sbjct: 298 HAFDKHQIPFARAKVGDRYVLELLNENNWKLGGENSGHILTLDKHTSGDAIIAALQVLHV 357

Query: 355 IKQYDKPVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRAS 414
           +KQ  K ++ +      YPQ L +V+ K    L    I  A+  AE+EL G  R+++RAS
Sbjct: 358 LKQSGKTLTQMNAELVLYPQVLINVTTKTKLNLEIPQIQNAVKKAENELNGAGRVLLRAS 417

Query: 415 GTESLIRIMAEGDDLSRIKRIVDDLAKVI 443
           GTE  IR+M EG D   ++++ +++A+V+
Sbjct: 418 GTEPKIRVMVEGQDNFLVQKLAEEIAEVV 446


>gi|118580671|ref|YP_901921.1| phosphoglucosamine mutase [Pelobacter propionicus DSM 2379]
 gi|158512564|sp|A1AR93|GLMM_PELPD RecName: Full=Phosphoglucosamine mutase
 gi|118503381|gb|ABK99863.1| phosphoglucosamine mutase [Pelobacter propionicus DSM 2379]
          Length = 453

 Score =  417 bits (1071), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 207/444 (46%), Positives = 295/444 (66%), Gaps = 3/444 (0%)

Query: 3   RRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHR-RVVIGKDTRLSGYMLENS 61
           ++ FGTDG+RG +N +P+T    M++G A  Y+F+   K R R+VIGKDTRLSGYMLEN+
Sbjct: 2   KKLFGTDGVRGVANVYPMTTEMAMQLGRAAAYIFKSSSKRRHRIVIGKDTRLSGYMLENA 61

Query: 62  LVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKV 121
           +VAG  + G+D  ++GP+P+P +A +T S+RAD GV+ISASHNP+QDNGIK F  DG+K+
Sbjct: 62  MVAGICSMGVDVLLVGPLPTPGIANITSSMRADAGVVISASHNPFQDNGIKFFSADGFKL 121

Query: 122 STDIEDRIETLLEDD-LTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
              IE +IE L+E + + S       +G A R+D    RYI  +K T P ++ L G++IV
Sbjct: 122 PDQIELKIEKLIESNKIDSLRPTASEVGKAFRIDDAAGRYIVFLKNTFPTEMDLSGMKIV 181

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           +DCANGA+Y+VAP VF ELGA+V+ +G  PNG NIN DCGS     +   V + RADIGI
Sbjct: 182 LDCANGAAYRVAPAVFEELGAEVICLGVSPNGTNINADCGSLYPQVISEAVKKHRADIGI 241

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           ALDGD DRVI+ DE G  V+GD IMA+ A + +   LL+   +VTTVMSN+GL+  +   
Sbjct: 242 ALDGDADRVIVCDEFGHEVDGDHIMAICATDMLRRKLLKKKTLVTTVMSNMGLDIAMRAA 301

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           G  + +T VGDRY++E M+  G+N+GGEQSGH+I  D  +TGDG+++ALQ+L  +++ +K
Sbjct: 302 GGKIVKTAVGDRYVVEEMRKGGYNLGGEQSGHMIFLDSNTTGDGILSALQLLAVMRRTEK 361

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTS-ILNSSSIVQAIADAESELRGIDRLIVRASGTESL 419
           P+S +       PQ L +  V++   I     I   I D E +L    R+++R SGTE L
Sbjct: 362 PLSELSEVMIALPQVLVNTRVREKKDITTIPEIAARIRDVEEKLGNEGRVLIRYSGTEPL 421

Query: 420 IRIMAEGDDLSRIKRIVDDLAKVI 443
           +R+M EG D   I    +++  ++
Sbjct: 422 LRVMLEGKDTYEITAWANEIIDLV 445


>gi|148264771|ref|YP_001231477.1| phosphoglucosamine mutase [Geobacter uraniireducens Rf4]
 gi|205830875|sp|A5G536|GLMM_GEOUR RecName: Full=Phosphoglucosamine mutase
 gi|146398271|gb|ABQ26904.1| phosphoglucosamine mutase [Geobacter uraniireducens Rf4]
          Length = 454

 Score =  416 bits (1070), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 208/443 (46%), Positives = 299/443 (67%), Gaps = 2/443 (0%)

Query: 3   RRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSL 62
           ++ FGTDG+RG +N +P+T    M+IG A  Y+FR  K+  R+VIGKDTRLSGYM+EN+L
Sbjct: 2   KKLFGTDGVRGVANVYPMTTEMAMQIGRAAAYIFRNGKRRHRIVIGKDTRLSGYMIENAL 61

Query: 63  VAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVS 122
           VAG  + G+D   +GP+P+P +A +T S+RAD GV+ISASHNP+QDNGIK F  DG+K+ 
Sbjct: 62  VAGICSMGVDVLQVGPLPTPGIANITSSMRADAGVVISASHNPFQDNGIKFFSRDGFKLP 121

Query: 123 TDIEDRIETLL-EDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVV 181
            ++E RIE L+    + S       +G A R+D    R++  +K T P+D+ L GL+IV+
Sbjct: 122 DEMELRIEELIFSGKIDSLRPIATEVGKAYRIDDAVGRFVVFLKSTFPKDLDLSGLKIVL 181

Query: 182 DCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIA 241
           DCANGA+YKVAP V  ELGA+V+ IG KPNG NIN  CGS     +   V E RAD+GIA
Sbjct: 182 DCANGAAYKVAPAVLEELGAEVIAIGVKPNGTNINAGCGSLYPNIISEAVKEHRADLGIA 241

Query: 242 LDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLG 301
           LDGD DRVI VDE G  V+GD IMA+ A + +  + LR N +V TVMSN+GL+  +   G
Sbjct: 242 LDGDADRVIFVDEFGHEVDGDHIMAICATDMLKQNKLRENTLVATVMSNMGLDIAVKKAG 301

Query: 302 LSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKP 361
             + +T VGDRY++E M+  G+N+GGEQSGH+I  D+ +TGDG+++ALQVL  +++++K 
Sbjct: 302 GRVIKTAVGDRYVVEEMQKGGYNLGGEQSGHMIFLDHNTTGDGVLSALQVLAVMQRHNKR 361

Query: 362 VSTICHCFEEYPQFLRSVSVKDT-SILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
           +S +       PQ L +V V +   ++    +   I D E++++   R+++R SGTE L+
Sbjct: 362 LSELAEVMIPLPQVLVNVRVTEKRDVMTIPEVAGLIGDIEAKVKDEGRILIRYSGTEPLL 421

Query: 421 RIMAEGDDLSRIKRIVDDLAKVI 443
           R+M EG D  +I     ++A+++
Sbjct: 422 RVMLEGQDKYQITGWAKEIAELV 444


>gi|262274887|ref|ZP_06052698.1| phosphoglucosamine mutase [Grimontia hollisae CIP 101886]
 gi|262221450|gb|EEY72764.1| phosphoglucosamine mutase [Grimontia hollisae CIP 101886]
          Length = 445

 Score =  416 bits (1069), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 210/445 (47%), Positives = 305/445 (68%), Gaps = 9/445 (2%)

Query: 2   KRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENS 61
           KR++FGTDG+RGK   FPITP+FM+++G A G +   ++  ++V+IGKDTR+SGYMLE++
Sbjct: 3   KRKYFGTDGVRGKVGQFPITPDFMLKLGWAAGRVLS-QQGTKKVLIGKDTRISGYMLESA 61

Query: 62  LVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKV 121
           L AG +AAG+ A   GP+P+PA+A LT++ RA+ G++ISASHNPY DNGIK F  +G K+
Sbjct: 62  LEAGLSAAGLQAAFTGPMPTPAIAYLTQTFRAEAGIVISASHNPYYDNGIKFFSSEGTKL 121

Query: 122 STDIEDRIETLLEDDLTSYLSCYDS--IGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRI 179
             +IE  IE  LE  LT    C +S  +G AKR+     RYIE  K T P  ++L+GL+I
Sbjct: 122 PDEIELAIEAELEKPLT----CVESSQLGKAKRIVDAAGRYIEFCKGTFPSSMSLKGLKI 177

Query: 180 VVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIG 239
           V+DCA+GA+Y +AP VF ELGADV+ +G +PNG NIN   G+T+V +LQ++V E +A +G
Sbjct: 178 VLDCAHGATYHIAPSVFQELGADVIAMGVEPNGTNINDQVGATDVRALQKRVVEEQAMLG 237

Query: 240 IALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAG 299
           IA DGDGDRVI+VD +G  V+GDQI  +IARE +    L+G G+V T+M+N+G+E  +  
Sbjct: 238 IAFDGDGDRVIMVDHEGNKVDGDQIAYIIARESLRRGELKG-GVVGTLMTNMGMEVALKN 296

Query: 300 LGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYD 359
           LG+   R +VGDRY+ME +  NG+ +G E SGH+IL D  +TGD +VAALQVL  +    
Sbjct: 297 LGIPFTRAKVGDRYVMEKLLENGWTIGAENSGHVILLDKVTTGDAIVAALQVLASVVGTG 356

Query: 360 KPVSTICHCFEEYPQFLRSVSVK-DTSILNSSSIVQAIADAESELRGIDRLIVRASGTES 418
             +  +C     +PQ L +V    ++  L S +++ A A  E++L    R+++R SGTE 
Sbjct: 357 MSLKELCDGMSMFPQVLENVRFSGESDPLQSDAVLSAKAAVEAKLGDKGRVLLRKSGTEP 416

Query: 419 LIRIMAEGDDLSRIKRIVDDLAKVI 443
           LIR+M EG++   ++    ++A+ +
Sbjct: 417 LIRVMVEGENAEEVQAYALEIAEAV 441


>gi|242279269|ref|YP_002991398.1| phosphoglucosamine mutase [Desulfovibrio salexigens DSM 2638]
 gi|259647715|sp|C6BTS9|GLMM_DESAD RecName: Full=Phosphoglucosamine mutase
 gi|242122163|gb|ACS79859.1| phosphoglucosamine mutase [Desulfovibrio salexigens DSM 2638]
          Length = 449

 Score =  416 bits (1069), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 212/445 (47%), Positives = 303/445 (68%), Gaps = 3/445 (0%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M +R FGTDG+RG+ N FP+T    +R+G+A G  FR  K+  +V+IGKDTRLSGY+ E+
Sbjct: 1   MSKRLFGTDGLRGQVNIFPMTAEVALRMGLAAGSYFRNGKQRHKVIIGKDTRLSGYVFES 60

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +L +G  A GMD F +GP+P+PAV+ LTR++RAD+G++ISASHNP+ DNGIK F   G+K
Sbjct: 61  ALTSGLCAMGMDVFQVGPMPTPAVSFLTRNMRADLGIVISASHNPFMDNGIKFFDSSGHK 120

Query: 121 VSTDIEDRI-ETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRI 179
           +   +ED I + +L  D        + +G A +++    RYI ++K + P+D+TL G+++
Sbjct: 121 LPDAVEDEIADMVLSQDTQWDYPQAEKVGRAYKIEDARGRYIVYLKYSFPQDMTLNGVKL 180

Query: 180 VVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIG 239
           V+DCANGA+Y +   +F ELGA+VV IGDKPNG+NIN  CGS     L ++V E  AD+G
Sbjct: 181 VLDCANGAAYSLG-HMFEELGAEVVRIGDKPNGLNINDKCGSLYPDILGQRVVEEHADLG 239

Query: 240 IALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAG 299
           +ALDGD DR+I+VDEKG +++GD IMA+ A + M    L  N +V TVMSN+ LE F+  
Sbjct: 240 LALDGDADRLIVVDEKGQVLDGDVIMAMCAADLMERGKLNHNMLVATVMSNMALENFMKE 299

Query: 300 LGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYD 359
            G SL RT VGDRY++E M+  G  +GGEQSGH+I  ++ +TGDGL+AALQ+LR +   +
Sbjct: 300 NGGSLLRTPVGDRYVVEAMRREGAILGGEQSGHLIFKEFSTTGDGLLAALQLLRILCVKN 359

Query: 360 KPVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQ-AIADAESELRGIDRLIVRASGTES 418
           +P+S +    E YPQ L++V VK          VQ A+   E EL G  R+++R SGTES
Sbjct: 360 RPLSELSGLLELYPQKLQNVHVKRKRPFEEVPAVQDALKQVEQELAGKGRVLLRYSGTES 419

Query: 419 LIRIMAEGDDLSRIKRIVDDLAKVI 443
           + R+M E +D S+++    +LA V+
Sbjct: 420 VARVMVEAEDSSKVELYTSELAGVL 444


>gi|51245493|ref|YP_065377.1| phosphoglucomutase/phosphomannomutase [Desulfotalea psychrophila
           LSv54]
 gi|81642162|sp|Q6AMQ5|GLMM_DESPS RecName: Full=Phosphoglucosamine mutase
 gi|50876530|emb|CAG36370.1| probable phosphoglucomutase/phosphomannomutase [Desulfotalea
           psychrophila LSv54]
          Length = 450

 Score =  416 bits (1068), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 202/443 (45%), Positives = 297/443 (67%), Gaps = 2/443 (0%)

Query: 3   RRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSL 62
           R+ FGTDGIRG +N  P+T    M++G A+ +L + +    R+VIGKDTRLSGYM+EN++
Sbjct: 2   RKLFGTDGIRGVANVHPMTMEIAMQVGRAIAFLVKKENYRHRIVIGKDTRLSGYMIENAI 61

Query: 63  VAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVS 122
           VAG  + G+D  ++GP+P+P +A +T S+RAD GV+ISASHNP+QDNGIK+F  DG+K+ 
Sbjct: 62  VAGICSMGVDVLLVGPLPTPGIAFITTSMRADAGVVISASHNPFQDNGIKIFFSDGFKLP 121

Query: 123 TDIEDRIETL-LEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVV 181
             +E +IE L L   + +     + +G A R+D    RYI  +K T P+  TL G  IV+
Sbjct: 122 DAMELKIEDLVLSQRMLALQPLAEEVGRASRIDDAKGRYIVFLKNTFPKKYTLDGFHIVI 181

Query: 182 DCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIA 241
           DCA+GA+Y VAP VF ELGA V  +G +PNG NIN  CG+ +   +  KV E+ ADIG+A
Sbjct: 182 DCAHGATYGVAPHVFEELGAKVTALGIEPNGQNINAGCGALHPELMAGKVKELGADIGLA 241

Query: 242 LDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLG 301
            DGDGDR+I+ DE G +V+GD +MA+ A+E ++    +   +V TVMSN+GLE  +  +G
Sbjct: 242 FDGDGDRLIVCDEHGVVVDGDHVMAICAKELLAQRKSKKKTLVATVMSNMGLEVAMKKMG 301

Query: 302 LSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKP 361
             L R +VGDRY++E M+ NG++ GGEQSGH++  ++ +TGDG++AALQ+L  +K+  K 
Sbjct: 302 GHLVRADVGDRYVVECMRKNGYSFGGEQSGHLVFLEHMTTGDGILAALQILAIMKKRKKT 361

Query: 362 VSTICHCFEEYPQFLRSV-SVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
           +S +    + +PQ L++V + K  S+ +      A+   E +L    R++VR SGTE +I
Sbjct: 362 LSELAQVMQSFPQVLKNVRTAKKISVDSIVGFADAVKKYEMQLGDTGRILVRPSGTEPVI 421

Query: 421 RIMAEGDDLSRIKRIVDDLAKVI 443
           R+M EG D + I  I D+L ++I
Sbjct: 422 RVMVEGLDSAEINDIADELCELI 444


>gi|242309128|ref|ZP_04808283.1| phosphoglucosamine mutase [Helicobacter pullorum MIT 98-5489]
 gi|239524169|gb|EEQ64035.1| phosphoglucosamine mutase [Helicobacter pullorum MIT 98-5489]
          Length = 445

 Score =  416 bits (1068), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 205/427 (48%), Positives = 287/427 (67%), Gaps = 5/427 (1%)

Query: 4   RFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSLV 63
           + FGTDG+RG++    +     +++GIA G  +R   K  R+++GKDTR SGYMLEN+LV
Sbjct: 2   KLFGTDGVRGEAGV-KLNAFCALKLGIAAGIYYREHSKTNRILVGKDTRRSGYMLENALV 60

Query: 64  AGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVST 123
           +G TA G +   +GP+P+PA+A LT  +R D G+M+SASHNP+ DNGIK FG  GYK+  
Sbjct: 61  SGLTAVGYEVIQIGPMPTPAIAYLTEDMRCDGGIMVSASHNPFMDNGIKFFGKSGYKIDE 120

Query: 124 DIEDRIETLLEDD--LTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVV 181
             E+ IE +  ++  L S       IG +KR+D V  RYI H+K + P+D++L G+R+V+
Sbjct: 121 KDEEVIEKIYHNESLLESAQKTGKEIGSSKRIDDVIGRYIVHIKNSFPKDLSLHGIRVVL 180

Query: 182 DCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIA 241
           DCANGA+YKVAP +F ELGA+V VI D PNG NIN +CG+T  L LQ +V  VRADIG A
Sbjct: 181 DCANGAAYKVAPTIFSELGAEVFVINDTPNGFNINENCGATQPLMLQEEVRRVRADIGFA 240

Query: 242 LDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLG 301
           LDGD DR+++VDEKG +V+GD+++ ++A     ++ L+ N  V T+MSN  LE F+A  G
Sbjct: 241 LDGDADRLVVVDEKGEVVHGDKLIGVLALAAKQNNTLKNNTAVATIMSNYALEEFLAQNG 300

Query: 302 LSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKP 361
           + L R+ VGD+Y++E M     N GGEQSGHII SD+  TGDGLV+ALQ + YI +  K 
Sbjct: 301 IKLIRSNVGDKYVLESMLAQNLNFGGEQSGHIIFSDFAKTGDGLVSALQTIAYILKSKKQ 360

Query: 362 VSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLIR 421
            S    CF+ YPQ L++++V+    L+S    Q +   E   + I R ++R SGTE+ +R
Sbjct: 361 ASKALDCFKLYPQILKNLNVQSKPNLDSLENYQNLLK-EITSKKI-RHLIRYSGTENKLR 418

Query: 422 IMAEGDD 428
           I+ EG D
Sbjct: 419 ILLEGKD 425


>gi|53803871|ref|YP_114284.1| phosphoglucosamine mutase [Methylococcus capsulatus str. Bath]
 gi|81681783|sp|Q607B4|GLMM_METCA RecName: Full=Phosphoglucosamine mutase
 gi|53757632|gb|AAU91923.1| phosphoglucosamine mutase [Methylococcus capsulatus str. Bath]
          Length = 447

 Score =  414 bits (1065), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 218/444 (49%), Positives = 306/444 (68%), Gaps = 4/444 (0%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           MK+ +FGTDGIRG+   +PITP+FM+++G A G +F  +   RRV+IGKDTR+SGYM E+
Sbjct: 1   MKKEYFGTDGIRGRVGDYPITPDFMLKLGWAAGCVFAREMPGRRVLIGKDTRISGYMFES 60

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +L AGF+AAG+D  +LGP+P+PAVA LTR+LRA  GV+ISASHNPY DNGIK FGPDG K
Sbjct: 61  ALEAGFSAAGVDTQLLGPMPTPAVAYLTRTLRAQAGVVISASHNPYYDNGIKFFGPDGMK 120

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +  ++E  IE  L   +T+ + C   IG A R+     RYIE  K T+P  +   G++IV
Sbjct: 121 LPDELELLIEDYLGRPMTT-VEC-SHIGKATRIVDAAGRYIEFCKSTIPLGMHFSGMKIV 178

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           VDCA+G++Y VAP+VF EL A V  +G  P+G+NIN   G+T+  +L++ V E  AD+GI
Sbjct: 179 VDCAHGSTYHVAPDVFSELRATVSTLGVAPDGLNINDRVGATDPENLRQTVLEENADLGI 238

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           ALDGDGDR+I+VD +G +V+GD+++ +IA    +   L+G+ +V T+MSN+GLE+ I  L
Sbjct: 239 ALDGDGDRLIMVDHRGEVVDGDELLFVIANARHAEGELKGS-VVGTLMSNLGLEQAIRRL 297

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           GL  +R  VGDRY+ME M  +G  +GGE SGHII  D  +TGDG+V+ALQVL  I +  K
Sbjct: 298 GLEFRRAAVGDRYVMEMMLEHGSMLGGEGSGHIICRDRTTTGDGIVSALQVLAEIVRSGK 357

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAI-ADAESELRGIDRLIVRASGTESL 419
            +  +     +YPQ L +V + +   L S  +VQ + A+ E+EL    R+++R SGTE L
Sbjct: 358 TLHELKQGMRKYPQRLVNVRLAERVSLASVPLVQKVKAEVEAELGDSGRVLLRPSGTEPL 417

Query: 420 IRIMAEGDDLSRIKRIVDDLAKVI 443
           IR+M EG D  +++ + D LA  +
Sbjct: 418 IRVMVEGADEGQVRELADRLAGAV 441


>gi|253997065|ref|YP_003049129.1| phosphoglucosamine mutase [Methylotenera mobilis JLW8]
 gi|253983744|gb|ACT48602.1| phosphoglucosamine mutase [Methylotenera mobilis JLW8]
          Length = 451

 Score =  414 bits (1065), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 209/449 (46%), Positives = 298/449 (66%), Gaps = 9/449 (2%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFR------GKKKHRRVVIGKDTRLS 54
           M +++FGTDGIRG+     ITP F+MR+G A G +         K  H  V+IGKDTR+S
Sbjct: 1   MSKKYFGTDGIRGRVGDALITPEFVMRLGYAAGRVLTSIDSHLAKGAHPAVLIGKDTRIS 60

Query: 55  GYMLENSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLF 114
           GYMLE +L AG +AAG+D  + GP+P+P VA LTR+LRA  G++ISASHNPY DNGIK F
Sbjct: 61  GYMLEAALEAGLSAAGVDVLLTGPMPTPGVAYLTRALRAQAGIVISASHNPYYDNGIKFF 120

Query: 115 GPDGYKVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTL 174
              G K+  D+E  IE  L++ +    S    +G A+R+D    RY+E  K T P  + L
Sbjct: 121 SSLGTKLPDDVEHAIEAALDEPMQVMESA--KLGKARRIDDAAGRYVEFCKSTFPNHLDL 178

Query: 175 QGLRIVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEV 234
           +GL+IV+DCA+GA+Y VAP VF ELGA++VVIG+ P+G+NIN   GST+  +LQ  V E 
Sbjct: 179 RGLKIVLDCAHGATYHVAPPVFHELGAEIVVIGNHPDGLNINEQVGSTHPQALQNAVVEH 238

Query: 235 RADIGIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLE 294
           +AD+G+A DGDGDRV++VD  G +++GDQ++ +IA        L+G G+V T+M+N+ LE
Sbjct: 239 QADLGVAFDGDGDRVMMVDHSGRLLDGDQLLYIIAAARQQAGALQG-GVVGTLMTNLALE 297

Query: 295 RFIAGLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRY 354
             +A + +   R +VGDRY++E +  N + +GGE SGHI+  D  S+GDG++AALQVL  
Sbjct: 298 HKLAAMSIPFARAKVGDRYVLELLNQNNWQLGGENSGHILTLDKHSSGDGIIAALQVLHA 357

Query: 355 IKQYDKPVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRAS 414
           + Q  K +S +      YPQ L +V+ K    LN+S I  A+  AE+EL+   R+++RAS
Sbjct: 358 VIQSGKTLSELGADLTLYPQVLINVTTKQKVDLNNSLIKAAVQQAEAELKDSGRVLLRAS 417

Query: 415 GTESLIRIMAEGDDLSRIKRIVDDLAKVI 443
           GTE  IR+M EG++ S++  +   +A V+
Sbjct: 418 GTEPKIRVMVEGENQSQVSTLAQSIADVV 446


>gi|108760574|ref|YP_632525.1| phosphoglucosamine mutase [Myxococcus xanthus DK 1622]
 gi|123247610|sp|Q1D498|GLMM_MYXXD RecName: Full=Phosphoglucosamine mutase
 gi|108464454|gb|ABF89639.1| phosphoglucosamine mutase [Myxococcus xanthus DK 1622]
          Length = 458

 Score =  414 bits (1065), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 208/447 (46%), Positives = 297/447 (66%), Gaps = 6/447 (1%)

Query: 3   RRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSL 62
           ++ FGTDG+RGK+N +P+T    M++G A+ +L R      RV++GKDTRLSGYMLE +L
Sbjct: 10  QKLFGTDGVRGKANVYPMTAEVAMQLGRALAFLIRNGPHRHRVIVGKDTRLSGYMLEQAL 69

Query: 63  VAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVS 122
            +G T+ G+D  ++GP+P+P ++ +T S+RAD G +ISASHNPY+DNGIK F  DG+K+ 
Sbjct: 70  ASGLTSMGVDVELVGPLPTPGISNITTSMRADAGAVISASHNPYEDNGIKFFWRDGFKLP 129

Query: 123 TDIEDRIETLLED-DLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVV 181
            + E +IE L+    + S       IG A R++    RYI  +K T PR++TL+G+ IVV
Sbjct: 130 DETEGKIEELVSSGSIDSIRPTATKIGRAFRMEDARGRYIVFLKATFPRELTLEGMTIVV 189

Query: 182 DCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIA 241
           DCANGA+YK AP V  ELGA V+ +G  P+G NIN  CG+    +L + V +  A +GIA
Sbjct: 190 DCANGAAYKTAPAVLEELGAKVIALGVSPDGKNINHKCGALYPENLAKTVVKHGAHLGIA 249

Query: 242 LDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLG 301
           LDGD DR+I+VDEKG +V+GD IMA+   E ++   L+   +V+TVMSNIGLER +A  G
Sbjct: 250 LDGDADRLIVVDEKGKVVDGDAIMAICTGELVARKQLKKKMLVSTVMSNIGLERAVARWG 309

Query: 302 LSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKP 361
           + + RT VGDRY+++ M+ NG+N+GGEQSGH+I  D+ +TGDG +AALQ+L  + +  KP
Sbjct: 310 VKVARTRVGDRYVVDEMRRNGYNLGGEQSGHLIFLDHTTTGDGTLAALQLLAVMCRAGKP 369

Query: 362 VSTICHCFEEYPQFLRSVSVKDTSILNS-SSIVQAIADAESELRGIDRLIVRASGTESLI 420
           +S +   FE  PQ L +V VK    L    ++++ I   E  L    R++VR SGTE   
Sbjct: 370 LSELASIFEPVPQTLVNVVVKQKKELGELPTVMKVIKSVEQRLGNTGRVLVRFSGTEPKA 429

Query: 421 RIMAEGDDLSR----IKRIVDDLAKVI 443
           R++ EG+D +R     K I D L+K +
Sbjct: 430 RVLIEGEDAARNQAYAKEIADALSKAL 456


>gi|330830893|ref|YP_004393845.1| phosphoglucosamine mutase [Aeromonas veronii B565]
 gi|328806029|gb|AEB51228.1| Phosphoglucosamine mutase [Aeromonas veronii B565]
          Length = 444

 Score =  414 bits (1063), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 205/446 (45%), Positives = 307/446 (68%), Gaps = 9/446 (2%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M R++FGTDG+RGK   +PITP+F+M++G A G +   KK  ++V+IGKDTR+SGYMLE+
Sbjct: 1   MARKYFGTDGVRGKVGEYPITPDFVMKLGWAAGKVLS-KKGTKKVLIGKDTRISGYMLES 59

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +L AG +AAG+ A ++GP+P+PAVA LTR+ RA+ G++ISASHNP+ DNGIK F  DG K
Sbjct: 60  ALEAGLSAAGLKAILMGPMPTPAVAYLTRTFRAEAGIVISASHNPFYDNGIKFFSADGTK 119

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDS--IGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLR 178
           +  D+E  IE  L+ +L     C +S  +G A R+D    RYIE  K T P  + L G++
Sbjct: 120 LPDDVELAIEAELDHEL----QCVESAELGKAVRIDDAAGRYIEFCKSTFPSHMNLDGVK 175

Query: 179 IVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADI 238
           +VVDC +GA+Y +AP VF ELGA+V+ +G  P+G+NIN   GST   +L  KV E +AD+
Sbjct: 176 MVVDCGHGATYHIAPSVFRELGAEVITMGCAPDGLNINDGVGSTAPDALVAKVLECKADL 235

Query: 239 GIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIA 298
           G+A DGDGDR+I+VD  G +++GD+++ +IAR+ + +  L+G G+V T+M+N+GLE  + 
Sbjct: 236 GVAFDGDGDRLIMVDHTGYLIDGDEVLYIIARDALRNGRLKG-GVVGTLMANMGLELALQ 294

Query: 299 GLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQY 358
            LG+   R +VGDRY++E M+  G+ +GGE SGHII  D  +TGDG+VAALQVL  ++  
Sbjct: 295 TLGIPFARAKVGDRYVLEMMEEKGWRIGGENSGHIICLDQTTTGDGIVAALQVLTAMRSA 354

Query: 359 DKPVSTICHCFEEYPQFLRSVSVKD-TSILNSSSIVQAIADAESELRGIDRLIVRASGTE 417
           + P++ +     ++PQ L +V   +    L + +++  +A  E EL G  R+++R SGTE
Sbjct: 355 EMPLAKLRSGMSKFPQVLVNVRFAEGKDPLAADAVMAEVAKVEQELAGRGRVLLRKSGTE 414

Query: 418 SLIRIMAEGDDLSRIKRIVDDLAKVI 443
            LIR+M EG+   +++ +   +AK +
Sbjct: 415 PLIRVMVEGEHEQQVRDMAQRIAKQV 440


>gi|222056501|ref|YP_002538863.1| phosphoglucosamine mutase [Geobacter sp. FRC-32]
 gi|254798580|sp|B9M5K3|GLMM_GEOSF RecName: Full=Phosphoglucosamine mutase
 gi|221565790|gb|ACM21762.1| phosphoglucosamine mutase [Geobacter sp. FRC-32]
          Length = 454

 Score =  414 bits (1063), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 208/443 (46%), Positives = 296/443 (66%), Gaps = 2/443 (0%)

Query: 3   RRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSL 62
           ++ FGTDG+RG +N +P+T    M+IG A  ++FR  K   R+VIGKDTRLSGYM+EN+L
Sbjct: 2   KKLFGTDGVRGVANVYPMTTEMAMQIGRAAAHIFRNGKSRHRIVIGKDTRLSGYMIENAL 61

Query: 63  VAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVS 122
           VAG  + G+D   +GP+P+P +A +T S+RAD GV+ISASHNP+QDNGIK F  DG+K+ 
Sbjct: 62  VAGICSMGVDVLQVGPLPTPGIANITSSMRADAGVVISASHNPFQDNGIKFFCRDGFKLP 121

Query: 123 TDIEDRIETLL-EDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVV 181
            ++E RIE L+   D+ S     + +G A R+D    R++  +K T P+D+ L GL+IV+
Sbjct: 122 DEMELRIEELIFSGDMDSMRPIANEVGKAYRIDDAAGRFVVFLKSTFPKDMDLSGLKIVL 181

Query: 182 DCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIA 241
           DCANGA+YKVAP VF ELGA+V+ IG KPNG NIN  CGS +   +   V E  AD+GIA
Sbjct: 182 DCANGAAYKVAPAVFEELGAEVIAIGVKPNGTNINAGCGSLHPEVISAAVKEHGADLGIA 241

Query: 242 LDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLG 301
           LDGD DRVI VDE G  VNGD IMA+ A + +    L    +V TVMSN+GL+  +   G
Sbjct: 242 LDGDADRVIFVDEFGNEVNGDNIMAICATDMLQKGTLNKQTLVATVMSNMGLDIAVKRAG 301

Query: 302 LSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKP 361
             + +T VGDRY++E M+  G+N+GGEQSGH+I  D+ +TGDG+++ALQVL  +++  K 
Sbjct: 302 GRVIKTAVGDRYVVEEMQKGGYNLGGEQSGHMIFLDHNTTGDGILSALQVLAVMQRQGKR 361

Query: 362 VSTICHCFEEYPQFLRSVSVKDT-SILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
           +S +       PQ L +V V +   ++   ++   I D E++++   R+++R SGTE L+
Sbjct: 362 LSELAEVMFALPQVLVNVRVAEKRDVMTIPAVAGLIGDIEAKVKDEGRILIRYSGTEPLL 421

Query: 421 RIMAEGDDLSRIKRIVDDLAKVI 443
           RIM EG D  +I     ++A ++
Sbjct: 422 RIMLEGQDKYQISGWAKEIADLV 444


>gi|298505917|gb|ADI84640.1| phosphoglucosamine mutase [Geobacter sulfurreducens KN400]
          Length = 451

 Score =  413 bits (1061), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 210/443 (47%), Positives = 292/443 (65%), Gaps = 2/443 (0%)

Query: 3   RRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSL 62
           ++ FGTDG+RG +N +P+T    M+IG A  YLF+   +  R+VIGKDTRLSGYMLEN+L
Sbjct: 2   KKLFGTDGVRGVANVYPMTTEMAMQIGRAAAYLFKDGNRRHRIVIGKDTRLSGYMLENAL 61

Query: 63  VAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVS 122
           VAG  + G+D  ++GP+P+P +A +T S+RAD GV+ISASHNP+QDNGIK F  DG+K+ 
Sbjct: 62  VAGICSMGVDVLVVGPLPTPGIANITSSMRADAGVVISASHNPFQDNGIKFFSRDGFKLP 121

Query: 123 TDIEDRIETLL-EDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVV 181
            ++E +IE L+    + S       +G A R+D    RY+  +K + P+D+ L G++IV+
Sbjct: 122 DEMELKIEDLIFSGKIDSLRPVATEVGKAYRIDDAVGRYVVFLKNSFPKDLDLAGMKIVL 181

Query: 182 DCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIA 241
           DCANGA+YKVAP V  ELGA+V+  G KPNG NIN  CGS     +   V E RAD+GIA
Sbjct: 182 DCANGAAYKVAPAVLEELGAEVIPYGVKPNGTNINAGCGSLYPQVISEAVKEHRADLGIA 241

Query: 242 LDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLG 301
           LDGD DRVI VDE G  V+GD IMA+ A + +    LR N +V TVMSN+GL+  +   G
Sbjct: 242 LDGDADRVIFVDEFGNEVDGDHIMAICATQMLKQKKLRKNTLVATVMSNMGLDIAVKRAG 301

Query: 302 LSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKP 361
             + +T VGDRY++E M   G+N+GGEQSGH+I  D+ +TGDG+++ALQVL  +++ DK 
Sbjct: 302 GKVVKTAVGDRYVVEEMIKGGYNLGGEQSGHMIFLDHNTTGDGVLSALQVLATMRRADKS 361

Query: 362 VSTICHCFEEYPQFLRSVSVKDTS-ILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
           +S +       PQ L +V VK+   I     +   I D E +L    R+++R SGTE L+
Sbjct: 362 LSELAEVMIPLPQVLVNVRVKEKKDITTIPEVALLIGDIEKKLGDEGRILIRYSGTEPLL 421

Query: 421 RIMAEGDDLSRIKRIVDDLAKVI 443
           RIM EG D  +I     ++A ++
Sbjct: 422 RIMLEGQDKYQITGWAKEIADLV 444


>gi|149375760|ref|ZP_01893528.1| phosphoglucosamine mutase [Marinobacter algicola DG893]
 gi|149359885|gb|EDM48341.1| phosphoglucosamine mutase [Marinobacter algicola DG893]
          Length = 447

 Score =  412 bits (1060), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 209/442 (47%), Positives = 308/442 (69%), Gaps = 4/442 (0%)

Query: 3   RRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSL 62
           R++FGTDGIRG+   +PITP FM+R+G A G  F+   +   V+IGKDTRLSGYM E++L
Sbjct: 4   RKYFGTDGIRGRVGEYPITPEFMLRLGWAAGQAFKQDGQRNSVLIGKDTRLSGYMFESAL 63

Query: 63  VAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVS 122
            AG +AAG+D  +LGP+P+PA+A LTR+ RA  G++ISASHNP+ DNGIK F P G K+ 
Sbjct: 64  EAGLSAAGVDVKLLGPMPTPAIAYLTRTFRASAGIVISASHNPHHDNGIKFFSPAGTKLD 123

Query: 123 TDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVVD 182
             +E  IE  L+  +   +     +G A RVD    RY+E  K T+P + +L+GL IV+D
Sbjct: 124 DALETEIEKWLDKPIE--VCGSKELGKAFRVDDAPGRYVEFCKSTVPNEFSLEGLHIVLD 181

Query: 183 CANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIAL 242
           CA+GA+Y VAP+VF ELGA + V+G +P+G+NINL+ GST++ SL R V E +AD+GIA 
Sbjct: 182 CAHGATYHVAPKVFRELGAKISVVGGEPDGLNINLNVGSTHMESLSRAVLEKQADLGIAF 241

Query: 243 DGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLGL 302
           DGDGDRV++VD  G+ V+GD+++ +IA +  +   L+G G+V T+M+N+G+E  +   G+
Sbjct: 242 DGDGDRVLMVDRDGSEVDGDELLYVIAAQRHAAGTLKG-GVVGTLMTNLGVELALREQGI 300

Query: 303 SLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKPV 362
             +R +VGDRY+ME + + G+ +GGE SGH+++ D  STGDG+V+ALQVL  I++    +
Sbjct: 301 DFERAKVGDRYVMERLIDRGWLLGGEGSGHMVIRDCTSTGDGIVSALQVLLAIRRSGSSL 360

Query: 363 STICHCFEEYPQFLRSVSV-KDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLIR 421
           + +     + PQ + +V V +    L    IV+A+  AE++L G  R+++RASGTE LIR
Sbjct: 361 ADLRQGMSKLPQKMINVRVDQRFDPLGREDIVRAVESAEAKLGGGGRVLLRASGTEPLIR 420

Query: 422 IMAEGDDLSRIKRIVDDLAKVI 443
           +M EG D ++I +I ++LA V+
Sbjct: 421 VMTEGQDETQIVKIAEELAVVV 442


>gi|189425582|ref|YP_001952759.1| phosphoglucosamine mutase [Geobacter lovleyi SZ]
 gi|226722753|sp|B3E692|GLMM_GEOLS RecName: Full=Phosphoglucosamine mutase
 gi|189421841|gb|ACD96239.1| phosphoglucosamine mutase [Geobacter lovleyi SZ]
          Length = 452

 Score =  412 bits (1058), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 208/444 (46%), Positives = 298/444 (67%), Gaps = 3/444 (0%)

Query: 3   RRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHR-RVVIGKDTRLSGYMLENS 61
           ++ FGTDG+RG +N  P+T    M++G A  Y+F+   + R R+VIGKDTRLSGYMLE++
Sbjct: 2   KKLFGTDGVRGVANIHPMTTETAMQLGRAAAYIFKSSSRRRHRIVIGKDTRLSGYMLESA 61

Query: 62  LVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKV 121
           LVAG  + G+D  ++GP+P+P +A +T+S+RAD GV+ISASHNP+QDNGIK F  DG+K+
Sbjct: 62  LVAGICSMGVDVLLVGPLPTPGIANITKSMRADAGVVISASHNPFQDNGIKFFSGDGFKL 121

Query: 122 STDIEDRIETLLEDDLTSYL-SCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
             +IE ++E LL+      L      +G A R+D    RYI  +K + P ++ L GL+IV
Sbjct: 122 PDEIELKMEKLLDSKKIEALRPTATEVGKAFRIDDAAGRYIVFLKNSFPPELDLAGLKIV 181

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           +DC NGA+YKVAP VF ELGA+V+ +G KPNG NIN  CGS +   +   V + RADIGI
Sbjct: 182 LDCGNGAAYKVAPAVFEELGAEVIPLGVKPNGTNINAGCGSLHPEVISEAVKQHRADIGI 241

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           ALDGD DRVI+ DE G  VNGDQIMA+ A + ++   L+   +V TVMSN+GL+  +  +
Sbjct: 242 ALDGDADRVIVCDEFGNEVNGDQIMAICATDMIARKQLKKKTLVATVMSNMGLDIALRKV 301

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           G  + +T VGDRY++E M+  G+N+GGEQSGH+I  D  +TGDG++AALQ+L  +++ +K
Sbjct: 302 GGKIIKTAVGDRYVVEEMRKGGYNLGGEQSGHLIFLDNNTTGDGVLAALQLLAVMRRREK 361

Query: 361 PVSTICHCFEEYPQFLRSVSVKD-TSILNSSSIVQAIADAESELRGIDRLIVRASGTESL 419
           P+S +       PQ L +V V++   I+    +  AI   E +L    R+++R SGTE L
Sbjct: 362 PLSELAEVMIPLPQVLVNVRVRERQDIMTIPPVAVAIKGVEEKLGNEGRVLIRYSGTEPL 421

Query: 420 IRIMAEGDDLSRIKRIVDDLAKVI 443
           +RIM EG D   I    +++A ++
Sbjct: 422 LRIMLEGQDKYEITGWANEIADLV 445


>gi|39996904|ref|NP_952855.1| phosphoglucosamine mutase [Geobacter sulfurreducens PCA]
 gi|81702219|sp|Q74C70|GLMM_GEOSL RecName: Full=Phosphoglucosamine mutase
 gi|39983792|gb|AAR35182.1| phosphoglucosamine mutase [Geobacter sulfurreducens PCA]
          Length = 451

 Score =  411 bits (1057), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 210/443 (47%), Positives = 291/443 (65%), Gaps = 2/443 (0%)

Query: 3   RRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSL 62
           ++ FGTDG+RG +N +P+T    M+IG A  YLF+   +  R+VIGKDTRLSGYMLEN+L
Sbjct: 2   KKLFGTDGVRGVANVYPMTTEMAMQIGRAAAYLFKDGNRRHRIVIGKDTRLSGYMLENAL 61

Query: 63  VAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVS 122
           VAG  + G+D  ++GP+P+P +A +T S+RAD GV+ISASHNP+QDNGIK F  DG+K+ 
Sbjct: 62  VAGICSMGVDVLVVGPLPTPGIANITSSMRADAGVVISASHNPFQDNGIKFFSRDGFKLP 121

Query: 123 TDIEDRIETLL-EDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVV 181
            ++E +IE L+    + S       +G A R+D    RY+  +K + P+D+ L G++IV+
Sbjct: 122 DEMELKIEDLIFSGKIDSLRPVATEVGKAYRIDDAVGRYVVFLKNSFPKDLDLAGMKIVL 181

Query: 182 DCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIA 241
           DCANGA+YKVAP V  ELGA+V+  G KPNG NIN  CGS     +   V E RAD+GIA
Sbjct: 182 DCANGAAYKVAPAVLEELGAEVIPYGVKPNGTNINAGCGSLYPQVISEAVKEHRADLGIA 241

Query: 242 LDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLG 301
           LDGD DRVI VDE G  V+GD IMA+ A + +    LR N +V TVMSN+GL+  +   G
Sbjct: 242 LDGDADRVIFVDEFGNEVDGDHIMAICATQMLKQKKLRKNTLVATVMSNMGLDIAVKRAG 301

Query: 302 LSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKP 361
             + +T VGDRY++E M   G+N+GGEQSGH+I  D  +TGDG+++ALQVL  +++ DK 
Sbjct: 302 GKVVKTAVGDRYVVEEMIKGGYNLGGEQSGHMIFLDPNTTGDGVLSALQVLATMRRADKS 361

Query: 362 VSTICHCFEEYPQFLRSVSVKDTS-ILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
           +S +       PQ L +V VK+   I     +   I D E +L    R+++R SGTE L+
Sbjct: 362 LSELAEVMIPLPQVLVNVRVKEKKDITTIPEVALLIGDIEKKLGDEGRILIRYSGTEPLL 421

Query: 421 RIMAEGDDLSRIKRIVDDLAKVI 443
           RIM EG D  +I     ++A ++
Sbjct: 422 RIMLEGQDKYQITGWAKEIADLV 444


>gi|328952043|ref|YP_004369377.1| phosphoglucosamine mutase [Desulfobacca acetoxidans DSM 11109]
 gi|328452367|gb|AEB08196.1| phosphoglucosamine mutase [Desulfobacca acetoxidans DSM 11109]
          Length = 452

 Score =  411 bits (1056), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 205/443 (46%), Positives = 295/443 (66%), Gaps = 2/443 (0%)

Query: 3   RRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSL 62
           R+ FGTDGIRG +N +P+T +  +++G  + Y+ +   +  R+V+GKDTRLSGY+LE ++
Sbjct: 2   RKLFGTDGIRGVANEYPMTADVALKLGNVIAYVVKNGARRHRIVVGKDTRLSGYILEYAI 61

Query: 63  VAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVS 122
            AG  + G+D  ++GP+P+P +A +T S+RAD GV+ISASHNPYQDNGIK F  +G K+ 
Sbjct: 62  TAGICSMGVDVMLVGPMPTPGIAFITSSMRADAGVVISASHNPYQDNGIKFFSHEGLKLP 121

Query: 123 TDIEDRIETL-LEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVV 181
            ++E R+E L L  +L S+      +G A R+D    RY  ++K TLP+++  +G +IV+
Sbjct: 122 DEMEVRMEELMLNPELGSHCPTATGVGQALRIDDASGRYNSYLKSTLPKNLDFKGFKIVL 181

Query: 182 DCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIA 241
           DCA+GA+YKVAP V  ELGA+V+  G +PNG NIN  CGST   ++Q  V    ADIGIA
Sbjct: 182 DCAHGAAYKVAPAVLQELGAEVIPFGVRPNGKNINRQCGSTYPATIQSLVRRHDADIGIA 241

Query: 242 LDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLG 301
           LDGDGDRVI VD +G IV+GD IMA+ +        LR   +V TVMSN+GLE  +  +G
Sbjct: 242 LDGDGDRVICVDHQGNIVDGDHIMAICSHHLHEKGDLRKKTLVATVMSNMGLEIALKKMG 301

Query: 302 LSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKP 361
             L RT+VGDRY++E M   G+N+GGEQSGHII  D+ +TGDG ++ALQ+L  +    + 
Sbjct: 302 CRLIRTQVGDRYVIERMLQGGYNLGGEQSGHIIFWDHSTTGDGTLSALQLLAIMHSTGRS 361

Query: 362 VSTICHCFEEYPQFLRSVSVKDTSILNS-SSIVQAIADAESELRGIDRLIVRASGTESLI 420
           ++ +    E YPQ L +V V++   L+    I Q I  AE +L    RL++R SGTE+ +
Sbjct: 362 LADLAKIMEVYPQALLNVRVREKKDLSQIPPIYQGIRAAEEKLGDRGRLLIRYSGTEAKL 421

Query: 421 RIMAEGDDLSRIKRIVDDLAKVI 443
           R+M EG+D   ++ I  ++A +I
Sbjct: 422 RVMCEGEDPEEVEAIAQEIADLI 444


>gi|297568424|ref|YP_003689768.1| phosphoglucosamine mutase [Desulfurivibrio alkaliphilus AHT2]
 gi|296924339|gb|ADH85149.1| phosphoglucosamine mutase [Desulfurivibrio alkaliphilus AHT2]
          Length = 449

 Score =  410 bits (1055), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 204/443 (46%), Positives = 291/443 (65%), Gaps = 2/443 (0%)

Query: 3   RRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSL 62
           RR FGTDGIRG +N +P+T    M++G  + +L + +    R+VIGKDTRLSGYM+EN+L
Sbjct: 2   RRLFGTDGIRGMANLYPMTTEIAMQVGRGLAFLVKQQSHRHRIVIGKDTRLSGYMIENAL 61

Query: 63  VAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVS 122
            AG  + G+D  ++GP+P+P +A +T S+RAD GV+ISASHNP+ DNGIK+F  DGYK+ 
Sbjct: 62  AAGICSMGVDILLVGPLPTPGIAFITTSMRADAGVVISASHNPFADNGIKIFAADGYKLP 121

Query: 123 TDIEDRIETLL-EDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVV 181
              E  IE L+    + +     + +G A R+D    RYI ++K   P D++L  L IV+
Sbjct: 122 DAEELAIEDLIFSQKMAALRPTAEEVGRATRIDDARGRYIVYLKNAFPADLSLDDLHIVL 181

Query: 182 DCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIA 241
           DCANGA Y VAP VF ELGA V  IG +P+G NIN +CG+     +  KV E  ADIG+A
Sbjct: 182 DCANGAGYGVAPHVFSELGAKVTTIGAEPDGTNINRECGALCPEIMAAKVRETGADIGLA 241

Query: 242 LDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLG 301
           LDGD DR+++ DE G I+NGDQIMA+ A + ++   LR   +V TVMSN+GLE F+   G
Sbjct: 242 LDGDADRLMVADETGTILNGDQIMAICAADLLAEKRLRHKTLVATVMSNLGLEHFMRAHG 301

Query: 302 LSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKP 361
             L+RT VGDRY++E M+  G+N GGEQSGH+I  D+ +TGDG++AAL++L  + + +K 
Sbjct: 302 GRLERTPVGDRYVVERMRTKGYNFGGEQSGHLIFLDHNTTGDGILAALRLLAVMLKQNKR 361

Query: 362 VSTICHCFEEYPQFLRSVSVKDTSILNS-SSIVQAIADAESELRGIDRLIVRASGTESLI 420
           +S +       PQ L +V ++  +  +    + + +  AE+EL    R+++R SGTE LI
Sbjct: 362 LSELAGLMTAVPQVLENVRLERPAAPDKIKGLKKLVNAAEAELGREGRILIRPSGTEPLI 421

Query: 421 RIMAEGDDLSRIKRIVDDLAKVI 443
           R+M EG D +RI  I  ++ + I
Sbjct: 422 RVMVEGADQARIGMIAKEICEHI 444


>gi|149192457|ref|ZP_01870650.1| phosphomannomutase [Vibrio shilonii AK1]
 gi|148833708|gb|EDL50752.1| phosphomannomutase [Vibrio shilonii AK1]
          Length = 445

 Score =  410 bits (1055), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 210/445 (47%), Positives = 305/445 (68%), Gaps = 13/445 (2%)

Query: 2   KRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENS 61
           +RR+FGTDGIRGK   FPITP+F++++G A G +   K+  ++V+IGKDTR+SGYMLE++
Sbjct: 3   QRRYFGTDGIRGKVGQFPITPDFVLKLGWAAGRVL-AKQGTKKVIIGKDTRISGYMLESA 61

Query: 62  LVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKV 121
           L AG +AAG+ A   GP+P+PAVA LT++ RA+ G++ISASHNPY DNGIK F  +G   
Sbjct: 62  LEAGLSAAGLKAIFTGPLPTPAVAYLTQTFRAEAGIVISASHNPYYDNGIKFFSSEG--- 118

Query: 122 STDIEDRIETLLEDDLTSYLSCYDS--IGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRI 179
            T + D IE  +E++L   + C +S  +G A R++    RYIE  K T P D++L GL+I
Sbjct: 119 -TKLPDAIELAIEEELDKDIECVESAELGKASRLNDAAGRYIEFCKSTFPHDLSLAGLKI 177

Query: 180 VVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIG 239
           V+DCA+GA+YK+AP VF ELGAD++ +G +PNG NIN + G+T+V +LQ +V   +ADIG
Sbjct: 178 VLDCAHGATYKIAPSVFAELGADIITMGVEPNGTNINHEVGATDVRALQARVVAEKADIG 237

Query: 240 IALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAG 299
           +A DGDGDR+I+VD  G  V+GDQI  +IAR+ +    L+G G+V T+M+N+G+E  +  
Sbjct: 238 LAFDGDGDRIIMVDHLGNKVDGDQIAYIIARDALRRGELKG-GVVGTLMTNLGMENGLKQ 296

Query: 300 LGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYD 359
           LG+   R  VGDRY+ME +   G+ +G E SGH+IL D  +TGD +VAALQVL  I    
Sbjct: 297 LGIPFVRAAVGDRYVMEQLLEKGWRIGAENSGHVILLDKVTTGDAIVAALQVLASIVGAK 356

Query: 360 KPVSTICHCFEEYPQFLRSVSVK-DTSILNSSSIVQAIADAESELRGIDRLIVRASGTES 418
             ++ +      YPQ L +V    D + L + +++ A+  AE++L    R+++R SGTE 
Sbjct: 357 MSLNELASGMMLYPQVLINVRFSGDANPLEADAVIAAVKKAEADLGDKGRVLLRKSGTEP 416

Query: 419 LIRIMAEGDDLSRIKRIVDDLAKVI 443
           L+R+M EG+D    + +V+D A+ I
Sbjct: 417 LLRVMVEGED----ETLVNDSAQYI 437


>gi|26991399|ref|NP_746824.1| phosphoglucosamine mutase [Pseudomonas putida KT2440]
 gi|81585931|sp|Q88DV3|GLMM_PSEPK RecName: Full=Phosphoglucosamine mutase
 gi|24986468|gb|AAN70288.1|AE016669_6 phosphoglucosamine mutase [Pseudomonas putida KT2440]
          Length = 446

 Score =  410 bits (1053), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 205/445 (46%), Positives = 301/445 (67%), Gaps = 6/445 (1%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M R++FGTDGIRG+   +PITP+FM+++G A G  FR K+ H RV++GKDTR+SGYM E+
Sbjct: 1   MSRKYFGTDGIRGRVGEYPITPDFMLKLGWAAGMAFR-KQGHCRVLVGKDTRISGYMFES 59

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +L AG +AAG D  +LGP+P+PA+A LTR+  A+ G++ISASHNP+ DNGIK F   G K
Sbjct: 60  ALEAGLSAAGADVMLLGPMPTPAIAYLTRTFHAEAGIVISASHNPHDDNGIKFFSGQGTK 119

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +  ++E  IE LL+  +T   S    +G   R++    RYIE  K ++P   + +GL++V
Sbjct: 120 LPDEVELMIEELLDQPMTVVES--GKLGKVSRINDAAGRYIEFCKSSVPSSTSFEGLKLV 177

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           VDCA+GA+YKVAP VF ELGADV V+  +P+G+NIN  CGST++ SLQ  V    AD+GI
Sbjct: 178 VDCAHGATYKVAPSVFRELGADVTVLHAQPDGLNINEGCGSTHIESLQAAVLVGHADLGI 237

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           A DGDGDRV++VD  GAIV+GD+++ +IAR+   H  L+G G+V T+MSN+GLE  +  L
Sbjct: 238 AFDGDGDRVLMVDHTGAIVDGDELLFIIARDLQEHGKLQG-GVVGTLMSNLGLELALKDL 296

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
            +   R +VGDRY+M  +    + VGGE SGH++  ++ +TGD ++AALQVL  +K+  +
Sbjct: 297 DIPFVRAKVGDRYVMAELLEREWLVGGENSGHVVCCNHTTTGDAIIAALQVLMALKRRGE 356

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTSI--LNSSSIVQAIADAESELRGIDRLIVRASGTES 418
            ++       + PQ L +V    + +  L   ++ +A A     L G  R+++R SGTE 
Sbjct: 357 TLAQARQALRKCPQVLINVRFGASKVDPLEHPAVKEASAKVTEALAGRGRVLLRKSGTEP 416

Query: 419 LIRIMAEGDDLSRIKRIVDDLAKVI 443
           L+R+M EG+D S+++   + LAK++
Sbjct: 417 LVRVMVEGEDESQVRAHAEALAKLV 441


>gi|148549784|ref|YP_001269886.1| phosphoglucosamine mutase [Pseudomonas putida F1]
 gi|166990422|sp|A5W992|GLMM_PSEP1 RecName: Full=Phosphoglucosamine mutase
 gi|148513842|gb|ABQ80702.1| phosphoglucosamine mutase [Pseudomonas putida F1]
          Length = 446

 Score =  409 bits (1052), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 205/445 (46%), Positives = 301/445 (67%), Gaps = 6/445 (1%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M R++FGTDGIRG+   +PITP+FM+++G A G  FR K+ H RV++GKDTR+SGYM E+
Sbjct: 1   MSRKYFGTDGIRGRVGEYPITPDFMLKLGWAAGMAFR-KQGHCRVLVGKDTRISGYMFES 59

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +L AG +AAG D  +LGP+P+PA+A LTR+  A+ G++ISASHNP+ DNGIK F   G K
Sbjct: 60  ALEAGLSAAGADVMLLGPMPTPAIAYLTRTFHAEAGIVISASHNPHDDNGIKFFSGQGTK 119

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +  ++E  IE LL+  +T   S    +G   R++    RYIE  K ++P   + +GL++V
Sbjct: 120 LPDEVELMIEELLDQPMTVIES--GKLGKVSRINDAAGRYIEFCKSSVPSSTSFEGLKLV 177

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           VDCA+GA+YKVAP VF ELGADV V+  +P+G+NIN  CGST++ SLQ  V    AD+GI
Sbjct: 178 VDCAHGATYKVAPSVFRELGADVTVLHAQPDGLNINEGCGSTHIESLQAAVLVGHADLGI 237

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           A DGDGDRV++VD  GAIV+GD+++ +IAR+   H  L+G G+V T+MSN+GLE  +  L
Sbjct: 238 AFDGDGDRVLMVDHTGAIVDGDELLFIIARDLQEHGKLQG-GVVGTLMSNLGLELALKDL 296

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
            +   R +VGDRY+M  +    + VGGE SGH++  ++ +TGD ++AALQVL  +K+  +
Sbjct: 297 DIPFVRAKVGDRYVMAELLEREWLVGGENSGHVVCCNHTTTGDAIIAALQVLMALKRRGE 356

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTSI--LNSSSIVQAIADAESELRGIDRLIVRASGTES 418
            ++       + PQ L +V    + +  L   ++ +A A     L G  R+++R SGTE 
Sbjct: 357 TLAQARQALRKCPQVLINVRFGASKVDPLEHPAVKEASAKVTDALAGRGRVLLRKSGTEP 416

Query: 419 LIRIMAEGDDLSRIKRIVDDLAKVI 443
           L+R+M EG+D S+++   + LAK++
Sbjct: 417 LVRVMVEGEDESQVRAHAEALAKLV 441


>gi|160872374|ref|ZP_02062506.1| phosphoglucosamine mutase [Rickettsiella grylli]
 gi|159121173|gb|EDP46511.1| phosphoglucosamine mutase [Rickettsiella grylli]
          Length = 447

 Score =  409 bits (1051), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 210/443 (47%), Positives = 296/443 (66%), Gaps = 6/443 (1%)

Query: 5   FFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSLVA 64
           +FGTDGIRGK   +PITP F++++G AVG +        +V+IGKDTRLSGYMLE++L A
Sbjct: 8   YFGTDGIRGKVGEYPITPEFILKLGWAVGKVL--DNGQNKVLIGKDTRLSGYMLESALEA 65

Query: 65  GFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVSTD 124
           G +AAG+D  +LGPIP+PA+A LT  L A  G++ISASHNPY DNGIK F  DG K++ +
Sbjct: 66  GLSAAGIDIHLLGPIPTPAIAFLTSDLGAQAGIVISASHNPYYDNGIKFFSHDGTKLADN 125

Query: 125 IEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVVDCA 184
           IE +IET L     +  S    +G A RV+    RY+   K TLP    L GL+IV+DCA
Sbjct: 126 IESQIETYLTRPFQTVNSA--KLGKAVRVEDAKIRYVNFCKSTLPPSFHLNGLKIVLDCA 183

Query: 185 NGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIALDG 244
           NG++Y +AP +F  LGA + ++G  PNG+NIN +CGST++ +LQ+ V E +AD+GIA DG
Sbjct: 184 NGSTYHIAPSLFSGLGAHLTLLGTAPNGLNINKNCGSTHLETLQKTVLEKKADLGIAFDG 243

Query: 245 DGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLGLSL 304
           DGDRV++VD  G IV+GD+I+ L+ +  +    + G GIV T MSN+GLE     LGL  
Sbjct: 244 DGDRVLMVDYLGEIVDGDEILFLLTQHGLKKGYITG-GIVGTTMSNLGLELATKKLGLDF 302

Query: 305 KRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKPVST 364
            RT VGDRY+ E ++   + +GGE SGHII   +  TGDG++ ALQVL  ++  + P+  
Sbjct: 303 IRTAVGDRYVNETLQQKNWQLGGEPSGHIISRRFTKTGDGIIIALQVLEALQLAEIPLHI 362

Query: 365 ICHCFEEYPQFLRSVSVKDT-SILNSSSIVQAIADAESELRGIDRLIVRASGTESLIRIM 423
                +++PQ L +V  ++  +I+N+S + +AI     +LR   RL+VR SGTES++RIM
Sbjct: 363 AKKSMKKFPQVLINVPAENPLAIMNASPLKKAIKKTTLQLRNHGRLLVRPSGTESVVRIM 422

Query: 424 AEGDDLSRIKRIVDDLAKVIPMI 446
            EG +LS ++ I   LAK + ++
Sbjct: 423 VEGIELSEVQSIALKLAKTVQIL 445


>gi|119774093|ref|YP_926833.1| phosphoglucosamine mutase [Shewanella amazonensis SB2B]
 gi|158705789|sp|A1S457|GLMM1_SHEAM RecName: Full=Phosphoglucosamine mutase 1
 gi|119766593|gb|ABL99163.1| phosphoglucosamine mutase [Shewanella amazonensis SB2B]
          Length = 445

 Score =  409 bits (1051), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 205/445 (46%), Positives = 306/445 (68%), Gaps = 9/445 (2%)

Query: 2   KRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENS 61
           +R+FFGTDGIRGK     +TP   +++G A G +   +   ++V+IGKDTR+SGYM E++
Sbjct: 3   QRKFFGTDGIRGKVGADQMTPELALKLGWAAGRVL-ARTGTKKVIIGKDTRISGYMFESA 61

Query: 62  LVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKV 121
           L AGF++AG++  ++GP+P+PAVA LTR+ RA+ GV+ISASHNPY DNGIK F  DG K 
Sbjct: 62  LEAGFSSAGLNVLLMGPMPTPAVAYLTRTFRAEAGVVISASHNPYYDNGIKFFSNDGSK- 120

Query: 122 STDIEDRIETLLEDDLTSYLSCYDS--IGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRI 179
              ++D IE  +E +L   L C +S  +G   R+D    RYIE+ K   P D TL GL+I
Sbjct: 121 ---LDDEIELAIEAELEKPLICAESQFLGKVSRIDDARGRYIEYCKGNFPADQTLSGLKI 177

Query: 180 VVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIG 239
           VVDCA+GA+Y +AP VF ELGA+VV IG +PNG+NIN  CG+T++ +++ KV EV AD+G
Sbjct: 178 VVDCAHGATYHIAPAVFRELGAEVVAIGVEPNGMNINDKCGATSMGAIRDKVLEVNADLG 237

Query: 240 IALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAG 299
           IALDGDGDR+++V ++G I++GDQI+ ++A +     LL+G G+V T M+N+GLE  +  
Sbjct: 238 IALDGDGDRIMMVTQEGDIIDGDQILYILALDAKERGLLKG-GVVGTQMANLGLELALKD 296

Query: 300 LGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYD 359
            G+   R++VGDRY+ME +K  G+ +GGE SGHI+  D+G+TGDG+VA + VL  +++  
Sbjct: 297 EGIPFARSKVGDRYVMELLKELGWRIGGENSGHILNLDHGTTGDGIVAGILVLAAMRRSG 356

Query: 360 KPVSTICHCFEEYPQFLRSVSVK-DTSILNSSSIVQAIADAESELRGIDRLIVRASGTES 418
           K +  +    + +PQ L +V  + D + L + ++   +A+ E EL    R+++R SGTE 
Sbjct: 357 KGLQQLIAKLKMFPQVLVNVRFEGDKNPLEADTVTAKVAEVERELGERGRVLLRKSGTEP 416

Query: 419 LIRIMAEGDDLSRIKRIVDDLAKVI 443
           L+R+M EG+D   + R+ + +A  +
Sbjct: 417 LLRVMVEGEDKETVTRLANAIADAV 441


>gi|313500625|gb|ADR61991.1| GlmM [Pseudomonas putida BIRD-1]
          Length = 446

 Score =  409 bits (1050), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 205/445 (46%), Positives = 300/445 (67%), Gaps = 6/445 (1%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M R++FGTDGIRG+   +PITP+FM+++G A G  FR K+ H RV++GKDTR+SGYM E+
Sbjct: 1   MSRKYFGTDGIRGRVGEYPITPDFMLKLGWAAGMAFR-KQGHCRVLVGKDTRISGYMFES 59

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +L AG +AAG D  +LGP+P+PA+A LTR+  A+ G++ISASHNP+ DNGIK F   G K
Sbjct: 60  ALEAGLSAAGADVMLLGPMPTPAIAYLTRTFHAEAGIVISASHNPHDDNGIKFFSGQGTK 119

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +  ++E  IE LL+  +T   S    +G   R++    RYIE  K ++P   +  GL++V
Sbjct: 120 LPDEVELMIEELLDQPMTVVES--GKLGKVSRINDAAGRYIEFCKSSVPSSTSFDGLKLV 177

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           VDCA+GA+YKVAP VF ELGADV V+  +P+G+NIN  CGST++ SLQ  V    AD+GI
Sbjct: 178 VDCAHGATYKVAPSVFRELGADVTVLHAQPDGLNINEGCGSTHIESLQAAVLVGHADLGI 237

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           A DGDGDRV++VD  GAIV+GD+++ +IAR+   H  L+G G+V T+MSN+GLE  +  L
Sbjct: 238 AFDGDGDRVLMVDHTGAIVDGDELLFIIARDLQEHGKLQG-GVVGTLMSNLGLELALKDL 296

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
            +   R +VGDRY+M  +    + VGGE SGH++  ++ +TGD ++AALQVL  +K+  +
Sbjct: 297 DIPFVRAKVGDRYVMAELLEREWLVGGENSGHVVCCNHTTTGDAIIAALQVLMALKRRGE 356

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTSI--LNSSSIVQAIADAESELRGIDRLIVRASGTES 418
            ++       + PQ L +V    + +  L   ++ +A A     L G  R+++R SGTE 
Sbjct: 357 TLAQARQALRKCPQVLINVRFGASKVDPLEHPAVKEASAKVTEALAGRGRVLLRKSGTEP 416

Query: 419 LIRIMAEGDDLSRIKRIVDDLAKVI 443
           L+R+M EG+D S+++   + LAK++
Sbjct: 417 LVRVMVEGEDESQVRAHAEALAKLV 441


>gi|327399774|ref|YP_004340643.1| phosphoglucosamine mutase [Hippea maritima DSM 10411]
 gi|327182403|gb|AEA34584.1| phosphoglucosamine mutase [Hippea maritima DSM 10411]
          Length = 452

 Score =  409 bits (1050), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 208/425 (48%), Positives = 292/425 (68%), Gaps = 3/425 (0%)

Query: 4   RFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKK-KHRRVVIGKDTRLSGYMLENSL 62
           + FGTDGIRGK+NT+P+  +   ++G A+ Y   GK  + R+++IGKDTRLSGYMLE+++
Sbjct: 2   KLFGTDGIRGKANTYPMVGDVAYKLGKALVYALDGKTDRKRKIIIGKDTRLSGYMLESAI 61

Query: 63  VAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVS 122
            +G  + G DA+++GP+P+PA+A L RS+R D GV+ISASHNPY DNGIK+F  DG K+ 
Sbjct: 62  TSGVVSMGADAYLVGPMPTPAIAFLVRSMRGDAGVVISASHNPYDDNGIKIFSKDGLKLD 121

Query: 123 TDIEDRIETL-LEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVV 181
             +ED IE L L D L +  +  D IG A R+     RYI   K TLP  V+L GLR+V+
Sbjct: 122 DKLEDLIEKLILTDKLNNMGAVGDKIGRAYRIRDTLGRYIVFAKDTLPYSVSLDGLRVVL 181

Query: 182 DCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIA 241
           DCANGA+YKVAP +F ELGA+V+ I ++PNGININ  CGST   ++       RAD+GIA
Sbjct: 182 DCANGATYKVAPMIFEELGAEVIAINNQPNGININDKCGSTYPKAIVDATKLYRADVGIA 241

Query: 242 LDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLG 301
            DGDGDRV++VD++  IV+GD I+A++AR     + L+G+ +V TVM+N GLE F+  LG
Sbjct: 242 FDGDGDRVLMVDDRYNIVDGDAILAILARYMKKRNTLKGDKVVGTVMTNYGLEMFLDKLG 301

Query: 302 LSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKP 361
           +SL+R +VGD+ I++ + +   N+GGEQSGHI+L D+ +TGDG+V AL +L  +KQ +  
Sbjct: 302 ISLQRVDVGDKNIVKKIMDENLNLGGEQSGHIVLWDFNTTGDGIVTALAILSIMKQENAR 361

Query: 362 VSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQ-AIADAESELRGIDRLIVRASGTESLI 420
           +S +   F + PQ   +V VK+   L     +Q AI  A+ +L    R++VR SGTE L+
Sbjct: 362 LSELTQDFRKIPQKTVNVLVKEKPQLEEVEEIQNAITKAKEKLSKNGRIVVRYSGTEPLL 421

Query: 421 RIMAE 425
           RI  E
Sbjct: 422 RITVE 426


>gi|254787190|ref|YP_003074619.1| phosphoglucosamine mutase [Teredinibacter turnerae T7901]
 gi|259647728|sp|C5BQ00|GLMM_TERTT RecName: Full=Phosphoglucosamine mutase
 gi|237685614|gb|ACR12878.1| phosphoglucosamine mutase [Teredinibacter turnerae T7901]
          Length = 446

 Score =  409 bits (1050), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 211/446 (47%), Positives = 298/446 (66%), Gaps = 8/446 (1%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLF--RGKKKHRRVVIGKDTRLSGYML 58
           M R++FGTDGIRG+     ITP F M++G AVG +   R       V+IGKDTR+SGYM 
Sbjct: 1   MTRKYFGTDGIRGQVGQGVITPQFFMQLGWAVGKVLAERHADGGGLVLIGKDTRISGYMF 60

Query: 59  ENSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDG 118
           E++L AG  AAG+D  +LGP+P+PA+A LTR+ +A  G++ISASHNP++DNGIKLF   G
Sbjct: 61  ESALEAGLIAAGVDVGLLGPMPTPAIAYLTRTFQASAGIVISASHNPFRDNGIKLFNTQG 120

Query: 119 YKVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLR 178
            K++ D+E  IE  ++  + +     + +G A+RV     RYIE  K TLP   +L GL 
Sbjct: 121 VKLADDVEAAIEHQVDRPMVTA----ERLGKARRVPDAEGRYIEFCKGTLPWGFSLAGLT 176

Query: 179 IVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADI 238
           +VVDCANGA+Y VAP+VF ELGA+V+ I   P+G NINL+CGST + +LQ++V E  ADI
Sbjct: 177 VVVDCANGATYNVAPKVFSELGAEVIAISTHPDGENINLNCGSTKLNNLQKQVLESHADI 236

Query: 239 GIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIA 298
           GIA DGDGDRV  VDE+G +V+GDQ++ +IA     H     +G+V T MSN G E  + 
Sbjct: 237 GIAFDGDGDRVQFVDERGEVVDGDQLLFIIAAHKQRHG-GGCSGVVGTQMSNFGFELALE 295

Query: 299 GLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQY 358
            L +  +R +VGDRY++E M NNG+ +GGE SGHI+ +D  +TGDG++AALQVLR +   
Sbjct: 296 ALKIPFERAKVGDRYVIEAMNNNGWKLGGESSGHIVCADVTTTGDGIIAALQVLRALNAE 355

Query: 359 DKPVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQ-AIADAESELRGIDRLIVRASGTE 417
            + +  +    ++ PQ + +V VK    L  + +VQ AIA+AE  + G  R+++R SGTE
Sbjct: 356 AQTLYELKQRMQKMPQVMVNVPVKRKLNLEENDMVQTAIAEAEQRMEGQGRVLLRPSGTE 415

Query: 418 SLIRIMAEGDDLSRIKRIVDDLAKVI 443
            +IR+M EG     + ++  +LA+V+
Sbjct: 416 PVIRVMVEGQQHGMVSQLAHELAEVV 441


>gi|224823867|ref|ZP_03696976.1| phosphoglucosamine mutase [Lutiella nitroferrum 2002]
 gi|224604322|gb|EEG10496.1| phosphoglucosamine mutase [Lutiella nitroferrum 2002]
          Length = 445

 Score =  409 bits (1050), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 204/445 (45%), Positives = 300/445 (67%), Gaps = 7/445 (1%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKK--HRRVVIGKDTRLSGYML 58
           M R++FGTDGIRG+   FPITP F++++G A G +    +   H  V+IGKDTR+SGYML
Sbjct: 1   MARKYFGTDGIRGEVGQFPITPEFVLKLGYAAGRVLVNHENDLHPTVLIGKDTRISGYML 60

Query: 59  ENSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDG 118
           E +L AG TAAG++  + GP+P+P +A LTR+LR   GVMISASHNPY DNGIK F   G
Sbjct: 61  EAALQAGLTAAGVNVLLTGPLPTPGIAYLTRALRLSAGVMISASHNPYHDNGIKFFAEGG 120

Query: 119 YKVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLR 178
            K+   IE  IE +LE  + +  S    +G A+R+DG  +RYIE  K T P D  L+GL+
Sbjct: 121 KKLDDAIELEIEAMLEQPMETRPS--RELGRARRIDGAAERYIEFCKSTFPNDRNLKGLK 178

Query: 179 IVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADI 238
           +VVDCA+GA+Y +AP+VF ELGA+VV IG +P G NIN   G+T   +LQ  V +  AD 
Sbjct: 179 LVVDCAHGATYHIAPKVFHELGAEVVTIGGEPTGYNINDKVGATYTKTLQAAVLQHEADY 238

Query: 239 GIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIA 298
           G+ALDGDGDR+++VD KG + +GDQ++ +IA+   +   L+G G+V TVM+N+G+E  + 
Sbjct: 239 GVALDGDGDRLMMVDRKGQVYDGDQLIYVIAKARAAKGELKG-GVVGTVMTNMGMELALQ 297

Query: 299 GLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQY 358
            + +   R +VGDRY++E + NNG+ VGGE SGH++  D  +TGDG+++ LQVL  + + 
Sbjct: 298 KMAVPFGRAKVGDRYVLEMLHNNGWLVGGEASGHVLCLDKHNTGDGIISCLQVLTALAEL 357

Query: 359 DKPVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTES 418
            + ++++C  ++ +PQ L +V +K      +S  V  +  AE+ L+G  R+++R SGTE 
Sbjct: 358 GQDLASVCRDWQPFPQTLINVRLKGQDWKAAS--VDVLTAAETALQGRGRVVLRPSGTEP 415

Query: 419 LIRIMAEGDDLSRIKRIVDDLAKVI 443
           ++R+M E DD +  ++   ++A VI
Sbjct: 416 VVRVMVEADDHALSEKWAREIAAVI 440


>gi|114321122|ref|YP_742805.1| phosphoglucosamine mutase [Alkalilimnicola ehrlichii MLHE-1]
 gi|122311299|sp|Q0A772|GLMM_ALHEH RecName: Full=Phosphoglucosamine mutase
 gi|114227516|gb|ABI57315.1| phosphoglucosamine mutase [Alkalilimnicola ehrlichii MLHE-1]
          Length = 451

 Score =  408 bits (1048), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 207/444 (46%), Positives = 298/444 (67%), Gaps = 5/444 (1%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           MK+ +FGTDGIRG     PITP+FM+ +G A G +   +     V++GKDTR+SGYMLE+
Sbjct: 1   MKKEYFGTDGIRGTVGEPPITPDFMLHLGWAAGRVL-ARAGQSSVLVGKDTRISGYMLES 59

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +L +GF AAG++  +LGP+P+PA+A LTR+LRA  GV+ISASHNP++DNGIK F  DG K
Sbjct: 60  ALESGFAAAGVNVKLLGPMPTPAIAYLTRTLRAAAGVVISASHNPHEDNGIKFFSDDGEK 119

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +    E  IE  L   L    S    +G A R++    RYIE  KR+ P +++L+GLR+V
Sbjct: 120 LDDATELAIEAELRQPLKPAPSA--RLGKASRINDAPGRYIEFCKRSFPYELSLRGLRLV 177

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           VDCANGA+Y VAP VF ELGA+V+ + D P+G+NIN DCGS +   LQ  V E  AD GI
Sbjct: 178 VDCANGATYHVAPAVFHELGAEVIPLADDPDGLNINADCGSLHPKGLQAAVREHDADAGI 237

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           A DGDGDRVI+VD +G +V+GD ++ +IAR+ M++  L G  +V TVMSN+GLE+ I  L
Sbjct: 238 AFDGDGDRVIMVDHRGEVVDGDGLLYIIARQRMANGGLAGP-VVGTVMSNLGLEQGIGRL 296

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           GL   R +VGDRY+ME ++  G  +GGE SGH+I  D  +TGDG+V+ALQVL  +   ++
Sbjct: 297 GLPFLRAKVGDRYVMEMLRREGGILGGESSGHLICLDRTTTGDGIVSALQVLEAMAAQER 356

Query: 361 PVSTICHCFEEYPQFLRSVSV-KDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESL 419
            ++ +    +  PQ + +V + +   + + +++  A+ DAE+ L G  R+++R SGTE +
Sbjct: 357 TLAELADGMDRLPQIMVNVPISRGVPVQDHATVTDAVRDAETRLAGRGRVLLRPSGTEPV 416

Query: 420 IRIMAEGDDLSRIKRIVDDLAKVI 443
           +R+M EG D + +    + +A  +
Sbjct: 417 LRVMVEGPDQAEVSATAEAIAGAV 440


>gi|294085872|ref|YP_003552632.1| phosphoglucosamine mutase [Candidatus Puniceispirillum marinum
           IMCC1322]
 gi|292665447|gb|ADE40548.1| phosphoglucosamine mutase [Candidatus Puniceispirillum marinum
           IMCC1322]
          Length = 475

 Score =  407 bits (1047), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 219/444 (49%), Positives = 299/444 (67%), Gaps = 11/444 (2%)

Query: 5   FFGTDGIRGKSNTFPITPNFMMRIGIAVGYLF--------RGKKKHR-RVVIGKDTRLSG 55
            FGTDG+R + NT P+T   ++R+ +A G  F         G+K  R  VVIGKDTRLSG
Sbjct: 25  LFGTDGVRARINTGPMTAEAIVRLALAAGSWFVANNAVGKTGRKAGRPSVVIGKDTRLSG 84

Query: 56  YMLENSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFG 115
           YMLE++LVAGFT+ GMD  +LGP+P+PAVA LT SLRA++GVMISASHNP+ DNGIKLFG
Sbjct: 85  YMLESALVAGFTSIGMDCRLLGPVPTPAVAYLTSSLRAELGVMISASHNPHSDNGIKLFG 144

Query: 116 PDGYKVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQ 175
           PDGYK+   IE  I  L    +   L+  +++G A+R+     RY+E  K   PR++ L 
Sbjct: 145 PDGYKLDDAIETEISQLAAGSIA--LAEPENLGRARRMLDSVGRYVEFAKAAFPRNLRLD 202

Query: 176 GLRIVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVR 235
           G++IVVDCANGA+Y+ AP+  +ELG DV+ +   PNG+NIN  CG+ +   +   V    
Sbjct: 203 GMKIVVDCANGAAYRTAPDTLFELGVDVIPLAVTPNGMNINDMCGAVSPQMMAAAVVTHG 262

Query: 236 ADIGIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLER 295
           AD GIALDGD DR+I+ DEKG +++GDQ++A +A        L G G+V TVMSN GLE 
Sbjct: 263 ADAGIALDGDADRLIMADEKGHLLDGDQLLATLAYALQQSGSLAGGGVVGTVMSNRGLEL 322

Query: 296 FIAGLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYI 355
            +A  GL L R++VGDRYI+E M+  G N+GGEQSGHI+LSDY +TGDGL+AALQ+L  +
Sbjct: 323 KLAEWGLDLHRSKVGDRYILETMRKTGINLGGEQSGHILLSDYATTGDGLLAALQMLALL 382

Query: 356 KQYDKPVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASG 415
           K+ DK  S +   F   PQ L ++   D +IL   ++   I+  E+ + G  R++VRASG
Sbjct: 383 KRSDKNASDLFTAFTPSPQKLENIYDIDRTILADDALQADISKIEASMNGQGRVLVRASG 442

Query: 416 TESLIRIMAEGDDLSRIKRIVDDL 439
           TE+LIR+M E D++  +  ++ +L
Sbjct: 443 TENLIRVMVEADEMPLLDNVMQEL 466


>gi|152989858|ref|YP_001355580.1| phosphoglucosamine mutase [Nitratiruptor sp. SB155-2]
 gi|158705801|sp|A6Q164|GLMM_NITSB RecName: Full=Phosphoglucosamine mutase
 gi|151421719|dbj|BAF69223.1| phosphoglucosamine mutase [Nitratiruptor sp. SB155-2]
          Length = 445

 Score =  407 bits (1047), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 206/440 (46%), Positives = 286/440 (65%), Gaps = 9/440 (2%)

Query: 4   RFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSLV 63
             FGTDG+RGK+    ++    MR+ +A G  FR   +  ++V+GKDTR SGYM+EN+LV
Sbjct: 2   ELFGTDGVRGKAGKL-LSAQLSMRLAMAAGIYFRKNSRTNKIVVGKDTRRSGYMIENALV 60

Query: 64  AGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVST 123
           +G TA G +   +GP+P+PA+A LT  LR D G+MISASHNPY DNGIK F   G K+  
Sbjct: 61  SGLTAVGYNVIQVGPMPTPAIAFLTEDLRCDAGIMISASHNPYYDNGIKFFNHQGDKLQP 120

Query: 124 DIEDRIETLLEDDLT--SYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVV 181
           + E  IE +  D+ T          IG +KR+D V  RYI H+K + P+D+TL GLR+V+
Sbjct: 121 EDEKAIEAIFFDEQTIEENQKTDQDIGSSKRIDDVIGRYIVHLKNSFPKDLTLNGLRVVI 180

Query: 182 DCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIA 241
           D ANGA+YKVAP VF ELGA+V VI D+PNG NIN  CG+     L +KV E RADIG A
Sbjct: 181 DTANGAAYKVAPTVFSELGAEVFVINDEPNGFNINEKCGAMYPGELAKKVREYRADIGFA 240

Query: 242 LDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLG 301
           LDGD DR+++VDEKG IV GD ++  +A       +L+ + IV TVMSN  LE ++A LG
Sbjct: 241 LDGDADRLVVVDEKGKIVPGDLVIGALATYLKQEGMLQADAIVATVMSNKALEDYLATLG 300

Query: 302 LSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKP 361
           + L R+ VGD+Y+++ MK  G N GGE SGHII  DY  TGDG+V ALQ+  Y+ +  K 
Sbjct: 301 IELVRSNVGDKYVLDEMKKRGINFGGESSGHIIFGDYSKTGDGIVTALQITAYMLRSQKG 360

Query: 362 VSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAES--ELRGIDRLIVRASGTESL 419
            S I + F  YP  + +V+VK+   L +   ++   + +   E  GI R ++R SGTE+ 
Sbjct: 361 ASEILYPFSLYPSKMENVTVKEKKPLET---IEEFPELQKRIEKSGI-RSLIRYSGTENK 416

Query: 420 IRIMAEGDDLSRIKRIVDDL 439
           +RI+ EG D  ++++++++L
Sbjct: 417 LRILLEGKDQKKLEKLMEEL 436


>gi|237808994|ref|YP_002893434.1| phosphoglucosamine mutase [Tolumonas auensis DSM 9187]
 gi|237501255|gb|ACQ93848.1| phosphoglucosamine mutase [Tolumonas auensis DSM 9187]
          Length = 444

 Score =  407 bits (1047), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 210/443 (47%), Positives = 303/443 (68%), Gaps = 9/443 (2%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M R++FGTDG+RGK    PITP+F+M++G A G +   K+  ++V+IGKDTR+SGYMLE 
Sbjct: 1   MSRKYFGTDGVRGKVGEMPITPDFVMKLGWAAGKVL-AKQGSKKVLIGKDTRISGYMLEA 59

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +L AG +AAG+   +LGP+P+PAVA LTR+ RA+ GV+ISASHNPY DNGIK F   G K
Sbjct: 60  ALEAGLSAAGLKPVLLGPMPTPAVAYLTRTFRAEAGVVISASHNPYYDNGIKFFSAQGTK 119

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDS--IGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLR 178
           +  +IE+ IE  +++D+     C +S  +G A R+D    RYIE  K T P ++ L GL+
Sbjct: 120 LPDEIENAIEKTMDEDI----RCVESAQLGKASRIDDAPGRYIEFCKSTFPGELNLDGLK 175

Query: 179 IVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADI 238
           IVVDCA+GA+Y +AP VF ELGADV+ +G  P+G+NIN   GST   +L  +V + +AD+
Sbjct: 176 IVVDCAHGATYHIAPSVFRELGADVITMGCAPDGLNINDHVGSTAPQALVERVLQEKADL 235

Query: 239 GIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIA 298
           GIA DGDGDR+I+VD  G  V+GD+++ +IA +      L G G+V T+M+N+GLE  +A
Sbjct: 236 GIAFDGDGDRLIMVDHTGYEVDGDELLYIIACDLQQQGSLTG-GVVGTLMTNMGLEVALA 294

Query: 299 GLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQY 358
              + L R +VGDRY+ME ++  G+ +GGE SGHII  D  +TGDG+VAALQVL+   + 
Sbjct: 295 KRDIPLVRAKVGDRYVMELLQEKGWRLGGENSGHIICLDQTTTGDGIVAALQVLKAASRA 354

Query: 359 DKPVSTICHCFEEYPQFLRSVS-VKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTE 417
            K +  +     ++PQ L +V  V D   L S+S+ QA+ DAE  L    R+++R SGTE
Sbjct: 355 GKTLFELRSDIRKFPQILINVRFVGDHDPLLSASVQQAVRDAEKILGQTGRVLLRKSGTE 414

Query: 418 SLIRIMAEGDDLSRIKRIVDDLA 440
            L+R+M EG++  +++++ + +A
Sbjct: 415 PLLRVMVEGENEQQVRQLAEKIA 437


>gi|325276160|ref|ZP_08141965.1| phosphoglucosamine mutase [Pseudomonas sp. TJI-51]
 gi|324098697|gb|EGB96738.1| phosphoglucosamine mutase [Pseudomonas sp. TJI-51]
          Length = 446

 Score =  407 bits (1046), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 205/445 (46%), Positives = 299/445 (67%), Gaps = 6/445 (1%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M R++FGTDGIRG+   +PITP+FM+++G A G  FR K  H RV++GKDTR+SGYM E+
Sbjct: 1   MSRKYFGTDGIRGRVGEYPITPDFMLKLGWAAGMAFR-KLGHCRVLVGKDTRISGYMFES 59

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +L AG +AAG D  +LGP+P+PA+A LTR+  A+ G++ISASHNP+ DNGIK F   G K
Sbjct: 60  ALEAGLSAAGADVMLLGPMPTPAIAYLTRTFHAEAGIVISASHNPHDDNGIKFFSGQGTK 119

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +  D+E  IE LL+  +T   S    +G   R++    RYIE  K ++P   +  GL++V
Sbjct: 120 LPDDVELMIEELLDQPMTVVES--SKLGKVSRINDAAGRYIEFCKSSVPSSTSFAGLKLV 177

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           VDCA+GA+YKVAP VF ELGADV V+  +P+G+NIN +CGST++ SLQ  V    AD+GI
Sbjct: 178 VDCAHGATYKVAPSVFRELGADVTVLHAQPDGLNINENCGSTHIESLQAAVLVGHADLGI 237

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           A DGDGDRV++VD  GAIV+GD+++ +IAR+      L+G G+V T+MSN+GLE  +  L
Sbjct: 238 AFDGDGDRVLMVDHTGAIVDGDELLFIIARDLQERGKLQG-GVVGTLMSNLGLELALKDL 296

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
            +   R +VGDRY+M  +    + VGGE SGH++  +Y +TGD ++AALQVL  +K+  +
Sbjct: 297 DIPFVRAKVGDRYVMAELLEREWLVGGENSGHVVCCNYTTTGDAIIAALQVLMALKRRGE 356

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTSI--LNSSSIVQAIADAESELRGIDRLIVRASGTES 418
            ++       + PQ L +V    + +  L   ++ +A A     L G  R+++R SGTE 
Sbjct: 357 GLAQARQALRKCPQVLINVRFGGSKVDPLQHPAVQEASAKVTEALAGRGRVLLRKSGTEP 416

Query: 419 LIRIMAEGDDLSRIKRIVDDLAKVI 443
           L+R+M EG+D ++++   + LAK++
Sbjct: 417 LVRVMVEGEDEAQVRGHAEALAKLV 441


>gi|149909284|ref|ZP_01897940.1| phosphoglucosamine mutase [Moritella sp. PE36]
 gi|149807601|gb|EDM67549.1| phosphoglucosamine mutase [Moritella sp. PE36]
          Length = 444

 Score =  407 bits (1046), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 204/446 (45%), Positives = 303/446 (67%), Gaps = 9/446 (2%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M R++FGTDGIRG     PITP F +++G A G +   K+  R+V+IGKDTR+SGYMLE 
Sbjct: 1   MSRKYFGTDGIRGLVGVAPITPEFALKLGWAAGKVL-AKQGTRKVLIGKDTRISGYMLEC 59

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +L AG +AAG+D   +GP+P+PAVA LTR+ RA+ G++ISASHNPY DNGIK F  +G K
Sbjct: 60  ALEAGLSAAGLDVAFMGPMPTPAVAYLTRTFRAEAGIVISASHNPYHDNGIKFFSANGTK 119

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDS--IGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLR 178
           +  ++E  IE  LE +LT    C +S  +G A R++    RYIE+ K T P   +L+GL+
Sbjct: 120 LPDEVELAIEAQLEKELT----CVESAQLGKAVRIEDAAGRYIEYCKSTFPSRASLKGLK 175

Query: 179 IVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADI 238
           IV+DCA+GA+Y +AP VF ELGA+++ IG +PNG+NIN  CG+T   +L  +V   +AD+
Sbjct: 176 IVLDCAHGATYHIAPSVFTELGAEIITIGVEPNGLNINDGCGATAPEALVARVLAEKADL 235

Query: 239 GIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIA 298
           G+A DGDGDR+++VD  G +++GD+++ +IAR+ + +  L+G G+V T+M+N+GLE  + 
Sbjct: 236 GVAYDGDGDRLMMVDHTGYVIDGDEVLYIIARDALRNGELKG-GVVGTLMANMGLELALK 294

Query: 299 GLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQY 358
            LG+   R+ VGDRY++E M   G+ +GGE SGHII  D+ +TGDG+V++L VL  +   
Sbjct: 295 SLGIPFARSAVGDRYVVEMMLEKGWRIGGENSGHIISLDHTTTGDGIVSSLLVLAALVNS 354

Query: 359 DKPVSTICHCFEEYPQFLRSVSVK-DTSILNSSSIVQAIADAESELRGIDRLIVRASGTE 417
              +  +     ++PQ L +V    DT  L + S++QA+ D E EL    R+++R SGTE
Sbjct: 355 GLTLKELRSGMSKFPQVLVNVRFNGDTDPLLAESVLQAVKDVEQELADRGRVLLRKSGTE 414

Query: 418 SLIRIMAEGDDLSRIKRIVDDLAKVI 443
            LIR+M EG+D + +  + + +A  +
Sbjct: 415 PLIRVMVEGEDETHVLALANKIADAV 440


>gi|254362644|ref|ZP_04978733.1| phosphomannomutase [Mannheimia haemolytica PHL213]
 gi|261492886|ref|ZP_05989432.1| phosphomannomutase [Mannheimia haemolytica serotype A2 str. BOVINE]
 gi|261496764|ref|ZP_05993139.1| phosphomannomutase [Mannheimia haemolytica serotype A2 str. OVINE]
 gi|153094258|gb|EDN75129.1| phosphomannomutase [Mannheimia haemolytica PHL213]
 gi|261307603|gb|EEY08931.1| phosphomannomutase [Mannheimia haemolytica serotype A2 str. OVINE]
 gi|261311427|gb|EEY12584.1| phosphomannomutase [Mannheimia haemolytica serotype A2 str. BOVINE]
          Length = 444

 Score =  407 bits (1046), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 203/447 (45%), Positives = 299/447 (66%), Gaps = 10/447 (2%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M R++FGTDG+RG+   FPITP F +++G A G +    +  ++V+IGKDTR+SGYMLE+
Sbjct: 1   MARKYFGTDGVRGEVGKFPITPEFALKLGWAAGKVL-ATQGTKKVLIGKDTRISGYMLES 59

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +L AG TAAG+ A  +GP+P+PA+A LTR+ RA+ G++ISASHNPY DNGIK F   G K
Sbjct: 60  ALEAGLTAAGLSAVFVGPMPTPAIAYLTRTFRAEAGIVISASHNPYYDNGIKFFSSVGEK 119

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDS--IGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLR 178
           +  +IE+ IE +L+  +     C DS  +G A R++    RYIE  K T P +++L+G +
Sbjct: 120 LPDEIEEAIEAMLDKPM----DCVDSANLGRASRINDAAGRYIEFCKGTFPSELSLEGYK 175

Query: 179 IVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADI 238
           IVVDCANGA+Y +AP V  ELGA+V+ IG KP+G+NIN  CG+T++ +LQ+ V E  AD+
Sbjct: 176 IVVDCANGATYHIAPNVMRELGAEVLEIGTKPDGLNINEKCGATDIKALQKVVVEAGADV 235

Query: 239 GIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIA 298
           G+A DGDGDR+I+VD  G  V+GDQI+ ++ARE +    L+G G+V T+MSN+ LE  + 
Sbjct: 236 GLAYDGDGDRLIMVDHLGNKVDGDQILFILAREALRSGKLQG-GVVGTLMSNMSLELALK 294

Query: 299 GLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQY 358
            L +   R  VGDRY++E +K  G+ +GGE SGHII+ D  +TGDG++A+LQVL  +  +
Sbjct: 295 ELAIPFSRANVGDRYVLEQLKEKGWKLGGENSGHIIVLDKNTTGDGIIASLQVLAAMASH 354

Query: 359 DKPVSTICHCFEEYPQFLRSVSVKD--TSILNSSSIVQAIADAESELRGIDRLIVRASGT 416
              ++ +      +PQ L +V  +    + L S+ +    AD E  L G  R+++R SGT
Sbjct: 355 KLSLNDLAKAVPLFPQVLLNVRFEKGAANPLESNEVKAVAADVEKRLAGKGRILLRKSGT 414

Query: 417 ESLIRIMAEGDDLSRIKRIVDDLAKVI 443
           E LIR+M E +D    +   +++ + +
Sbjct: 415 EPLIRVMVECEDAVLAQSCAEEIVEAV 441


>gi|329893945|ref|ZP_08269980.1| Phosphoglucosamine mutase [gamma proteobacterium IMCC3088]
 gi|328923400|gb|EGG30717.1| Phosphoglucosamine mutase [gamma proteobacterium IMCC3088]
          Length = 449

 Score =  407 bits (1045), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 206/443 (46%), Positives = 298/443 (67%), Gaps = 6/443 (1%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRR--VVIGKDTRLSGYML 58
           M +R+FGTDGIRG+    PITP+FM+++G A G +F  K   +R  VVIGKDTR+SGYM 
Sbjct: 1   MSKRYFGTDGIRGEVGVAPITPDFMLKLGWAAGKVFAAKAGKQRPLVVIGKDTRVSGYMF 60

Query: 59  ENSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDG 118
           E++L AG  AAG+D  +LGP+P+PAV+++T++L A  G++ISASHNP+QDNGIK FG DG
Sbjct: 61  ESALEAGLVAAGVDVRLLGPMPTPAVSVMTQTLNATAGIVISASHNPFQDNGIKFFGHDG 120

Query: 119 YKVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLR 178
            K+  ++E  IE +++  L +  S   ++G   R++    RYIE+ K T+PR  +L GL 
Sbjct: 121 GKLGDELEFEIEAMIDRPLET--SGSSALGKVVRINDAGGRYIEYCKSTVPRGFSLAGLN 178

Query: 179 IVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADI 238
           +VVDCANGA+Y VAP VF ELGA+V  IG +PNG NIN   GST++ +L  +V + +AD+
Sbjct: 179 LVVDCANGATYHVAPAVFQELGANVTKIGTEPNGFNINAGVGSTDMSALAAQVRQTQADL 238

Query: 239 GIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIA 298
           GIA DGDGDRV+ VD +GA + GDQ++ ++A+           G+V T+MSN+GLE  + 
Sbjct: 239 GIAFDGDGDRVLFVDHQGAEIEGDQLLYVMAKSRQQRG-CNDQGVVGTLMSNLGLEVGLK 297

Query: 299 GLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQY 358
            LGL   R +VGDRY+ E M   G+ +GGE SGH+I +D  +TGDG+V+ALQVLR + + 
Sbjct: 298 ALGLGFFRAKVGDRYVKEAMLARGWVLGGESSGHLICTDVSNTGDGIVSALQVLRAVVES 357

Query: 359 DKPVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQ-AIADAESELRGIDRLIVRASGTE 417
              +  +C   +  PQ + +V + +   + ++  VQ A+A+ ES L    R+++R SGTE
Sbjct: 358 GDSLGALCSEMDMMPQTMINVRMSERVDITANPQVQAAVAEVESALGDSGRVLLRLSGTE 417

Query: 418 SLIRIMAEGDDLSRIKRIVDDLA 440
            L+R+M EG + S +  +   LA
Sbjct: 418 PLVRVMVEGSNASTVNELCASLA 440


>gi|290473443|ref|YP_003466310.1| phosphoglucosamine mutase [Xenorhabdus bovienii SS-2004]
 gi|289172743|emb|CBJ79514.1| phosphoglucosamine mutase [Xenorhabdus bovienii SS-2004]
          Length = 445

 Score =  407 bits (1045), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 213/442 (48%), Positives = 301/442 (68%), Gaps = 5/442 (1%)

Query: 3   RRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSL 62
           R++FGTDGIRGK    PITP+F++++G A G +   +   R+++IGKDTR+SGYMLE++L
Sbjct: 4   RKYFGTDGIRGKVGDSPITPDFVLKLGWAAGKVL-ARHGSRKIIIGKDTRISGYMLESAL 62

Query: 63  VAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVS 122
            AG  AAG+ A   GP+P+PAVA LTR+ RA+ G++ISASHNPY DNGIK F  DG K+ 
Sbjct: 63  EAGLAAAGLSASFTGPMPTPAVAYLTRTFRAEAGIVISASHNPYYDNGIKFFSIDGTKLP 122

Query: 123 TDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVVD 182
            ++E+ IE  +E  LT   S    +G A R+     RYIE  K T P + +L GL++V+D
Sbjct: 123 DNVEEAIEAEMEKPLTCVESA--ELGRANRIVDAAGRYIEFCKGTFPSEQSLNGLKVVLD 180

Query: 183 CANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIAL 242
           CANGA+Y +AP V  ELGA+VV IG +PNGININ +CG+T+V  LQ++V E +AD+G+A 
Sbjct: 181 CANGATYHIAPNVLRELGANVVTIGCEPNGININEECGATDVRLLQKRVQEEQADVGLAF 240

Query: 243 DGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLGL 302
           DGDGDR+I+VD  G  V+GDQI+ +IARE +    LRG G V T+MSNIGLE  +  LG+
Sbjct: 241 DGDGDRIIMVDHLGQKVDGDQILYIIAREALRQGQLRG-GAVGTLMSNIGLELALKQLGI 299

Query: 303 SLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKPV 362
             +R +VGDRY++E ++  G+ +G E SGH+IL D  +TGDG+VA LQ+L  + + +  +
Sbjct: 300 PFERAKVGDRYVLEKLQEKGWRLGAENSGHVILLDKTTTGDGIVAGLQILSAMVRNNMSL 359

Query: 363 STICHCFEEYPQFLRSVSVK-DTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLIR 421
             +C   +  PQ L +V    D   L S S+++A+   E+EL G  R+++R SGTE LIR
Sbjct: 360 HDLCSGMKLLPQILVNVRFAGDNDPLQSESVLEAVKSVEAELNGRGRVLLRKSGTEPLIR 419

Query: 422 IMAEGDDLSRIKRIVDDLAKVI 443
           +M EG+D   +  +   +A  +
Sbjct: 420 VMVEGEDEELVTALAHRIADAV 441


>gi|300721533|ref|YP_003710808.1| phosphoglucosamine mutase [Xenorhabdus nematophila ATCC 19061]
 gi|297628025|emb|CBJ88574.1| phosphoglucosamine mutase [Xenorhabdus nematophila ATCC 19061]
          Length = 445

 Score =  406 bits (1044), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 216/445 (48%), Positives = 305/445 (68%), Gaps = 9/445 (2%)

Query: 3   RRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSL 62
           R++FGTDGIRGK    PITP+F++++G A G +   +   R+++IGKDTR+SGYMLE++L
Sbjct: 4   RKYFGTDGIRGKVGNTPITPDFVLKLGWAAGKVL-ARHGSRKIIIGKDTRISGYMLESAL 62

Query: 63  VAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVS 122
            AG  AAG+ A   GP+P+PAVA LTR+ RA+ G++ISASHNPY DNGIK F  DG K+ 
Sbjct: 63  EAGLAAAGLSASFTGPMPTPAVAYLTRTFRAEAGIVISASHNPYYDNGIKFFSIDGTKLP 122

Query: 123 TDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVVD 182
            D+E+ IE  +E  LT   S    +G A R+     RYIE  K T P + +L GL+IV+D
Sbjct: 123 DDVEEAIEAEMEKPLTCVESA--ELGRANRIVDAAGRYIEFCKGTFPSEQSLNGLKIVLD 180

Query: 183 CANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIAL 242
           CANGA+Y +AP V  ELGA+V+ IG +PNGININ +CG+T+V  LQ++V E +A++G+A 
Sbjct: 181 CANGATYHIAPNVLRELGAEVITIGCEPNGININEECGATDVRLLQKRVLEEQANVGLAF 240

Query: 243 DGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLGL 302
           DGDGDR+I+VD  G  V+GDQI+ +IARE +    LRG G V T+MSN+GLE  +  LG+
Sbjct: 241 DGDGDRIIMVDHLGHKVDGDQILYIIAREALRQGQLRG-GAVGTLMSNMGLELALKQLGI 299

Query: 303 SLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKPV 362
             +R +VGDRY++E ++  G+ +G E SGH+IL D  +TGDG+VA LQVL  + + +  +
Sbjct: 300 PFERAKVGDRYVLEKLQEKGWRLGAENSGHVILLDKTTTGDGIVAGLQVLSAMVRNNMNL 359

Query: 363 STICHCFEEYPQFLRSVSVK-DTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLIR 421
             +C   +  PQ L +V    +T  L S S+++A+   E+EL G  R+++R SGTE LIR
Sbjct: 360 HDLCSGMKLLPQILVNVRFAGNTDPLQSDSVLEAVKSVEAELNGRGRVLLRKSGTEPLIR 419

Query: 422 IMAEGDDLSRI----KRIVDDLAKV 442
           +M EG+D  ++     RI D + K+
Sbjct: 420 VMVEGEDEKQVTALAHRIADTVKKM 444


>gi|224373413|ref|YP_002607785.1| phosphoglucosamine mutase [Nautilia profundicola AmH]
 gi|254798589|sp|B9L5Z7|GLMM_NAUPA RecName: Full=Phosphoglucosamine mutase
 gi|223589441|gb|ACM93177.1| phosphoglucosamine mutase [Nautilia profundicola AmH]
          Length = 440

 Score =  406 bits (1044), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 206/434 (47%), Positives = 285/434 (65%), Gaps = 8/434 (1%)

Query: 4   RFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSLV 63
           + FGTDG+RGK+  F +TP   M++ ++ G      KK  ++++GKDTR SGYM+EN+LV
Sbjct: 2   KLFGTDGVRGKAGEF-LTPFLAMKLAMSFGECL--PKKTGKILVGKDTRRSGYMIENALV 58

Query: 64  AGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVST 123
           +G TA G D   +GP+P+PA+A LT  +R D G+MISASHNPY DNGIK F   G K+S 
Sbjct: 59  SGLTAIGYDVIQIGPMPTPAIAFLTEDMRCDGGIMISASHNPYYDNGIKFFDSFGNKLSQ 118

Query: 124 DIEDRIET-LLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVVD 182
           + E++IE    E++    L     IG +KR+D V  RYI H+K + P+ V L G+RIV+D
Sbjct: 119 EFEEKIEKRYFENNFN--LKTEKEIGKSKRIDDVIGRYIVHIKSSFPKHVNLNGMRIVLD 176

Query: 183 CANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIAL 242
            ANGA+YKVAP +F ELGADV+ I D+P+G NIN + G+ +   L +KV E RADIG AL
Sbjct: 177 TANGAAYKVAPTIFTELGADVITINDEPDGFNINQNAGAMHPEFLAKKVLEYRADIGFAL 236

Query: 243 DGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLGL 302
           DGD DR+++VDEKG IVNGD+++  +A      + L+ NG+  TVMSN  LE+F+  +G+
Sbjct: 237 DGDADRLVVVDEKGEIVNGDKLLGALAYYLHKQNKLKNNGVAVTVMSNGALEKFLNDMGI 296

Query: 303 SLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKPV 362
            + R+ VGD+Y++E MK    N GGEQSGHII SDY  TGDGLV+ALQ + Y+ Q  K  
Sbjct: 297 KVYRSNVGDKYVLEVMKEKDLNFGGEQSGHIIFSDYAKTGDGLVSALQAVAYLIQSGKKA 356

Query: 363 STICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLIRI 422
           S     FE YPQ   ++ V     LN     + + D E E  G  R +VR SGTE+ +R+
Sbjct: 357 SEAFDLFELYPQIQANIQVSSKPPLNEIEGAKELLD-EVEKEGY-RHLVRYSGTENKLRL 414

Query: 423 MAEGDDLSRIKRIV 436
           + EG+  ++ K ++
Sbjct: 415 LVEGESENKAKELL 428


>gi|86157924|ref|YP_464709.1| phosphoglucosamine mutase [Anaeromyxobacter dehalogenans 2CP-C]
 gi|123497499|sp|Q2IHZ5|GLMM_ANADE RecName: Full=Phosphoglucosamine mutase
 gi|85774435|gb|ABC81272.1| phosphoglucosamine mutase [Anaeromyxobacter dehalogenans 2CP-C]
          Length = 458

 Score =  406 bits (1044), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 208/450 (46%), Positives = 296/450 (65%), Gaps = 10/450 (2%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M RR FGTDG+RG +N  P+T    +++G A+ Y+ R      R+VIGKDTRLSGYMLE 
Sbjct: 1   MARRLFGTDGVRGVANVHPMTAEMALQLGRALAYIVRSGPHRHRIVIGKDTRLSGYMLEQ 60

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           ++ +G  + G+D  + GP+P+P +A +T S+RAD GV+ISASHNPYQDNGIK F  DG+K
Sbjct: 61  AIASGICSMGVDVMLCGPLPTPGIAFVTHSMRADAGVVISASHNPYQDNGIKFFSRDGFK 120

Query: 121 VSTDIEDRIETLL----EDD-----LTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRD 171
           +  ++E +IE L+    EDD       +       IG AKR+D    RY + +K   P++
Sbjct: 121 LPDELELQIERLVLDAGEDDAGAEEFRALRPTATRIGKAKRIDDAIGRYAQFLKTIFPKE 180

Query: 172 VTLQGLRIVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKV 231
           +TL GL +VVDCA+GA+Y VAP VF ELGA V+ +  KP+G NIN  CG+ +  S+ R V
Sbjct: 181 LTLDGLTVVVDCAHGAAYHVAPAVFEELGAKVIPLNVKPDGKNINDACGAVHPESMARAV 240

Query: 232 HEVRADIGIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNI 291
               A++G+ALDGD DRVI+ DE G +V+GD IMAL+ R+ ++   L    +V TVMSN+
Sbjct: 241 KRHGANLGLALDGDADRVILADEHGNVVDGDAIMALVGRDLLARKALAKRTVVATVMSNL 300

Query: 292 GLERFIAGLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQV 351
           GLER +A LG  + RT VGDRY++E M+ +G++ GGEQSGH++  D+ +TGDG+ A L V
Sbjct: 301 GLERALAPLGGKVVRTAVGDRYVVEEMRRSGYSFGGEQSGHLVFLDHVTTGDGVAAGLNV 360

Query: 352 LRYIKQYDKPVSTICHCFEEYPQFLRSVSVKDT-SILNSSSIVQAIADAESELRGIDRLI 410
           L  + +  KP+S +  CFE +PQ L +V V++   +     + +AIA AE  L    R++
Sbjct: 361 LAVMVREGKPLSELARCFEPFPQALVNVEVREKRPVAELPGVAKAIAAAEKALGAEGRVL 420

Query: 411 VRASGTESLIRIMAEGDDLSRIKRIVDDLA 440
           VR SGTE+ +R++ EG D  R + + D +A
Sbjct: 421 VRPSGTENKVRVLVEGPDAKRARALADGIA 450


>gi|283850236|ref|ZP_06367525.1| phosphoglucosamine mutase [Desulfovibrio sp. FW1012B]
 gi|283574262|gb|EFC22233.1| phosphoglucosamine mutase [Desulfovibrio sp. FW1012B]
          Length = 450

 Score =  406 bits (1043), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 205/445 (46%), Positives = 297/445 (66%), Gaps = 2/445 (0%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M+++ FGTDG+RGK NT+P+TP  +MR+G+A G + R   +  +V+IGKDTRLSGY+ E 
Sbjct: 1   MEKKLFGTDGLRGKVNTYPMTPEVVMRLGLAAGQVLRDGGRRHKVLIGKDTRLSGYIYEY 60

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +L +GF AAGMD  ++GP+P+PA++ LTR +R DVGV+ISASHNPY DNGIK F   G+K
Sbjct: 61  ALTSGFCAAGMDVILVGPLPTPAISFLTRDMRVDVGVVISASHNPYHDNGIKFFDHMGFK 120

Query: 121 VSTDIEDRIETLLEDDLTSY-LSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRI 179
           +   +E  I  L++     + L   +++G A ++     RY   +K T+P DV+ + ++I
Sbjct: 121 LPDAVEAEIAALVDGCGQEWNLPAPEAVGRASKIQDSTGRYNVFLKNTVPLDVSFEDMKI 180

Query: 180 VVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIG 239
           V+DCANGA+++VAP VF ELGA V  +G +P+G+NIN   GS     +   V    ADIG
Sbjct: 181 VLDCANGAAFRVAPMVFEELGAKVFKMGVEPDGVNINRGVGSLYPEQVAANVVATGADIG 240

Query: 240 IALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAG 299
           IALDGD DRVI+ DEKG I++GDQIMA+ A + M    L GN +V TVMSN+ LE F+A 
Sbjct: 241 IALDGDADRVIVSDEKGRILDGDQIMAICALDCMERGSLPGNLLVATVMSNMALEVFMAA 300

Query: 300 LGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYD 359
            G  L RT VGDRY++E M+  G  +GGEQSGH+I  ++ +TGDG +AALQ+++ + +  
Sbjct: 301 HGGRLLRTPVGDRYVVEAMRAEGAVLGGEQSGHLIFLNHSTTGDGTLAALQLMKIMARKG 360

Query: 360 KPVSTICHCFEEYPQFLRSVSV-KDTSILNSSSIVQAIADAESELRGIDRLIVRASGTES 418
           KP+S +      +PQ L +V V +      +  I +A  +AE  L G  R+++R SGTES
Sbjct: 361 KPLSELATLLSPFPQKLVNVPVARKIPFSEAPEIARATVEAERLLAGRGRVLLRYSGTES 420

Query: 419 LIRIMAEGDDLSRIKRIVDDLAKVI 443
           L R+M E +D + ++ + + LA+ +
Sbjct: 421 LARVMVEAEDPALVESLCERLAQAV 445


>gi|78223093|ref|YP_384840.1| phosphoglucosamine mutase [Geobacter metallireducens GS-15]
 gi|123571772|sp|Q39UF9|GLMM_GEOMG RecName: Full=Phosphoglucosamine mutase
 gi|78194348|gb|ABB32115.1| phosphoglucosamine mutase [Geobacter metallireducens GS-15]
          Length = 451

 Score =  406 bits (1043), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 206/443 (46%), Positives = 291/443 (65%), Gaps = 2/443 (0%)

Query: 3   RRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSL 62
           ++ FGTDG+RG +N +P+T    M+IG A  YLF+   +  R+VIGKDTRLSGYMLEN+L
Sbjct: 2   KKLFGTDGVRGVANVYPMTTEMAMQIGRAAAYLFKNGNRRHRIVIGKDTRLSGYMLENAL 61

Query: 63  VAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVS 122
           VAG  + G+D  ++GP+P+P +A +T S+RAD GV+ISASHN +QDNGIK F  DG+K+ 
Sbjct: 62  VAGICSMGVDVLVVGPLPTPGIANITSSMRADAGVVISASHNAFQDNGIKFFSRDGFKLP 121

Query: 123 TDIEDRIETLL-EDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVV 181
            ++E +IE L+    + S       +G A R+D    RY+  +K T P+++ L G++IV+
Sbjct: 122 DEMELKIEELIFSKKIDSLRPIATEVGKAYRIDDAVGRYVVFLKNTFPKELDLTGMKIVL 181

Query: 182 DCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIA 241
           DCANGA+YKVAP V  ELGA+V+  G KPNG NIN   GS +   +   V E RAD+GIA
Sbjct: 182 DCANGAAYKVAPAVLEELGAEVIPYGIKPNGTNINAGFGSLHPEVISEAVKEHRADLGIA 241

Query: 242 LDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLG 301
           LDGD DRVI VDE G  V+GD IMA+ A + + H  LR N +V TVMSN+GL+  +   G
Sbjct: 242 LDGDADRVIFVDEFGNEVDGDHIMAICATDMLKHKKLRKNTLVATVMSNMGLDIAVKKAG 301

Query: 302 LSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKP 361
             + +T VGDRY++E M   G+N+GGEQSGH+I  D+ +TGDG+++ALQVL  +++  K 
Sbjct: 302 GKVIKTAVGDRYVVEEMLKGGYNLGGEQSGHMIFLDHNTTGDGMLSALQVLAIMRRSGKT 361

Query: 362 VSTICHCFEEYPQFLRSVSVKDTS-ILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
           +S +       PQ L +V V +   I+    +   I   E +L+   R+++R SGTE L+
Sbjct: 362 LSELAEVMIPLPQVLVNVRVTEKKDIMTIPEVAALIRGVEDKLKDEGRILIRYSGTEPLL 421

Query: 421 RIMAEGDDLSRIKRIVDDLAKVI 443
           RIM EG D  +I     ++A ++
Sbjct: 422 RIMLEGQDKYQITGWAKEIADLV 444


>gi|162454065|ref|YP_001616432.1| phosphoglucosamine mutase [Sorangium cellulosum 'So ce 56']
 gi|205830891|sp|A9G862|GLMM_SORC5 RecName: Full=Phosphoglucosamine mutase
 gi|161164647|emb|CAN95952.1| Phosphoglucosamine mutase [Sorangium cellulosum 'So ce 56']
          Length = 480

 Score =  405 bits (1042), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 214/434 (49%), Positives = 288/434 (66%), Gaps = 4/434 (0%)

Query: 3   RRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLF-RGKKKHRRVVIGKDTRLSGYMLENS 61
           R+ FGTDG+RG +N  P+TP   +R+G A+ ++   GK +  RVVIGKDTRLSGYMLE +
Sbjct: 27  RKLFGTDGVRGVANQPPMTPEMALRLGRAIAFVASHGKSRQVRVVIGKDTRLSGYMLETA 86

Query: 62  LVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKV 121
           + +G  A G    + GPIP+PAVA LT+S+RAD GV+ISASHNPYQDNGIK+FGPDGYK+
Sbjct: 87  IASGVCAMGGRVMLSGPIPTPAVAQLTQSMRADAGVVISASHNPYQDNGIKIFGPDGYKL 146

Query: 122 STDIEDRIETLLED-DLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
               E+ IE L+E  +L        +IG A ++D    RY+   K T P  ++L G++IV
Sbjct: 147 PDTAEEEIERLMESHELDEARVVGAAIGSAVKLDDARGRYVVFCKNTFPTALSLDGVKIV 206

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           VD A+GA+Y+VAP VF ELGA+V  +G KPNG NIN + G+ +   ++ +V +  A IGI
Sbjct: 207 VDAAHGAAYRVAPSVFTELGANVTALGVKPNGRNINRETGALHPEHVKAEVLKRGAAIGI 266

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           ALDGD DRVI+VDE+G +V+GD IMAL A   +    L  N IVTTVMSN+GLER +   
Sbjct: 267 ALDGDADRVIMVDERGEVVDGDAIMALCALRMLRTGKLPRNTIVTTVMSNLGLERALKAQ 326

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
              + RT VGDRY++E M+N G++ GGEQSGH+I  D+ +TGDG+VAALQVL  + + DK
Sbjct: 327 SGHVVRTAVGDRYVVEAMRNGGYSFGGEQSGHLIFLDHATTGDGIVAALQVLAIMMEEDK 386

Query: 361 PVSTIC-HCFEEYPQFLRSVSVKDTSILNSSSIVQAIADA-ESELRGIDRLIVRASGTES 418
           P+S +     +  PQ L + +      L+S    +   D  E  L    R++VR SGTE 
Sbjct: 387 PLSELASKAMQRVPQVLENATFATRLPLDSMQRTRVTVDRIEKTLGDKGRILVRWSGTEP 446

Query: 419 LIRIMAEGDDLSRI 432
            +R+M EG+D S I
Sbjct: 447 KLRVMVEGEDASTI 460


>gi|206891112|ref|YP_002247900.1| phosphoglucosamine mutase [Thermodesulfovibrio yellowstonii DSM
           11347]
 gi|254798603|sp|B5YGX0|GLMM_THEYD RecName: Full=Phosphoglucosamine mutase
 gi|206743050|gb|ACI22107.1| phosphoglucosamine mutase [Thermodesulfovibrio yellowstonii DSM
           11347]
          Length = 451

 Score =  405 bits (1042), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 200/452 (44%), Positives = 303/452 (67%), Gaps = 9/452 (1%)

Query: 4   RFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHR-RVVIGKDTRLSGYMLENSL 62
           R FGTDGIRG  N +P+TP   +R G+A+ +L + +  H+ +++IGKDTR+SGY++E++L
Sbjct: 2   RIFGTDGIRGTINNYPMTPEVCLRAGMALCFLLKKRLPHKPKILIGKDTRISGYVIESAL 61

Query: 63  VAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVS 122
            +G T+ G D +++GPIP+PAVA L +S+R D G++ISASHNP+ DNGIK+F  DG+K++
Sbjct: 62  TSGITSMGGDVYLVGPIPTPAVAFLVKSMRVDAGIVISASHNPFSDNGIKIFSNDGFKLT 121

Query: 123 TDIEDRIETLLED-DLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVV 181
            ++E+ IE L+ D D  +       +G A R++    RYIE +K TLP+D  L+GL++ +
Sbjct: 122 EELENDIEKLINDKDFPAIRPSARELGKAYRIEDAQGRYIEFIKSTLPKDSNLEGLKVAI 181

Query: 182 DCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIA 241
           D ANGA+YK+ P +F ELGA+V+ I DKP+G+NIN +CG+    SL + V E +A  G+A
Sbjct: 182 DPANGAAYKITPTLFHELGAEVITINDKPDGVNINKECGALYPESLIKIVKETQAHFGVA 241

Query: 242 LDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLG 301
            DGD DR I+VDEKG IV+GD I+ ++A E      L+ N +V T+M+N+G+E ++   G
Sbjct: 242 HDGDADRTILVDEKGNIVDGDFILTILAEELKKERKLKKNTVVATIMTNMGVENYLKNAG 301

Query: 302 LSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKP 361
           + + RT+VGD+Y++E M   G+N+GGEQSGHII  DY +TGDG + A+Q+   IK+    
Sbjct: 302 IKMIRTKVGDKYVVEEMLKGGYNLGGEQSGHIICMDYTNTGDGPITAVQMAYIIKKNQFY 361

Query: 362 VSTICHCFEEYPQFLRSVSV-----KDTSILNSSSIVQAIADAESELRGIDRLIVRASGT 416
           +S +      YPQ L+++ +     KD        + Q  +  E  +RG  R+I+R SGT
Sbjct: 362 LSELIKNIPRYPQALKNIKIPEKLPKDEVKNVIKKLSQKASTLEKNMRG--RIIIRPSGT 419

Query: 417 ESLIRIMAEGDDLSRIKRIVDDLAKVIPMIDS 448
           E  IRIM E ++  R+K+++D+L  V  M+ S
Sbjct: 420 EPKIRIMVEDENPERLKQVLDELEAVANMMLS 451


>gi|239907206|ref|YP_002953947.1| phosphoglucosamine mutase [Desulfovibrio magneticus RS-1]
 gi|259647717|sp|C4XU39|GLMM_DESMR RecName: Full=Phosphoglucosamine mutase
 gi|239797072|dbj|BAH76061.1| phosphoglucosamine mutase [Desulfovibrio magneticus RS-1]
          Length = 450

 Score =  405 bits (1041), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 208/445 (46%), Positives = 293/445 (65%), Gaps = 2/445 (0%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M  + FGTDG+RG+ N +P+TP+ +MR+ ++ G  FR   +  +V+IGKDTR SGY+ E 
Sbjct: 1   MDNKLFGTDGLRGRVNAYPMTPDVVMRLALSAGLHFRNGSRRHKVLIGKDTRRSGYIYEY 60

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +L +GF AAGMD F+ GP+P+PA++ LTR +RADVGV+ISASHNP  DNGIK F   G+K
Sbjct: 61  ALSSGFCAAGMDVFLTGPLPTPAISFLTRDMRADVGVVISASHNPACDNGIKFFDHMGFK 120

Query: 121 VSTDIEDRIETLLEDDLTSY-LSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRI 179
           +   +E  I   +E     + L   D +G A +++    RY   +K ++P DV  +GL+I
Sbjct: 121 LPDAVEAEIAARVEGYAQDWRLPDPDHVGRAFKLEDSPGRYNVFLKNSIPLDVNFEGLKI 180

Query: 180 VVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIG 239
           V+DCA+GA+Y+V P+VF ELGA V+ IG  P+G NIN   GS     + R V E  ADIG
Sbjct: 181 VLDCAHGAAYRVTPQVFEELGAKVIKIGVDPDGSNINQRVGSLFPQQVARMVAEAEADIG 240

Query: 240 IALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAG 299
           IALDGD DRVI+ DEKG I++GDQIMA+ A + M    L GN +V TVMSN+ LE F+  
Sbjct: 241 IALDGDADRVIVADEKGRILDGDQIMAICALDLMERGALPGNLLVATVMSNMALEVFMKD 300

Query: 300 LGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYD 359
            G  L RT VGDRY++E M+  G   GGEQSGH+I  ++ +TGDG +AALQ+++ + +  
Sbjct: 301 HGGRLLRTPVGDRYVVEAMRAQGAVFGGEQSGHLIFLNHSTTGDGTLAALQLMKIMVRKG 360

Query: 360 KPVSTICHCFEEYPQFLRSVSV-KDTSILNSSSIVQAIADAESELRGIDRLIVRASGTES 418
           KP+S +      +PQ L +V V +      + +I  A+ DAE+ L G  R+++R SGTES
Sbjct: 361 KPLSELATLLSPFPQKLVNVPVARKIPFSEAPAIEAAVKDAEATLSGRGRVLLRYSGTES 420

Query: 419 LIRIMAEGDDLSRIKRIVDDLAKVI 443
           L R+M E  D + ++ + D LA+V+
Sbjct: 421 LARVMVEAQDAALVESLCDSLAEVV 445


>gi|313673401|ref|YP_004051512.1| phosphoglucosamine mutase [Calditerrivibrio nitroreducens DSM
           19672]
 gi|312940157|gb|ADR19349.1| phosphoglucosamine mutase [Calditerrivibrio nitroreducens DSM
           19672]
          Length = 450

 Score =  405 bits (1041), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 210/439 (47%), Positives = 295/439 (67%), Gaps = 6/439 (1%)

Query: 3   RRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFR-GKKKHRRVVIGKDTRLSGYMLENS 61
           R++FGTDGIRGK+N FP+TP+F M++G A   +FR G+KKH+ +VIGKDTR+S YM E S
Sbjct: 2   RKYFGTDGIRGKANLFPMTPDFAMKLGQAAATIFRRGEKKHK-IVIGKDTRISSYMFEYS 60

Query: 62  LVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKV 121
           + +G  + G+D  ++G +P+PA++ +TRSLRAD G++ISASHNPY DNGIK F  DGYK+
Sbjct: 61  IASGICSMGVDVVLVGVLPTPAISFITRSLRADAGIVISASHNPYYDNGIKFFSSDGYKL 120

Query: 122 STDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVV 181
             ++E  +E  +++D     +    +G   R++    RY+E  K +  ++  L GL+IVV
Sbjct: 121 PDELELEMERFIDEDKAVLEAV---VGRVTRIETAIGRYVEFAKSSFDKNYDLSGLKIVV 177

Query: 182 DCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIA 241
           DCANGA YKVAP  F ELGADV+VI DKPNG NIN  CG+ +  ++ +KV EV AD+GIA
Sbjct: 178 DCANGAMYKVAPMAFAELGADVIVINDKPNGYNINEGCGAVHPETVAKKVIEVGADLGIA 237

Query: 242 LDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLG 301
            DGDGDR I VDE G IV+GD I+ +  +      +L  N +V TVMSN+G ER +  +G
Sbjct: 238 FDGDGDRAIFVDEYGVIVDGDYILGICGKFMKEKGILNQNTLVATVMSNLGFERSLNKIG 297

Query: 302 LSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKP 361
           +++ R +VGDRY++E M+  G N+GGEQSGHII SDY +TGDGL+ ALQ+L+ I    K 
Sbjct: 298 INIIRCDVGDRYVIEQMRTFGLNLGGEQSGHIIFSDYNTTGDGLITALQLLKVIVTTGKK 357

Query: 362 VSTICHCFEEYPQFLRSVSV-KDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
           +S +      YPQ L++ SV +   I +  +  + I +   +L    R+ VR SGTE+ I
Sbjct: 358 LSELQSFISVYPQVLKNASVNRKVPIEDLKNTSKLIKEFSEQLGRDGRVFVRYSGTENKI 417

Query: 421 RIMAEGDDLSRIKRIVDDL 439
           R+M EG D  +I  I + +
Sbjct: 418 RVMVEGIDYEKIDYIANSI 436


>gi|271499170|ref|YP_003332195.1| phosphoglucosamine mutase [Dickeya dadantii Ech586]
 gi|270342725|gb|ACZ75490.1| phosphoglucosamine mutase [Dickeya dadantii Ech586]
          Length = 445

 Score =  405 bits (1041), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 211/444 (47%), Positives = 303/444 (68%), Gaps = 9/444 (2%)

Query: 3   RRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSL 62
           R++FGTDGIRGK    PITP+F++++G A G +   +   R+++IGKDTR+SGYMLE++L
Sbjct: 4   RKYFGTDGIRGKVGDLPITPDFVLKLGWAAGKVL-ARHGSRKIIIGKDTRISGYMLESAL 62

Query: 63  VAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVS 122
            AG  AAG+ A   GP+P+PAVA LTR+ RA+ G++ISASHNPY DNGIK F  DG K+ 
Sbjct: 63  EAGLAAAGLSASFTGPMPTPAVAYLTRTFRAEAGIVISASHNPYYDNGIKFFSIDGTKLP 122

Query: 123 TDIEDRIETLLEDDLTSYLSCYDS--IGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
            ++E+ IE  +E  LT    C +S  +G A R+     RYIE  K T P +++L GL+IV
Sbjct: 123 DEVEEAIEAEMEKPLT----CVESAELGRASRIVDAAGRYIEFCKSTFPSELSLNGLKIV 178

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           VDCANGA+Y +AP V  ELGA V+ IG +P+G+NIN  CG+T+V  LQ +V   +AD+G+
Sbjct: 179 VDCANGATYHIAPSVLRELGAKVIAIGCEPDGVNINEQCGATDVTQLQERVLSEKADVGL 238

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           A DGDGDR+I+VD +G  V+GDQI+ +IARE +    LRG G V T+MSN+GLE  +  L
Sbjct: 239 AFDGDGDRLIMVDHQGNKVDGDQILYIIAREALRQGQLRG-GAVGTLMSNMGLEVALKQL 297

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           G+   R +VGDRY++E M++ G+ +G E SGH+IL D  +TGDG++A LQVL  + +   
Sbjct: 298 GVPFARAKVGDRYVLELMQSKGWRMGAENSGHVILLDKTTTGDGVIAGLQVLTAMVRNHM 357

Query: 361 PVSTICHCFEEYPQFLRSVSVK-DTSILNSSSIVQAIADAESELRGIDRLIVRASGTESL 419
            +  +C   + +PQ L +V    +   L S ++ QA  D E++L G  R+++R SGTE L
Sbjct: 358 SLHDLCSGMKLFPQILVNVHFSGEGDPLESDAVKQATLDVETQLAGRGRVLLRKSGTEPL 417

Query: 420 IRIMAEGDDLSRIKRIVDDLAKVI 443
           IR+M EG+D + + ++ + +A  +
Sbjct: 418 IRVMVEGEDEATVTQMANHIADAV 441


>gi|292493671|ref|YP_003529110.1| phosphoglucosamine mutase [Nitrosococcus halophilus Nc4]
 gi|291582266|gb|ADE16723.1| phosphoglucosamine mutase [Nitrosococcus halophilus Nc4]
          Length = 448

 Score =  405 bits (1040), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 215/448 (47%), Positives = 306/448 (68%), Gaps = 7/448 (1%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVG-YLFRGKKKHRRVVIGKDTRLSGYMLE 59
           MK+++FGTDGIRG+    PIT +F++ +G AVG  L RG++   +V+IGKDTR+SGYM E
Sbjct: 1   MKKKYFGTDGIRGRVGEHPITADFVLHLGWAVGRVLARGRQS--KVLIGKDTRISGYMFE 58

Query: 60  NSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGY 119
           ++L AG +AAG+D  +LGP+P+PA+A LTR+L A+ G++ISASHNPY DNGIK F   G 
Sbjct: 59  SALQAGLSAAGVDIRLLGPMPTPAIAYLTRTLHAEAGIVISASHNPYYDNGIKFFSSAGT 118

Query: 120 KVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRI 179
           K+  +IE  IE  LE  + +  S    +G A+RV     RYIE  K T P  V L GLR+
Sbjct: 119 KLPDEIEFAIEKELEGPMQTVDS--SRLGKAERVVDAAGRYIEFCKGTGPASVDLSGLRL 176

Query: 180 VVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIG 239
           VVDCA+GA+Y VA EVF E+GA+V+ IG  PNG+NIN   GS    +LQRKV E +AD+G
Sbjct: 177 VVDCAHGATYHVASEVFAEMGAEVIAIGISPNGLNINEGYGSIAPEALQRKVLECKADVG 236

Query: 240 IALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAG 299
           IALDGDGDRVI+VD +G IV+GD+++  IAR       +   G+V T+MSN+GLE+ +A 
Sbjct: 237 IALDGDGDRVIMVDHRGEIVDGDEMLYTIARARQRTDRMM-EGVVGTLMSNLGLEKALAA 295

Query: 300 LGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYD 359
           LG+ L R +VGDRY++E +++NG+++GGE SGHII  D  +TGDG+V+ALQVL  +    
Sbjct: 296 LGIPLMRAQVGDRYVLEMLQSNGYSLGGESSGHIICLDRTTTGDGIVSALQVLVEMVATG 355

Query: 360 KPVSTICHCFEEYPQFLRSVSVKDTSILN-SSSIVQAIADAESELRGIDRLIVRASGTES 418
             +  +     +YPQ L +V V+    L+ + ++  A+ + E++L    R+++R SGTE 
Sbjct: 356 CSLHELKSAMTKYPQCLINVRVEQRVELHGNGAVTSAVKEIENQLGEEGRVLLRPSGTEP 415

Query: 419 LIRIMAEGDDLSRIKRIVDDLAKVIPMI 446
           ++R+M EG D S++  +   LA+ I  +
Sbjct: 416 VVRVMVEGRDASQVNTLAQQLAQEIAFL 443


>gi|114046904|ref|YP_737454.1| phosphoglucosamine mutase [Shewanella sp. MR-7]
 gi|123326693|sp|Q0HWV8|GLMM2_SHESR RecName: Full=Phosphoglucosamine mutase 2
 gi|113888346|gb|ABI42397.1| phosphoglucosamine mutase [Shewanella sp. MR-7]
          Length = 450

 Score =  405 bits (1040), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 211/449 (46%), Positives = 300/449 (66%), Gaps = 8/449 (1%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M R++FGTDG+RGK  TFPITP+F M++G A G +       + V+IGKDTR+SGYMLE+
Sbjct: 1   MSRKYFGTDGVRGKVGTFPITPDFAMKLGWAAGTVL-ASTGTKEVLIGKDTRISGYMLES 59

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           ++ AGF+AAG++  ++GP+P+PAVA L  + RAD GV+ISASHNP+ DNGIK F   G K
Sbjct: 60  AMEAGFSAAGVNVALIGPMPTPAVAYLASTFRADAGVVISASHNPFYDNGIKFFSNTGTK 119

Query: 121 VSTDIEDRIETLLEDDLT-SYLSCYDS--IGHAKRVDGVHDRYIEHVKRTLPRDVTLQGL 177
           ++   E  IE LLE  L  + L C  S  +G  +R+D    RYIE  K T P  ++L GL
Sbjct: 120 LNDAQELEIEALLEQALEHNALQCVASEKLGKVRRIDDAAGRYIEFCKGTFPNHLSLAGL 179

Query: 178 RIVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRAD 237
           +IVVD A+GA+Y +AP V+ ELGA+V+ I DKPNG+NIN  CG+T++ SLQ  V    AD
Sbjct: 180 KIVVDSAHGAAYHIAPNVYRELGAEVISINDKPNGVNINDHCGATHLDSLQSAVMIHEAD 239

Query: 238 IGIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFI 297
           +GIALDGD DRV+ VD  G +V+GD+I+ ++A+       ++G G+V T+MSN+GLE  +
Sbjct: 240 LGIALDGDADRVMFVDHNGHVVDGDEILFILAQAAYQKGEMQG-GVVGTLMSNLGLELAL 298

Query: 298 AGLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQ 357
             +G+   R +VGDRY++E +K  G+ +GGE SGHI+   + STGDG+VA+LQVL+ I +
Sbjct: 299 KQMGIPFLRAKVGDRYVVEQLKETGWQLGGEGSGHILSLQHASTGDGIVASLQVLKAILE 358

Query: 358 YDKPVSTICHCFEEYPQFL---RSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRAS 414
             K ++ +     + PQ L   R  S    SIL+  S+ QA+  AE  L    R+++R S
Sbjct: 359 SGKRLAELKAGMTKLPQVLINVRLTSGSADSILSKDSVKQAVITAEEVLGNQGRVLLRKS 418

Query: 415 GTESLIRIMAEGDDLSRIKRIVDDLAKVI 443
           GTE LIR+M E  D+S  ++  + +A+ +
Sbjct: 419 GTEPLIRVMVESTDISLTQQQAEYIAQAV 447


>gi|114778679|ref|ZP_01453491.1| Phosphoglucomutase/phosphomannomutase [Mariprofundus ferrooxydans
           PV-1]
 gi|114551041|gb|EAU53603.1| Phosphoglucomutase/phosphomannomutase [Mariprofundus ferrooxydans
           PV-1]
          Length = 447

 Score =  404 bits (1039), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 206/445 (46%), Positives = 293/445 (65%), Gaps = 8/445 (1%)

Query: 3   RRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFR---GKKKHRRVVIGKDTRLSGYMLE 59
           RR+FGTDG+RG  N  P++  F + +G A G++     G K H  ++IGKDTRLSGYM+E
Sbjct: 2   RRYFGTDGVRGTVNQEPMSAEFSLVLGRAAGHVLTRHLGHKPH--ILIGKDTRLSGYMIE 59

Query: 60  NSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGY 119
           ++L AG TA GM+  ++GP+P+PAVA LTRSLRAD GVM+SASHNP  DNGIK F  DG+
Sbjct: 60  SALCAGLTAQGMNVLLVGPVPTPAVAYLTRSLRADAGVMLSASHNPAGDNGIKFFAADGF 119

Query: 120 KVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRI 179
           K+  +IE  IE  +  D    L     IG A RVD    RYIE +K  LPR +   GL++
Sbjct: 120 KLPDEIELEIEHCI--DHLPPLPPALEIGKAARVDDARGRYIEFLKSALPRGMRFDGLKV 177

Query: 180 VVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIG 239
           V+DCANGA+Y VAP +  ELG +VV +   P+G NIN DCGST+   + ++V E  ADIG
Sbjct: 178 VIDCANGAAYDVAPRILRELGCEVVAMAASPDGFNINRDCGSTHPERMTQRVVECGADIG 237

Query: 240 IALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAG 299
           +ALDGD DR+I  D +G IV+GD+++A++A    +   L G  +VTT+MSN+GLER+++G
Sbjct: 238 LALDGDADRLIACDARGQIVDGDRVIAILAEHAAAQGGLTGGAVVTTLMSNMGLERYLSG 297

Query: 300 LGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYD 359
           LGL++ R  VGDRY++E M++ G N+GGEQSGH+I+ DY +TGDGL+  LQ+L  + +  
Sbjct: 298 LGLAMHRAAVGDRYVLEMMRDTGCNMGGEQSGHMIMLDYNTTGDGLMTGLQLLLAMSEQG 357

Query: 360 KPVSTICHCFEEYPQFLRSVSVK-DTSILNSSSIVQAIADAESELRGIDRLIVRASGTES 418
           K ++ +      +PQ L ++ +     ++   ++   +  AE  L G  R+ VR SGTE 
Sbjct: 358 KALADMASDMPLFPQKLWNIVMPVRRDVMADDAVCLLVEQAEGRLGGNGRVNVRMSGTEP 417

Query: 419 LIRIMAEGDDLSRIKRIVDDLAKVI 443
            +RIM E +D + +  + + L + I
Sbjct: 418 KLRIMVEAEDETLMLDVGESLVEAI 442


>gi|76789559|ref|YP_328645.1| phosphoglucosamine mutase [Chlamydia trachomatis A/HAR-13]
 gi|237803247|ref|YP_002888441.1| phosphoglucosamine mutase [Chlamydia trachomatis B/Jali20/OT]
 gi|237805168|ref|YP_002889322.1| phosphoglucosamine mutase [Chlamydia trachomatis B/TZ1A828/OT]
 gi|255311654|ref|ZP_05354224.1| phosphoglucosamine mutase [Chlamydia trachomatis 6276]
 gi|255317955|ref|ZP_05359201.1| phosphoglucosamine mutase [Chlamydia trachomatis 6276s]
 gi|123606565|sp|Q3KKM5|GLMM_CHLTA RecName: Full=Phosphoglucosamine mutase
 gi|76168089|gb|AAX51097.1| phosphoglucosamine mutase [Chlamydia trachomatis A/HAR-13]
 gi|231273468|emb|CAX10384.1| phosphoglucosamine mutase [Chlamydia trachomatis B/TZ1A828/OT]
 gi|231274481|emb|CAX11277.1| phosphoglucosamine mutase [Chlamydia trachomatis B/Jali20/OT]
 gi|296436369|gb|ADH18543.1| phosphoglucosamine mutase [Chlamydia trachomatis G/9768]
 gi|296437300|gb|ADH19470.1| phosphoglucosamine mutase [Chlamydia trachomatis G/11222]
 gi|296438228|gb|ADH20389.1| phosphoglucosamine mutase [Chlamydia trachomatis G/11074]
 gi|297140729|gb|ADH97487.1| phosphoglucosamine mutase [Chlamydia trachomatis G/9301]
          Length = 458

 Score =  404 bits (1039), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 208/443 (46%), Positives = 295/443 (66%), Gaps = 6/443 (1%)

Query: 3   RRFFGTDGIRGKSNTFPITPNFMMRIGIAV-GYLFRGKKKHRRVVIGKDTRLSGYMLENS 61
           R+ FGTDG+RG++N  P+T    + +G AV G L        RVV+GKDTRLSGYM EN+
Sbjct: 6   RQLFGTDGVRGRANFEPMTVETSVLLGKAVAGVLLEKHAGKHRVVVGKDTRLSGYMFENA 65

Query: 62  LVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKV 121
           L+AG T+ G++  +LGPIP+P VA +TR+ RAD G+MISASHNPY+DNGIK+F  DG+K+
Sbjct: 66  LIAGLTSMGIETLMLGPIPTPGVAFITRAYRADAGIMISASHNPYRDNGIKIFSSDGFKI 125

Query: 122 STDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVV 181
              +E+RIE ++       L    ++G  KRV     RYIE+ K T P+  TL+GLRIV+
Sbjct: 126 GQAVEERIEAMVASKDFGKLPDDHAVGKNKRVKDATGRYIEYAKATFPKGRTLKGLRIVL 185

Query: 182 DCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIA 241
           DCA+GA+Y+VAP VF EL A+V+  G +P+G NIN  CG+    ++Q+ V E +AD+GIA
Sbjct: 186 DCAHGATYRVAPSVFEELDAEVICYGCEPSGCNINAGCGALWPSTIQKAVIEHKADVGIA 245

Query: 242 LDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLG 301
           LDGDGDR+I+VDEKG IV+GD ++++ A +      L  N +V TVM+N G+ R++  LG
Sbjct: 246 LDGDGDRLIMVDEKGHIVDGDMLLSICASDLKRRQALSDNRVVATVMTNFGVLRYLESLG 305

Query: 302 LSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKP 361
           + +  + VGDR+++++M  N   +GGEQSGH+I  DY +TGDG+V+ALQVLR + + +  
Sbjct: 306 IQVTISPVGDRHVLQHMLENQAVLGGEQSGHMIFLDYNTTGDGIVSALQVLRIMIESEST 365

Query: 362 VSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGID-RLIVRASGTESLI 420
           +S +  C  + PQ L +V V     L S + VQ +     E+ G   R+++R SGTE++ 
Sbjct: 366 LSDLTACIAKSPQALINVPVTKKVPLESLANVQGVLKEVKEVLGDSGRILLRYSGTENIC 425

Query: 421 RIMAEGDDLSRIKRIVDDLAKVI 443
           R+M EG      K  VD LAK I
Sbjct: 426 RVMVEGTK----KHQVDSLAKTI 444


>gi|198284349|ref|YP_002220670.1| phosphoglucosamine mutase [Acidithiobacillus ferrooxidans ATCC
           53993]
 gi|218666750|ref|YP_002427011.1| phosphoglucosamine mutase [Acidithiobacillus ferrooxidans ATCC
           23270]
 gi|198248870|gb|ACH84463.1| phosphoglucosamine mutase [Acidithiobacillus ferrooxidans ATCC
           53993]
 gi|218518963|gb|ACK79549.1| phosphoglucosamine mutase [Acidithiobacillus ferrooxidans ATCC
           23270]
          Length = 454

 Score =  404 bits (1039), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 205/427 (48%), Positives = 299/427 (70%), Gaps = 7/427 (1%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHR-RVVIGKDTRLSGYMLE 59
           M R++FGTDG+RG+     I P +++R+G A G++       R RVVIGKDTRLSGYMLE
Sbjct: 1   MTRKWFGTDGVRGQVGDSVIHPEWVLRLGWAAGHVLTADAPGRPRVVIGKDTRLSGYMLE 60

Query: 60  NSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGY 119
           ++L +G  AAG+D  ++GP+P+PA+A LTR+LRAD G++ISASHNPYQDNGIK F  DGY
Sbjct: 61  SALESGLAAAGVDVLLVGPLPTPAIAYLTRTLRADAGIVISASHNPYQDNGIKFFSGDGY 120

Query: 120 KVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRI 179
           K+    E+ IE  ++  +   LS  + +G A+RVD    RY+E  K T P D+ L+G+ +
Sbjct: 121 KLPDAQEEAIEAWMDRPMA--LSASERLGKARRVDDAAGRYVEFCKTTFPADLDLRGIHL 178

Query: 180 VVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIG 239
           V+DCA+GA+YKVAP +F ELGA + ++G +PNG+NIN   GST+  +L+  V    AD+G
Sbjct: 179 VLDCAHGANYKVAPMIFGELGATLELLGAEPNGVNINDQVGSTHPEALRAAVLRTGADVG 238

Query: 240 IALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAG 299
           IA DGDGDR+++VD +G +++GD+I+ L+AR    +  L  +G+V TVMSN+ LE+ +AG
Sbjct: 239 IAFDGDGDRLLLVDGRGELLDGDEILWLLARNMCQNGGL--SGVVGTVMSNLALEQALAG 296

Query: 300 LGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYD 359
            G+ + RT VGDRY++E M+ +G+ +GGE SGHII +   +TGDG++AAL++L  +++  
Sbjct: 297 CGVPMLRTPVGDRYVLEAMRRHGYPLGGESSGHII-TPANTTGDGILAALRILAILRRSG 355

Query: 360 KPVSTICHCFEEYPQFLRSVSVKDT-SILNSSSIVQAIADAESELRGIDRLIVRASGTES 418
             ++ +   +  +PQ L+SV +    ++L+ SS  Q IADAE  L G  RL+VR SGTE 
Sbjct: 356 VTLAALREGYSAFPQVLKSVRMAGAQTLLDQSSAHQLIADAEDRLGGSGRLLVRPSGTEP 415

Query: 419 LIRIMAE 425
           ++RIM E
Sbjct: 416 VLRIMVE 422


>gi|253991506|ref|YP_003042862.1| phosphoglucosamine mutase [Photorhabdus asymbiotica subsp.
           asymbiotica ATCC 43949]
 gi|211638384|emb|CAR67006.1| phosphoglucosamine mutase (ec 5.4.2.10) [Photorhabdus asymbiotica
           subsp. asymbiotica ATCC 43949]
 gi|253782956|emb|CAQ86121.1| phosphoglucosamine mutase [Photorhabdus asymbiotica]
          Length = 445

 Score =  404 bits (1039), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 215/442 (48%), Positives = 297/442 (67%), Gaps = 5/442 (1%)

Query: 3   RRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSL 62
           R++FGTDGIRGK    PITP+F++++G A G +   +   R+++IGKDTR+SGYMLE+SL
Sbjct: 4   RKYFGTDGIRGKVGDSPITPDFVLKLGWAAGKVL-ARHGSRKIIIGKDTRISGYMLESSL 62

Query: 63  VAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVS 122
            AG  AAG+ A   GP+P+PAVA LTR+ RA+ G++ISASHNPY DNGIK F  DG K+ 
Sbjct: 63  EAGLAAAGLSASFTGPMPTPAVAYLTRTFRAEAGIVISASHNPYYDNGIKFFSIDGTKLP 122

Query: 123 TDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVVD 182
            D+E+ IE  +E  LT   S    +G A R+     RYIE  K T P + +L GL+IV+D
Sbjct: 123 DDVEEAIEAEMEKSLTCVESA--ELGRANRIVDAAGRYIEFCKGTFPSEQSLNGLKIVLD 180

Query: 183 CANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIAL 242
           CANGA+Y +AP V  ELGA+VV IG +PNGININ  CG+T+V  LQ++V E +AD+G+A 
Sbjct: 181 CANGATYHIAPNVLRELGANVVTIGCEPNGININEKCGATDVRLLQQRVVEEKADVGLAF 240

Query: 243 DGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLGL 302
           DGDGDRVI+VD  G  V+GDQI+ +IARE +    LRG G+V T+MSN+GLE  +  LG+
Sbjct: 241 DGDGDRVIMVDHLGQKVDGDQILYIIAREALRQGQLRG-GVVGTLMSNMGLELALKQLGI 299

Query: 303 SLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKPV 362
              R +VGDRY++E ++  G+ +G E SGHIIL D  +TGDG+VA LQVL  + +    +
Sbjct: 300 PFLRAKVGDRYVLEKLQEEGWRLGAENSGHIILLDKTTTGDGIVAGLQVLSAMVRNHMNL 359

Query: 363 STICHCFEEYPQFLRSVSVKDT-SILNSSSIVQAIADAESELRGIDRLIVRASGTESLIR 421
             +C   +  PQ L +V    +   L S +++      E+EL G  R+++R SGTE LIR
Sbjct: 360 HDLCSGMKLLPQVLVNVRFSGSYDPLQSENVINVTKSVEAELNGCGRVLLRKSGTEPLIR 419

Query: 422 IMAEGDDLSRIKRIVDDLAKVI 443
           +M EG+D  ++  +   +A  +
Sbjct: 420 VMVEGEDNEQVTALAHRIADAV 441


>gi|146313244|ref|YP_001178318.1| phosphoglucosamine mutase [Enterobacter sp. 638]
 gi|166990415|sp|A4WEY7|GLMM_ENT38 RecName: Full=Phosphoglucosamine mutase
 gi|145320120|gb|ABP62267.1| phosphoglucosamine mutase [Enterobacter sp. 638]
          Length = 445

 Score =  404 bits (1039), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 207/447 (46%), Positives = 304/447 (68%), Gaps = 14/447 (3%)

Query: 3   RRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSL 62
           R++FGTDGIRG+    PITP F++++G A G +   +   R+++IGKDTR+SGYMLE++L
Sbjct: 4   RKYFGTDGIRGRVGDAPITPEFVLKLGWAAGKVL-ARHGSRKIIIGKDTRISGYMLESAL 62

Query: 63  VAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVS 122
            AG +AAG+ A   GP+P+PAVA LTR+ RA+ G++ISASHNP+ DNGIK F  DG K+ 
Sbjct: 63  EAGLSAAGLSASFTGPMPTPAVAYLTRTFRAEAGIVISASHNPFYDNGIKFFSIDGTKLP 122

Query: 123 TDIEDRIETLLEDDLTSYLSCYDS--IGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
            ++E+ IE  +E +LT    C DS  +G A R+     RYIE  K T P +++L  L+IV
Sbjct: 123 DEVEEAIEAEMEKELT----CVDSSELGKASRIVDAAGRYIEFCKGTFPNELSLSHLKIV 178

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           VDCANGA+Y +AP VF ELGA V+ IG +P+G+NIN + G+T+V +LQ +V   +AD+GI
Sbjct: 179 VDCANGATYHIAPNVFRELGAKVIAIGCEPDGLNINEEVGATDVRALQARVLAEKADLGI 238

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           A DGDGDRVI+VD +G  V+GDQI+ +IARE +    LRG G V T+MSN+GLE  +  L
Sbjct: 239 AFDGDGDRVIMVDHEGNKVDGDQILYIIAREGLRQGQLRG-GAVGTLMSNMGLELALKQL 297

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           G+   R +VGDRY++E ++  G+ +G E SGH+IL D  +TGDG+VA+LQV+  + +   
Sbjct: 298 GIPFARAKVGDRYVLEKLQEKGWRIGAENSGHVILLDKTTTGDGIVASLQVVAAMVRNHM 357

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTS----ILNSSSIVQAIADAESELRGIDRLIVRASGT 416
            +  +C   + +PQ L  V+V+ T+     L + ++   +A+ E+ L    R+++R SGT
Sbjct: 358 NLHDLCSGMKMFPQIL--VNVRFTAGKGDPLENENVKAVMAEVEAALGNRGRVLLRKSGT 415

Query: 417 ESLIRIMAEGDDLSRIKRIVDDLAKVI 443
           E LIR+M EG++ +++      +A  +
Sbjct: 416 EPLIRVMVEGEEEAQVTEFAHRIADAV 442


>gi|15605550|ref|NP_220336.1| phosphoglucosamine mutase [Chlamydia trachomatis D/UW-3/CX]
 gi|81345322|sp|O84822|GLMM_CHLTR RecName: Full=Phosphoglucosamine mutase
 gi|3329284|gb|AAC68412.1| Phosphoglucomutase [Chlamydia trachomatis D/UW-3/CX]
 gi|297748944|gb|ADI51490.1| Phosphoglucosamine mutase [Chlamydia trachomatis D-EC]
 gi|297749824|gb|ADI52502.1| Phosphoglucosamine mutase [Chlamydia trachomatis D-LC]
          Length = 458

 Score =  404 bits (1038), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 207/443 (46%), Positives = 295/443 (66%), Gaps = 6/443 (1%)

Query: 3   RRFFGTDGIRGKSNTFPITPNFMMRIGIAV-GYLFRGKKKHRRVVIGKDTRLSGYMLENS 61
           R+ FGTDG+RG++N  P+T    + +G A+ G L        RVV+GKDTRLSGYM EN+
Sbjct: 6   RQLFGTDGVRGRANFEPMTVETSVLLGKAIAGVLLEKHAGKHRVVVGKDTRLSGYMFENA 65

Query: 62  LVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKV 121
           L+AG T+ G++  +LGPIP+P VA +TR+ RAD G+MISASHNPY+DNGIK+F  DG+K+
Sbjct: 66  LIAGLTSMGIETLMLGPIPTPGVAFITRAYRADAGIMISASHNPYRDNGIKIFSSDGFKI 125

Query: 122 STDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVV 181
              +E+RIE ++       L    ++G  KRV     RYIE+ K T P+  TL+GLRIV+
Sbjct: 126 GQAVEERIEAMVASKDFGKLPDDHAVGKNKRVKDATGRYIEYAKATFPKGRTLKGLRIVL 185

Query: 182 DCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIA 241
           DCA+GA+Y+VAP VF EL A+V+  G +P+G NIN  CG+    ++Q+ V E +AD+GIA
Sbjct: 186 DCAHGATYRVAPSVFEELDAEVICYGCEPSGCNINAGCGALWPSTIQKAVIEHKADVGIA 245

Query: 242 LDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLG 301
           LDGDGDR+I+VDEKG IV+GD ++++ A +      L  N +V TVM+N G+ R++  LG
Sbjct: 246 LDGDGDRLIMVDEKGHIVDGDMLLSICASDLKRRQALSDNRVVATVMTNFGVLRYLESLG 305

Query: 302 LSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKP 361
           + +  + VGDR+++++M  N   +GGEQSGH+I  DY +TGDG+V+ALQVLR + + +  
Sbjct: 306 IQVTISPVGDRHVLQHMLENQAVLGGEQSGHMIFLDYNTTGDGIVSALQVLRIMIESEST 365

Query: 362 VSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGID-RLIVRASGTESLI 420
           +S +  C  + PQ L +V V     L S + VQ +     E+ G   R+++R SGTE++ 
Sbjct: 366 LSDLTACIAKSPQALINVPVTKKVPLESLANVQGVLKEVKEVLGDSGRILLRYSGTENIC 425

Query: 421 RIMAEGDDLSRIKRIVDDLAKVI 443
           R+M EG      K  VD LAK I
Sbjct: 426 RVMVEGTK----KHQVDSLAKTI 444


>gi|261342619|ref|ZP_05970477.1| phosphoglucosamine mutase [Enterobacter cancerogenus ATCC 35316]
 gi|288315267|gb|EFC54205.1| phosphoglucosamine mutase [Enterobacter cancerogenus ATCC 35316]
          Length = 445

 Score =  404 bits (1038), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 206/445 (46%), Positives = 299/445 (67%), Gaps = 10/445 (2%)

Query: 3   RRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSL 62
           R++FGTDGIRG+    PITP+F++++G A G +   +   R+++IGKDTR+SGYMLE++L
Sbjct: 4   RKYFGTDGIRGRVGDAPITPDFVLKLGWAAGKVL-ARHGSRKIIIGKDTRISGYMLESAL 62

Query: 63  VAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVS 122
            AG +AAG+ A   GP+P+PAVA LTR+ RA+ G++ISASHNP+ DNGIK F  DG K+ 
Sbjct: 63  EAGLSAAGLSASFTGPMPTPAVAYLTRTFRAEAGIVISASHNPFYDNGIKFFSIDGTKLP 122

Query: 123 TDIEDRIETLLEDDLTSYLSCYDS--IGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
            ++E+ IE  +E ++T    C DS  +G A R+     RYIE  K T P +++L  L+IV
Sbjct: 123 DEVEEAIEAEMEKEIT----CVDSAELGKANRIVDAAGRYIEFCKGTFPNELSLAHLKIV 178

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           VDCANGA+Y +AP VF ELGA V+ IG +P+G+NIN + G+T+V +LQ +V   +AD+GI
Sbjct: 179 VDCANGATYHIAPNVFRELGAKVITIGCEPDGLNINEEVGATDVRALQARVLAEKADLGI 238

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           ALDGDGDRVI+VD +G  V+GDQI+ +IARE +    LRG G V T+MSN+GLE  +  L
Sbjct: 239 ALDGDGDRVIMVDHEGNKVDGDQILYIIAREGLRQGQLRG-GAVGTLMSNMGLELALKQL 297

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           G+   R +VGDRY++E ++  G+ +G E SGH+IL D  +TGDG+VA LQV+  + +   
Sbjct: 298 GIPFVRAKVGDRYVLEKLQEKGWRIGAENSGHVILLDKTTTGDGIVAGLQVVAAMARNHM 357

Query: 361 PVSTICHCFEEYPQFLRSV--SVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTES 418
            +  +C   + +PQ L +V  +      L +  +   +A  E  L    R+++R SGTE 
Sbjct: 358 SLHDLCSGMKLFPQILVNVRFTAGKGDPLENEQVKAVMAKVEEALGNRGRVLLRKSGTEP 417

Query: 419 LIRIMAEGDDLSRIKRIVDDLAKVI 443
           LIR+M EG+D +++      +A  +
Sbjct: 418 LIRVMVEGEDEAQVTEFAHRIADAV 442


>gi|62185369|ref|YP_220154.1| putative phosphoglucomutase [Chlamydophila abortus S26/3]
 gi|81312481|sp|Q5L588|GLMM_CHLAB RecName: Full=Phosphoglucosamine mutase
 gi|62148436|emb|CAH64204.1| putative phosphoglucomutase [Chlamydophila abortus S26/3]
          Length = 458

 Score =  404 bits (1038), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 218/451 (48%), Positives = 305/451 (67%), Gaps = 11/451 (2%)

Query: 3   RRFFGTDGIRGKSNTFPITPNFMMRIGIAV-GYLFRGKKKHRRVVIGKDTRLSGYMLENS 61
           ++ FGTDG+RGK+N  P+T    + +G AV G L   K    RVV+GKDTRLSGYM EN+
Sbjct: 6   KQLFGTDGVRGKANYEPMTVELSVLLGKAVAGVLQESKSGKHRVVVGKDTRLSGYMFENA 65

Query: 62  LVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKV 121
           LVAG T+ G++  +LGPIP+P VA +TR+ RAD G+MISASHNPY DNGIK+F  +G+K+
Sbjct: 66  LVAGLTSMGIETLVLGPIPTPGVAFITRAYRADAGIMISASHNPYWDNGIKIFSSEGFKI 125

Query: 122 STDIEDRIETLLEDDLTSYLSCYD--SIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRI 179
           S  IE RIE ++   L  + +  D  ++G  KRV     RYIE  K T PR  TL+GL+I
Sbjct: 126 SDVIERRIEQMVA--LKEFGNFPDDCAVGKNKRVVDAMGRYIEFAKATFPRGRTLKGLKI 183

Query: 180 VVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIG 239
           V+DCA+GA+YKVAP VF EL A+V+  G +P G NIN +CG+     +Q+ V E +AD+G
Sbjct: 184 VLDCAHGAAYKVAPSVFEELDAEVICYGCEPTGSNINDNCGALFPSVIQKAVIEHKADVG 243

Query: 240 IALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAG 299
           IALDGDGDRVI+VDEKG IV+GD I+++ A +     LLRGN ++ TVM+N G+ +++  
Sbjct: 244 IALDGDGDRVIMVDEKGHIVDGDMILSICANDLKKKDLLRGNRVIATVMTNFGVLKYLES 303

Query: 300 LGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYD 359
           +G+    + VGDR++++ M     N+GGEQSGH+I  DY +TGDG+V+ALQVLR + + +
Sbjct: 304 VGIEALISPVGDRHVLQNMLEYEVNLGGEQSGHMIFLDYNTTGDGIVSALQVLRIMIESE 363

Query: 360 KPVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQ-AIADAESELRGIDRLIVRASGTES 418
             +S +     + PQ L +V+VK+   L++  +VQ A+ D  S L    R+++R SGTE+
Sbjct: 364 STLSDLTSLIVKSPQALINVAVKEKIPLDTLPLVQEALRDVRSSLGDSGRVLLRYSGTEN 423

Query: 419 LIRIMAEGDDLSRIKRIVDDLAKVIP-MIDS 448
           + R+M EG      K  VD LAK I  ++DS
Sbjct: 424 ICRVMVEGLK----KHQVDSLAKTIADIVDS 450


>gi|29840546|ref|NP_829652.1| phosphoglucosamine mutase [Chlamydophila caviae GPIC]
 gi|81584452|sp|Q821Z6|GLMM_CHLCV RecName: Full=Phosphoglucosamine mutase
 gi|29834895|gb|AAP05530.1| phosphoglucosamine mutase [Chlamydophila caviae GPIC]
          Length = 458

 Score =  404 bits (1038), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 218/452 (48%), Positives = 310/452 (68%), Gaps = 11/452 (2%)

Query: 2   KRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKK--KHRRVVIGKDTRLSGYMLE 59
           +++ FGTDGIRG++N  P+T    + +G AV  + + +K  KHR VV+GKDTRLSGYM E
Sbjct: 5   EKQLFGTDGIRGRANYEPMTVELSVLLGKAVAGVLQERKPGKHR-VVVGKDTRLSGYMFE 63

Query: 60  NSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGY 119
           N+LVAG T+ G++  +LGPIP+P VA +TR+ RAD G+MISASHNPY DNGIK+F  +G+
Sbjct: 64  NALVAGLTSMGIETLVLGPIPTPGVAFITRAYRADAGIMISASHNPYWDNGIKIFSSEGF 123

Query: 120 KVSTDIEDRIETLLE-DDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLR 178
           K+S  IE RIE ++   D  ++   Y ++G  KRV     RYIE  K T P+  TL+GL+
Sbjct: 124 KISDVIERRIEQMVACRDFGNFPEDY-AVGKNKRVVDAMGRYIEFAKATFPKGRTLKGLK 182

Query: 179 IVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADI 238
           IV+DCA+GA+YKVAP VF EL A+V+  G +P G NIN +CG+     +Q+ V E +AD+
Sbjct: 183 IVLDCAHGAAYKVAPSVFEELDAEVICYGCEPTGSNINDNCGALFPSVIQKAVIEHKADV 242

Query: 239 GIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIA 298
           GIALDGDGDR+I+V+EKG IV+GD I+++ A +    +LL GN +V TVM+N G+ +++ 
Sbjct: 243 GIALDGDGDRIIMVNEKGHIVDGDMILSICASDLKKKALLNGNRVVATVMTNFGVLKYLE 302

Query: 299 GLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQY 358
            LG+    + VGDR++++ M  +  N+GGEQSGH+I  DY +TGDG+V+ALQVLR + + 
Sbjct: 303 SLGIETLISSVGDRHVLQNMLEHEANLGGEQSGHMIFLDYNTTGDGIVSALQVLRIMIES 362

Query: 359 DKPVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQ-AIADAESELRGIDRLIVRASGTE 417
           +  +S +     + PQ L +VSVK+   L++  IVQ A+ D  S L    R+++R SGTE
Sbjct: 363 ESTLSDLTSLIVKSPQALINVSVKEKIPLDTLPIVQEALRDVRSSLGDSGRVLLRYSGTE 422

Query: 418 SLIRIMAEGDDLSRIKRIVDDLAKVIP-MIDS 448
           ++ R+M EG      K  VD LAK I  ++DS
Sbjct: 423 NICRVMVEGLK----KHQVDSLAKTIADIVDS 450


>gi|87119796|ref|ZP_01075693.1| phosphoglucosamine mutase [Marinomonas sp. MED121]
 gi|86165272|gb|EAQ66540.1| phosphoglucosamine mutase [Marinomonas sp. MED121]
          Length = 445

 Score =  404 bits (1038), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 212/439 (48%), Positives = 294/439 (66%), Gaps = 6/439 (1%)

Query: 3   RRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSL 62
           R++FGTDGIRG+     ITP FM+++G A G +F  K+   +VVIGKDTR+SGYM E++L
Sbjct: 2   RKYFGTDGIRGRVGEGAITPEFMLKLGWAAGQVF--KENGNKVVIGKDTRISGYMFESAL 59

Query: 63  VAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVS 122
            AG  AAG+D  ++GP+P+PA+A LTR+ RA  G++ISASHNPY DNGIK F   G K+ 
Sbjct: 60  EAGLVAAGVDVRLVGPMPTPAIAYLTRTFRASAGIVISASHNPYTDNGIKFFSAAGAKLC 119

Query: 123 TDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVVD 182
            ++E++IE  L+  L    S  D+IG AKR+D    RYIE+ K T P  + L GL+IVVD
Sbjct: 120 DEMEEKIEHYLDQPLVVVPS--DNIGRAKRIDDAAGRYIEYCKGTFPIGMQLNGLKIVVD 177

Query: 183 CANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIAL 242
           CA+GA+Y VAP VF ELGA+VV+IGDKP+G+NIN + G+T    L+  V   +ADIGIAL
Sbjct: 178 CADGATYHVAPRVFSELGAEVVIIGDKPDGLNINENSGATKPELLRETVLAEKADIGIAL 237

Query: 243 DGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLGL 302
           DGDGDR+I+VD +G + +GD ++ +IA          G G+V T+MSN GLE   +  G+
Sbjct: 238 DGDGDRLIMVDAEGGVRDGDDVLYVIANHMRQTGKFSG-GVVGTLMSNFGLELAFSEQGI 296

Query: 303 SLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKPV 362
              R  VGDR++ E +   G+ +GGE SGHI+     +TGDG+VAALQVL+ + + +K +
Sbjct: 297 GFGRASVGDRFVNEKLTQLGWVLGGEPSGHIVCRSITTTGDGVVAALQVLQAMVEGEKTL 356

Query: 363 STICHCFEEYPQFLRSVSVKDT-SILNSSSIVQAIADAESELRGIDRLIVRASGTESLIR 421
             +   F ++PQ L+++ VK   S      + QAIA A  +L G  R+++RASGTE LIR
Sbjct: 357 LELLEGFTKFPQRLKNIRVKSRFSPTEVPQLQQAIAHANEKLNGSGRVLLRASGTEPLIR 416

Query: 422 IMAEGDDLSRIKRIVDDLA 440
           +M EGD+   +  +V  LA
Sbjct: 417 VMVEGDNSDLVDELVTSLA 435


>gi|251791039|ref|YP_003005760.1| phosphoglucosamine mutase [Dickeya zeae Ech1591]
 gi|247539660|gb|ACT08281.1| phosphoglucosamine mutase [Dickeya zeae Ech1591]
          Length = 445

 Score =  404 bits (1038), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 211/444 (47%), Positives = 303/444 (68%), Gaps = 9/444 (2%)

Query: 3   RRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSL 62
           R++FGTDGIRGK    PITP+F++++G A G +   +   R+++IGKDTR+SGYMLE++L
Sbjct: 4   RKYFGTDGIRGKVGDLPITPDFVLKLGWAAGKVL-ARHGSRKIIIGKDTRISGYMLESAL 62

Query: 63  VAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVS 122
            AG  AAG+ A   GP+P+PAVA LTR+ RA+ G++ISASHNPY DNGIK F  DG K+ 
Sbjct: 63  EAGLAAAGLSASFTGPMPTPAVAYLTRTFRAEAGIVISASHNPYYDNGIKFFSIDGTKLP 122

Query: 123 TDIEDRIETLLEDDLTSYLSCYDS--IGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
            ++E+ IE  +E  LT    C +S  +G A R+     RYIE  K T P +++L GL+IV
Sbjct: 123 DEVEEAIEAEMEKPLT----CVESAELGRASRIVDAAGRYIEFCKSTFPSELSLNGLKIV 178

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           VDCANGA+Y +AP V  ELGA V+ IG +P+G+NIN  CG+T+V  LQ +V   +AD+G+
Sbjct: 179 VDCANGATYHIAPSVLRELGARVIAIGCEPDGVNINEQCGATDVTQLQARVLSEKADVGL 238

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           A DGDGDR+I+VD +G  V+GDQI+ +IARE +    LRG G V T+MSN+GLE  +  L
Sbjct: 239 AFDGDGDRLIMVDHQGNKVDGDQILYIIAREALRQGQLRG-GAVGTLMSNMGLEVALKQL 297

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           G+   R +VGDRY++E M++ G+ +G E SGH+IL D  +TGDG++A LQVL  + +   
Sbjct: 298 GVPFARAKVGDRYVLELMQSKGWRLGAENSGHVILLDKTTTGDGIIAGLQVLTAMVRNHM 357

Query: 361 PVSTICHCFEEYPQFLRSVSVK-DTSILNSSSIVQAIADAESELRGIDRLIVRASGTESL 419
            +  +C   + +PQ L +V    +   L S ++ QA  D E++L G  R+++R SGTE L
Sbjct: 358 SLHDLCSGMKLFPQILVNVHFSGEGDPLESDAVKQASQDVEAQLAGRGRVLLRKSGTEPL 417

Query: 420 IRIMAEGDDLSRIKRIVDDLAKVI 443
           IR+M EG+D + + ++ + +A  +
Sbjct: 418 IRVMVEGEDEATVTQMANHIADAV 441


>gi|149195431|ref|ZP_01872514.1| putative phospho-sugar mutase [Caminibacter mediatlanticus TB-2]
 gi|149134436|gb|EDM22929.1| putative phospho-sugar mutase [Caminibacter mediatlanticus TB-2]
          Length = 440

 Score =  404 bits (1037), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 212/441 (48%), Positives = 281/441 (63%), Gaps = 8/441 (1%)

Query: 4   RFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSLV 63
           + FGTDG+RGK+    ITP   M + +A G      KK  ++++GKDTR SGYM+EN++V
Sbjct: 2   KLFGTDGVRGKAGEV-ITPFLSMNLAMAFGECI--PKKTGKILVGKDTRRSGYMIENAIV 58

Query: 64  AGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVST 123
           +G TA G D   +GP+P+PA+A LT  +R D G+MISASHNPY DNGIK F  +G K+S 
Sbjct: 59  SGLTAIGFDVIQIGPMPTPAIAFLTEDMRCDGGIMISASHNPYYDNGIKFFDSEGNKLSQ 118

Query: 124 DIEDRIET-LLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVVD 182
           DIE +IE    E++    L     IG +KR+D V  RYI H+K + P+ + L GLR+V+D
Sbjct: 119 DIEKQIEKRYFENNFE--LKTNKEIGKSKRIDDVIGRYIVHIKSSFPKHLNLNGLRVVLD 176

Query: 183 CANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIAL 242
            ANGA+YKVAP +F ELGADV+ I D PNG NINL+ G+ +   L  KV E RADIG A 
Sbjct: 177 TANGAAYKVAPTIFNELGADVITINDNPNGFNINLNAGAMHPEMLASKVREYRADIGFAF 236

Query: 243 DGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLGL 302
           DGD DR+++VDEKG IV+GD+++  +A      + LR N I  TVMSN GLE F+   G+
Sbjct: 237 DGDADRLVVVDEKGNIVDGDKLLGALAYYLHKKNKLRNNAIAVTVMSNGGLEEFLKQYGI 296

Query: 303 SLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKPV 362
            + R+ VGD+Y++E MK    N GGEQSGHII SDY  TGDGLV+ALQ + Y+ +  K  
Sbjct: 297 KVYRSAVGDKYVLEVMKKYDLNFGGEQSGHIIFSDYAKTGDGLVSALQSVAYLIESGKKA 356

Query: 363 STICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLIRI 422
           S   + FE YPQ   S+ V     L      + I   E E  G  R +VR SGTE+ +R+
Sbjct: 357 SEAFNLFELYPQVQTSIVVSQKPPLEKIDGAKNIL-KEVEKEGY-RHLVRYSGTENKLRL 414

Query: 423 MAEGDDLSRIKRIVDDLAKVI 443
           + EG D  + K ++D L K  
Sbjct: 415 LVEGKDNKKAKELLDKLTKFF 435


>gi|223935020|ref|ZP_03626939.1| phosphoglucosamine mutase [bacterium Ellin514]
 gi|223896473|gb|EEF62915.1| phosphoglucosamine mutase [bacterium Ellin514]
          Length = 460

 Score =  404 bits (1037), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 202/451 (44%), Positives = 298/451 (66%), Gaps = 11/451 (2%)

Query: 3   RRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLF-------RGKKKHRRVVIGKDTRLSG 55
           ++ FGTDG+RG +N  P+T    +++G A GY+F       RG+ KH+ +VIGKDTRLSG
Sbjct: 5   KKIFGTDGVRGTANVEPVTAETALKLGRAAGYVFKNLESQSRGRGKHK-IVIGKDTRLSG 63

Query: 56  YMLENSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFG 115
           YMLEN++ AG  + G+D   +GP+P+P VA +TRSLRAD G++I+ASHNPY DNGIK F 
Sbjct: 64  YMLENAISAGILSMGVDVLFIGPLPTPGVAYVTRSLRADAGIVITASHNPYDDNGIKFFR 123

Query: 116 PDGYKVSTDIEDRIETL-LEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTL 174
            DGYK+   +E RIE L    D+ S       +G A R+D    RYIE+ K + PR +TL
Sbjct: 124 ADGYKLDDRVEARIEELVFGGDVESLRPKASEVGKAVRIDDALGRYIEYAKASFPRGMTL 183

Query: 175 QGLRIVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEV 234
           +G+RIVVDCA+GA+YK  P V  ELGA V+V G++P+G NIN DCGS +   + +KV E 
Sbjct: 184 EGMRIVVDCAHGAAYKSTPCVLRELGAQVIVYGNQPDGTNINKDCGSMHPEQMCQKVREH 243

Query: 235 RADIGIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLE 294
            A +GIA DGD DRV++ DE G +++GD IMA+   + +    L    +V+TVMSN GL+
Sbjct: 244 GAQLGIAHDGDADRVLLCDETGTLIDGDDIMAIAGLDMLERGSLAHKTLVSTVMSNAGLD 303

Query: 295 RFIAGLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRY 354
           + I   G  + RT VGD+ +++ M  +G++ GGEQSGH+I  ++ +TGDGLV ALQ+L+ 
Sbjct: 304 KAIESKGGKMLRTPVGDKNVIDEMLRHGYSFGGEQSGHMIFGEHSTTGDGLVCALQILQI 363

Query: 355 IKQYDKPVSTICHCFEEYPQFLRSVSVKDTSILNS-SSIVQAIADAESELRGI-DRLIVR 412
           +K  ++P+S +  C+  YPQ + +V V++       + ++Q +A AE+E++    R+++R
Sbjct: 364 MKAKERPLSKLAKCWTRYPQLVTNVKVREKKPFEQMNGVLQLVASAEAEVKPSGGRVLLR 423

Query: 413 ASGTESLIRIMAEGDDLSRIKRIVDDLAKVI 443
            SGTE   R++ EG D   ++R+ + +   I
Sbjct: 424 YSGTEPKARLLIEGPDAVALERLSESICDAI 454


>gi|113969676|ref|YP_733469.1| phosphoglucosamine mutase [Shewanella sp. MR-4]
 gi|123029816|sp|Q0HKK5|GLMM2_SHESM RecName: Full=Phosphoglucosamine mutase 2
 gi|113884360|gb|ABI38412.1| phosphoglucosamine mutase [Shewanella sp. MR-4]
          Length = 450

 Score =  404 bits (1037), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 210/449 (46%), Positives = 301/449 (67%), Gaps = 8/449 (1%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M R++FGTDG+RGK  TFPITP+F MR+G A G +       + V+IGKDTR+SGYMLE+
Sbjct: 1   MSRKYFGTDGVRGKVGTFPITPDFAMRLGWAAGTVL-ASTGTKEVLIGKDTRISGYMLES 59

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           ++ AGF+AAG++  ++GP+P+PAVA L  + RAD GV+ISASHNP+ DNGIK F   G K
Sbjct: 60  AMEAGFSAAGVNVALIGPMPTPAVAYLASTFRADAGVVISASHNPFYDNGIKFFSNTGTK 119

Query: 121 VSTDIEDRIETLLEDDLT-SYLSCYDS--IGHAKRVDGVHDRYIEHVKRTLPRDVTLQGL 177
           ++   E  IE LLE  L  + L C  S  +G  +R+D    RYIE  K T P  ++L GL
Sbjct: 120 LNDAQELEIEALLEQALEHNALQCVASEKLGKVRRIDDAAGRYIEFCKGTFPNHLSLAGL 179

Query: 178 RIVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRAD 237
           +IVVD A+GA+Y +AP V+ ELGA+V+ I DKPNG+NIN  CG+T++ SLQ  V    AD
Sbjct: 180 KIVVDSAHGAAYHIAPNVYRELGAEVISINDKPNGVNINDHCGATHLDSLQSAVMIHEAD 239

Query: 238 IGIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFI 297
           +GIALDGD DRV+ VD  G +V+GD+I+ ++A+       ++G G+V T+MSN+GLE  +
Sbjct: 240 LGIALDGDADRVMFVDHNGHVVDGDEILFILAQAAYQKGEMQG-GVVGTLMSNLGLELAL 298

Query: 298 AGLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQ 357
            G+ +   R +VGDRY++E +K  G+ +GGE SGHI+   + STGDG+VA+LQVL+ + +
Sbjct: 299 KGMDIPFVRAKVGDRYVVEQLKETGWQLGGEGSGHILSLKHASTGDGIVASLQVLKAVLE 358

Query: 358 YDKPVSTICHCFEEYPQFLRSVSVKD---TSILNSSSIVQAIADAESELRGIDRLIVRAS 414
             K ++ +     + PQ L +V +      SIL+  S+ QA+  AE  L    R+++R S
Sbjct: 359 SGKRLAELKAEMTKLPQVLINVRLTSGCADSILSKDSVKQAVIAAEEVLGNQGRVLLRKS 418

Query: 415 GTESLIRIMAEGDDLSRIKRIVDDLAKVI 443
           GTE LIR+M E  D+S  ++  + +A+ +
Sbjct: 419 GTEPLIRVMVESTDISLTQQQAEYIAQAV 447


>gi|255507436|ref|ZP_05383075.1| phosphoglucosamine mutase [Chlamydia trachomatis D(s)2923]
 gi|289525861|emb|CBJ15343.1| phosphoglucosamine mutase [Chlamydia trachomatis Sweden2]
 gi|296435445|gb|ADH17623.1| phosphoglucosamine mutase [Chlamydia trachomatis E/150]
 gi|296439162|gb|ADH21315.1| phosphoglucosamine mutase [Chlamydia trachomatis E/11023]
          Length = 458

 Score =  404 bits (1037), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 208/443 (46%), Positives = 295/443 (66%), Gaps = 6/443 (1%)

Query: 3   RRFFGTDGIRGKSNTFPITPNFMMRIGIAV-GYLFRGKKKHRRVVIGKDTRLSGYMLENS 61
           R+ FGTDG+RG++N  P+T    + +G AV G L        RVV+GKDTRLSGYM EN+
Sbjct: 6   RQLFGTDGVRGRANFEPMTVETSVLLGKAVAGVLLEKHAGKHRVVVGKDTRLSGYMFENA 65

Query: 62  LVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKV 121
           L+AG T+ G++  +LGPIP+P VA +TR+ RAD G+MISASHNPY+DNGIK+F  DG+K+
Sbjct: 66  LIAGLTSMGIETLMLGPIPTPGVAFITRAYRADAGIMISASHNPYRDNGIKIFSSDGFKI 125

Query: 122 STDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVV 181
              +E+RIE ++       L    ++G  KRV     RYIE+ K T P+  TL+GLRIV+
Sbjct: 126 GQAVEERIEAMVASKDFGKLPDDHAVGKNKRVKDATGRYIEYAKATFPKGRTLKGLRIVL 185

Query: 182 DCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIA 241
           DCA+GA+Y+VAP VF EL A+V+  G +P+G NIN  CG+    ++Q+ V E +AD+GIA
Sbjct: 186 DCAHGATYRVAPSVFEELDAEVICYGCEPSGCNINAGCGALWPSTIQKAVIEHKADVGIA 245

Query: 242 LDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLG 301
           LDGDGDR+I+VDEKG IV+GD ++++ A +      L  N +V TVM+N G+ R++  LG
Sbjct: 246 LDGDGDRLIMVDEKGHIVDGDMLLSICASDLKRRQALPDNRVVATVMTNFGVLRYLESLG 305

Query: 302 LSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKP 361
           + +  + VGDR+++++M  N   +GGEQSGH+I  DY +TGDG+V+ALQVLR + + +  
Sbjct: 306 IQVTISPVGDRHVLQHMLENQAVLGGEQSGHMIFLDYNTTGDGIVSALQVLRIMIESEST 365

Query: 362 VSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGID-RLIVRASGTESLI 420
           +S +  C  + PQ L +V V     L S + VQ +     E+ G   R+++R SGTE++ 
Sbjct: 366 LSDLTACIVKSPQALINVPVTKKVPLESLANVQGVLKEVKEVLGDSGRILLRYSGTENIC 425

Query: 421 RIMAEGDDLSRIKRIVDDLAKVI 443
           R+M EG      K  VD LAK I
Sbjct: 426 RVMVEGTK----KHQVDSLAKTI 444


>gi|329943131|ref|ZP_08291905.1| phosphoglucosamine mutase [Chlamydophila psittaci Cal10]
 gi|332287714|ref|YP_004422615.1| phosphoglucosamine mutase [Chlamydophila psittaci 6BC]
 gi|313848288|emb|CBY17289.1| putative phosphoglucomutase [Chlamydophila psittaci RD1]
 gi|325507199|gb|ADZ18837.1| phosphoglucosamine mutase [Chlamydophila psittaci 6BC]
 gi|328814678|gb|EGF84668.1| phosphoglucosamine mutase [Chlamydophila psittaci Cal10]
 gi|328914967|gb|AEB55800.1| phosphoglucosamine mutase [Chlamydophila psittaci 6BC]
          Length = 458

 Score =  403 bits (1036), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 217/449 (48%), Positives = 301/449 (67%), Gaps = 7/449 (1%)

Query: 3   RRFFGTDGIRGKSNTFPITPNFMMRIGIAV-GYLFRGKKKHRRVVIGKDTRLSGYMLENS 61
           ++ FGTDG+RGK+N  P+T    + +G AV G L   K    RVV+GKDTRLSGYM EN+
Sbjct: 6   KQLFGTDGVRGKANYEPMTVELSVLLGKAVAGVLQESKSGKHRVVVGKDTRLSGYMFENA 65

Query: 62  LVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKV 121
           LVAG T+ G++  +LGPIP+P VA +TR+ RAD G+MISASHNPY DNGIK+F  +G+K+
Sbjct: 66  LVAGLTSMGIETLVLGPIPTPGVAFITRAYRADAGIMISASHNPYWDNGIKIFSSEGFKI 125

Query: 122 STDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVV 181
           S  IE RIE ++       L    ++G  KRV     RYIE  K T PR  TL+GL+IV+
Sbjct: 126 SDVIERRIEQMVALREFGNLPDDCAVGKNKRVVDAMGRYIEFAKATFPRGRTLKGLKIVL 185

Query: 182 DCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIA 241
           DCA+GA+YKVAP VF EL A+V+  G +P G NIN  CG+     +Q+ V E +AD+GIA
Sbjct: 186 DCAHGAAYKVAPSVFEELDAEVICYGCEPTGSNINDGCGALFPSVIQKAVIEHKADVGIA 245

Query: 242 LDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLG 301
           LDGDGDRVI+VDEKG IV+GD I+++ A +     LLRGN ++ TVM+N G+ +++  +G
Sbjct: 246 LDGDGDRVIMVDEKGHIVDGDMILSICANDLKKKDLLRGNRVIATVMTNFGVLKYLESVG 305

Query: 302 LSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKP 361
           +    + VGDR++++ M     N+GGEQSGH+I  DY +TGDG+V+ALQVLR + + +  
Sbjct: 306 IEALISPVGDRHVLQNMLEYDVNLGGEQSGHMIFLDYNTTGDGIVSALQVLRIMIESEST 365

Query: 362 VSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQ-AIADAESELRGIDRLIVRASGTESLI 420
           +S +     + PQ L +V+VK+   L++  +VQ A+ D  S L    R+++R SGTE++ 
Sbjct: 366 LSDLTSLIVKSPQALINVAVKEKIPLDTLPLVQEALRDVRSSLGDSGRVLLRYSGTENIC 425

Query: 421 RIMAEGDDLSRIKRIVDDLAKVIP-MIDS 448
           R+M EG      K  VD LAK I  ++DS
Sbjct: 426 RVMVEGLK----KHQVDSLAKTIADIVDS 450


>gi|126664884|ref|ZP_01735868.1| phosphoglucosamine mutase [Marinobacter sp. ELB17]
 gi|126631210|gb|EBA01824.1| phosphoglucosamine mutase [Marinobacter sp. ELB17]
          Length = 447

 Score =  403 bits (1036), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 217/442 (49%), Positives = 304/442 (68%), Gaps = 4/442 (0%)

Query: 3   RRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSL 62
           R++FGTDGIRG     PITP FM+R+G A G  F+ + +   V+IGKDTRLSGYM E++L
Sbjct: 4   RQYFGTDGIRGHVGEGPITPEFMLRLGWAAGQAFKREGQRNSVMIGKDTRLSGYMFESAL 63

Query: 63  VAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVS 122
            AG  AAG+D  +LGP+P+PA+A LTR+ RA  G++ISASHNP+ DNGIK F  DG K+ 
Sbjct: 64  EAGLAAAGVDVKLLGPMPTPAIAYLTRTFRASAGIVISASHNPHYDNGIKFFSADGTKLD 123

Query: 123 TDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVVD 182
             +E  IE  LE  LT   S    +G A R+D    RYIE  K T+P + +L+G+ IV+D
Sbjct: 124 DALEAEIEHWLEQPLTVCDSA--ELGKASRIDDAPGRYIEFCKSTVPNEFSLEGMSIVLD 181

Query: 183 CANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIAL 242
           CA+GA+Y VAP+VF ELGA+V VIG  P+G+NINL+ GST++  L + V + +AD+GIA 
Sbjct: 182 CAHGATYHVAPKVFRELGANVSVIGAAPDGLNINLNVGSTHLAGLSQAVLDRKADLGIAF 241

Query: 243 DGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLGL 302
           DGDGDRV++VD  G+ V+GD+++ +IA +  +   L+G G+V T+M+N+G+E  +  LG+
Sbjct: 242 DGDGDRVLMVDRDGSEVDGDELLYVIASQRYAEGRLKG-GVVGTLMTNLGVELALKELGI 300

Query: 303 SLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKPV 362
             +R  VGDRY+ME +   G+ +GGE SGH+++ D  STGDG+V+ALQV+  I +  K +
Sbjct: 301 EFERANVGDRYVMERLLAKGWVLGGEGSGHMVIRDCTSTGDGIVSALQVMLAIWKSGKTL 360

Query: 363 STICHCFEEYPQFLRSVSV-KDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLIR 421
           + I     + PQ + +V V K  + L    IV A++ AE+EL G  R+++RASGTE LIR
Sbjct: 361 AEIRRGMSKLPQTMINVRVTKRFNPLEREDIVAAVSRAEAELGGDGRVLLRASGTEPLIR 420

Query: 422 IMAEGDDLSRIKRIVDDLAKVI 443
           +M EG D   I+RI   LAKV+
Sbjct: 421 VMTEGQDAEVIERIARQLAKVV 442


>gi|170719902|ref|YP_001747590.1| phosphoglucosamine mutase [Pseudomonas putida W619]
 gi|226723906|sp|B1J265|GLMM_PSEPW RecName: Full=Phosphoglucosamine mutase
 gi|169757905|gb|ACA71221.1| phosphoglucosamine mutase [Pseudomonas putida W619]
          Length = 446

 Score =  403 bits (1036), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 202/445 (45%), Positives = 302/445 (67%), Gaps = 6/445 (1%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M R++FGTDGIRG+   +PITP+FM+++G A G  FR K+ + RV++GKDTR+SGYM E+
Sbjct: 1   MSRKYFGTDGIRGRVGEYPITPDFMLKLGWAAGMAFR-KQGNCRVLVGKDTRISGYMFES 59

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +L AG +AAG D  +LGP+P+PA+A LTR+  A+ G++ISASHNP+ DNGIK F   G K
Sbjct: 60  ALEAGLSAAGADVLLLGPMPTPAIAYLTRTFHAEAGIVISASHNPHDDNGIKFFSGQGTK 119

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +  +IE  IE LL+  +T   S    +G   R++    RYIE  K ++P     +GL++V
Sbjct: 120 LPDEIELMIEELLDQPMTVVDS--SKLGKVSRINDAAGRYIEFCKSSVPTSTGFEGLKLV 177

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           VDCA+GA+YKVAP VF ELGA+V V+  +P+G+NIN +CGST++ SLQ  V    AD+GI
Sbjct: 178 VDCAHGATYKVAPSVFRELGAEVTVLHAQPDGLNINENCGSTHIESLQAAVLVGHADLGI 237

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           A DGDGDRV++VD  GAIV+GD+++ +IAR+      L+G G+V T+MSN+GLE  +  L
Sbjct: 238 AFDGDGDRVLMVDHTGAIVDGDELLFIIARDLHERGKLQG-GVVGTLMSNLGLELALKDL 296

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
            +   R +VGDRY+M  +   G+ VGGE SGH++  ++ +TGD ++AALQVL  +++  +
Sbjct: 297 DIPFVRAKVGDRYVMAELLERGWLVGGENSGHVVCCNHTTTGDAIIAALQVLLALRRRGE 356

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTSI--LNSSSIVQAIADAESELRGIDRLIVRASGTES 418
            ++       + PQ L +V    + +  L   ++ +A A    ++ G  R+++R SGTE 
Sbjct: 357 TLAQARQALRKCPQVLINVRFGASKVDPLEHPAVKEASARVTEDMAGRGRVLLRKSGTEP 416

Query: 419 LIRIMAEGDDLSRIKRIVDDLAKVI 443
           L+R+M EGDD ++++   + LAK++
Sbjct: 417 LVRVMVEGDDENQVRTHAEALAKLV 441


>gi|54295622|ref|YP_128037.1| hypothetical protein lpl2709 [Legionella pneumophila str. Lens]
 gi|81601170|sp|Q5WT16|GLMM_LEGPL RecName: Full=Phosphoglucosamine mutase
 gi|53755454|emb|CAH16950.1| hypothetical protein lpl2709 [Legionella pneumophila str. Lens]
          Length = 455

 Score =  403 bits (1036), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 212/447 (47%), Positives = 299/447 (66%), Gaps = 5/447 (1%)

Query: 2   KRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENS 61
           +R++FGTDGIRG      I P F++++G AVG +     + ++VVIGKDTR+SGYMLE++
Sbjct: 3   QRKYFGTDGIRGHVGLSNINPEFVLKLGWAVGCVLANGAR-KKVVIGKDTRVSGYMLESA 61

Query: 62  LVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKV 121
           L AG +AAG+D  +LGP+P+P +A LT++LRA+ G++ISASHN ++DNGIK F  DG K+
Sbjct: 62  LEAGLSAAGVDVALLGPMPTPGIAYLTQTLRANAGIVISASHNLFEDNGIKFFSADGGKL 121

Query: 122 STDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVV 181
              +E  IE  LE  L +  S    +G A R++    RYIE  K T+P    L  L+IVV
Sbjct: 122 PDSVELAIEAQLEKQLQTVPSA--KLGKATRINDAAGRYIEFCKSTIPSLSRLSNLKIVV 179

Query: 182 DCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIA 241
           DCANGA+Y +AP VF ELGADVV IG KP+G NIN +CGST    L+ KV  V ADIGI 
Sbjct: 180 DCANGATYHIAPNVFSELGADVVPIGIKPDGFNINQECGSTAPELLREKVIAVGADIGIG 239

Query: 242 LDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLG 301
           LDGDGDRVI+VD  G +V+GDQI+ +IA++     +L G G+V T+MSN GLE  I  LG
Sbjct: 240 LDGDGDRVILVDSLGNLVDGDQIIYIIAKDRHQRGVLHG-GVVGTLMSNYGLELAITSLG 298

Query: 302 LSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKP 361
           +  +R++VGDRY++E ++   + +GGE SGHI+  D  +TGDG+VAALQVL  + + +K 
Sbjct: 299 VPFQRSKVGDRYVLEMLREKDWKIGGETSGHIVCLDKTTTGDGIVAALQVLSIMVKQNKA 358

Query: 362 VSTICHCFEEYPQFLRSVSVKDTSILNSSS-IVQAIADAESELRGIDRLIVRASGTESLI 420
           +  +    +  PQ L ++   + ++L S+  ++QA+ + E  L G  R+++R SGTE L+
Sbjct: 359 LHELTAGIQLLPQTLVNLKTNNAALLASNPDVIQAVKNLEKHLNGEGRVLLRPSGTEPLL 418

Query: 421 RIMAEGDDLSRIKRIVDDLAKVIPMID 447
           R+M EG + S +K+    L   I  ID
Sbjct: 419 RVMVEGANASIVKQQAQMLCDDISQID 445


>gi|297620656|ref|YP_003708793.1| putative phosphoglucosamine mutase [Waddlia chondrophila WSU
           86-1044]
 gi|297375957|gb|ADI37787.1| putative phosphoglucosamine mutase [Waddlia chondrophila WSU
           86-1044]
          Length = 454

 Score =  403 bits (1035), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 200/444 (45%), Positives = 293/444 (65%), Gaps = 2/444 (0%)

Query: 2   KRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENS 61
           +++ FGTDG+RGK+N  P+T    + +G A G  FR      RVVIGKDTRLS YM EN+
Sbjct: 6   EKKIFGTDGVRGKANFSPMTVETALALGRAAGKFFRRHNGKHRVVIGKDTRLSCYMFENA 65

Query: 62  LVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKV 121
           L+AG  + G+D  ++GP+P+P VA +TR+ RAD G++ISASHN Y+DNGIK F  DG K+
Sbjct: 66  LIAGLCSMGVDTLMVGPLPTPGVAFITRAYRADAGIVISASHNSYEDNGIKFFSSDGIKL 125

Query: 122 STDIEDRIETLLED-DLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           S + E  IE L+E+ D    L     IG  K++D    RYIE VK T  + ++L G++I 
Sbjct: 126 SDEWEREIEKLIEENDFNDSLPASHLIGRNKKIDDAAGRYIEFVKATFGKKLSLNGMKIA 185

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           +DCANGA+Y+VAP VF EL   V   G  PNG+NIN  CGS +   +Q+ V E  AD+GI
Sbjct: 186 LDCANGAAYRVAPHVFNELDGQVFAYGINPNGLNINDMCGSLHPEVVQKAVIEHHADVGI 245

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           ALDGDGDRVI++DE   IV+GDQ++A+ A+  +    L+   +V T+M+N+G+   +   
Sbjct: 246 ALDGDGDRVILIDEHAQIVDGDQMLAICAKHMLGEGTLKNARVVATIMTNMGIVNAMEQS 305

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           G+ + R+ VGDRY+++ M +NG  +GGEQSGH+I  ++ +TGDGLV+ALQVLR ++    
Sbjct: 306 GIEVIRSAVGDRYVVKEMIDNGAELGGEQSGHVIFLEHNTTGDGLVSALQVLRIMQTTGL 365

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTSILNS-SSIVQAIADAESELRGIDRLIVRASGTESL 419
            +S +   FE++PQ   +V+VK    L   S + + + D E +L+G  R++VR SGTE++
Sbjct: 366 RLSELAKPFEKFPQVTVNVAVKSKPPLEEISELRKVVQDVEKKLQGKGRVLVRYSGTENM 425

Query: 420 IRIMAEGDDLSRIKRIVDDLAKVI 443
            R+M EG++L ++      +A+ +
Sbjct: 426 CRVMVEGENLHQVSVFAGQIAESV 449


>gi|261856553|ref|YP_003263836.1| phosphoglucosamine mutase [Halothiobacillus neapolitanus c2]
 gi|261837022|gb|ACX96789.1| phosphoglucosamine mutase [Halothiobacillus neapolitanus c2]
          Length = 446

 Score =  403 bits (1035), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 209/440 (47%), Positives = 296/440 (67%), Gaps = 4/440 (0%)

Query: 4   RFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSLV 63
           + FGTDG+RG    +P+TP F++++G A G +  G++  RRV+IGKDTR+SGYM E++L 
Sbjct: 2   KVFGTDGVRGTVGRWPMTPEFVLKLGWAAGMVL-GQEGRRRVLIGKDTRISGYMFESALE 60

Query: 64  AGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVST 123
           AGF+AAG+D  +LGP+P+PA+A LTR+LR   GV+ISASHNP+QDNG+K F   G K+  
Sbjct: 61  AGFSAAGVDVRLLGPMPTPAIAYLTRTLRGSAGVVISASHNPFQDNGVKFFSSHGEKLPD 120

Query: 124 DIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVVDC 183
            IE  IE +L++ +T  ++    +G A+R+D    RYIE  K ++   ++L  LRIVVDC
Sbjct: 121 VIEAEIERMLDEPMT--VARPHLLGKAQRIDDAPGRYIEFCKSSIETGLSLSNLRIVVDC 178

Query: 184 ANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIALD 243
           ANGA Y+VAP VF ELGA+V+ IG +P+G+NIN   GST+  SLQR V E RAD+G+ALD
Sbjct: 179 ANGAGYQVAPRVFTELGAEVIRIGVEPDGLNINAGVGSTDPASLQRAVTEFRADLGVALD 238

Query: 244 GDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLGLS 303
           GDGDRV++VD +G +++GDQ++ +IA + +S S   G G+V T+MSN+GLE  I  LGL 
Sbjct: 239 GDGDRVLLVDAEGQVLDGDQLLYIIAADRVSRSGYNG-GVVGTLMSNLGLELAIKALGLP 297

Query: 304 LKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKPVS 363
             R  VGDRY+ E +K + + +GGE SGHI+  D  +TGDG+VAALQVL  +K   + + 
Sbjct: 298 FVRANVGDRYVHETLKRHDWLLGGESSGHILCLDRHTTGDGIVAALQVLSAMKASGQSLR 357

Query: 364 TICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLIRIM 423
            +      +PQ L +V       L+   I  A+   E  L    R+++RASGTE LIR+M
Sbjct: 358 ALTQKMSIFPQTLINVRTDQKCDLSQPRITSAVQAVEKVLGDDGRVLLRASGTEPLIRVM 417

Query: 424 AEGDDLSRIKRIVDDLAKVI 443
            EG     +++    LA+ +
Sbjct: 418 VEGKQADLVEKQAKKLAQEV 437


>gi|52842991|ref|YP_096790.1| phosphoglucosamine mutase [Legionella pneumophila subsp.
           pneumophila str. Philadelphia 1]
 gi|54298776|ref|YP_125145.1| phosphoglucosamine mutase [Legionella pneumophila str. Paris]
 gi|81601637|sp|Q5X1A3|GLMM_LEGPA RecName: Full=Phosphoglucosamine mutase
 gi|81603172|sp|Q5ZRT4|GLMM_LEGPH RecName: Full=Phosphoglucosamine mutase
 gi|52630102|gb|AAU28843.1| phosphoglucomutase/phosphomannomutase MrsA [Legionella pneumophila
           subsp. pneumophila str. Philadelphia 1]
 gi|53752561|emb|CAH13993.1| hypothetical protein lpp2840 [Legionella pneumophila str. Paris]
          Length = 455

 Score =  403 bits (1035), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 212/447 (47%), Positives = 299/447 (66%), Gaps = 5/447 (1%)

Query: 2   KRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENS 61
           +R++FGTDGIRG      I P F++++G AVG +     + ++VVIGKDTR+SGYMLE++
Sbjct: 3   QRKYFGTDGIRGHVGLSNINPEFVLKLGWAVGCVLANGAR-KKVVIGKDTRVSGYMLESA 61

Query: 62  LVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKV 121
           L AG +AAG+D  +LGP+P+P +A LT++LRA+ G++ISASHN ++DNGIK F  DG K+
Sbjct: 62  LEAGLSAAGVDVALLGPMPTPGIAYLTQTLRANAGIVISASHNLFEDNGIKFFSADGGKL 121

Query: 122 STDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVV 181
              +E  IE  LE  L +  S    +G A R++    RYIE  K T+P    L  L+IVV
Sbjct: 122 PDSVELAIEAQLEKQLQTVPSA--KLGKATRINDAAGRYIEFCKSTIPSLSRLSNLKIVV 179

Query: 182 DCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIA 241
           DCANGA+Y +AP VF ELGADVV IG KP+G NIN +CGST    L+ KV  V ADIGI 
Sbjct: 180 DCANGATYHIAPNVFSELGADVVPIGIKPDGFNINQECGSTAPELLREKVIAVGADIGIG 239

Query: 242 LDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLG 301
           LDGDGDRVI+VD  G +V+GDQI+ +IA++     +L G G+V T+MSN GLE  I  LG
Sbjct: 240 LDGDGDRVILVDSLGNLVDGDQIIYIIAKDRHQRGVLHG-GVVGTLMSNYGLELAITSLG 298

Query: 302 LSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKP 361
           +  +R++VGDRY++E ++   + +GGE SGHI+  D  +TGDG+VAALQVL  + + +K 
Sbjct: 299 VPFQRSKVGDRYVLETLREKDWKIGGETSGHIVCLDKTTTGDGIVAALQVLSIMVKQNKA 358

Query: 362 VSTICHCFEEYPQFLRSVSVKDTSILNSSS-IVQAIADAESELRGIDRLIVRASGTESLI 420
           +  +    +  PQ L ++   + ++L S+  ++QA+ + E  L G  R+++R SGTE L+
Sbjct: 359 LHELTAGIQLLPQTLVNLKTNNAALLASNPDVIQAVKNLEKHLNGEGRVLLRPSGTEPLL 418

Query: 421 RIMAEGDDLSRIKRIVDDLAKVIPMID 447
           R+M EG + S +K+    L   I  ID
Sbjct: 419 RVMVEGANASIVKQQAQMLCDDISQID 445


>gi|110833185|ref|YP_692044.1| phosphoglucosamine mutase [Alcanivorax borkumensis SK2]
 gi|122959686|sp|Q0VSS6|GLMM_ALCBS RecName: Full=Phosphoglucosamine mutase
 gi|110646296|emb|CAL15772.1| phosphoglucosamine mutase [Alcanivorax borkumensis SK2]
          Length = 444

 Score =  403 bits (1035), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 203/444 (45%), Positives = 302/444 (68%), Gaps = 6/444 (1%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M R++FGTDG+RG    FPITP+F++++G A G +  G +   +++IGKDTR+SGYM E+
Sbjct: 1   MTRKYFGTDGVRGTVGEFPITPDFVLKLGWAAGKVL-GARGGSKILIGKDTRISGYMFES 59

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +L AG +AAG+D  +LGP+P+P +A LTR+L A  G++ISASHNPY DNGIK FG DG K
Sbjct: 60  ALEAGISAAGVDVRLLGPLPTPGIAYLTRTLSAQAGIVISASHNPYTDNGIKFFGADGRK 119

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           ++ +IE  IE LL++ ++  +   D IG  +R+D    RYIE  K T P  + L G++IV
Sbjct: 120 LNDEIELEIERLLDEQMS--VVSTDQIGKVRRIDDARGRYIEFCKSTAP-GLDLNGMKIV 176

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           VD ANGA+Y +AP+VF ELGA VV + ++P+G NIN DCGST+  +LQRKV E +AD+G+
Sbjct: 177 VDTANGAAYHIAPDVFEELGATVVPLANQPDGFNINRDCGSTHPEALQRKVVEEKADLGV 236

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           ALDGD DR+++VD  G +V+GDQ++ ++AR+   +     +G+V T+MSN GLE  +   
Sbjct: 237 ALDGDADRLLMVDHAGNLVDGDQLLFVVARDRKENG-AEMDGVVGTLMSNFGLELALQAE 295

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           G+   R +VGDRY+ME +   G+N+GGE SGH++  D  +TGDG V+ALQVL  + +  +
Sbjct: 296 GIEFVRAKVGDRYVMEQLDKRGWNIGGESSGHLVCLDCTTTGDGTVSALQVLAALSRRKQ 355

Query: 361 PVSTICHCFEEYPQFLRSVSVKD-TSILNSSSIVQAIADAESELRGIDRLIVRASGTESL 419
            ++         PQ + +V   +    + +  +  A+AD E  L G  R+++R SGTE L
Sbjct: 356 GLAESVADVSMLPQKMINVRGPNRDGFMENGDVQAAMADVEDRLAGNGRILLRPSGTEPL 415

Query: 420 IRIMAEGDDLSRIKRIVDDLAKVI 443
           +R+M EG D+ R++ +  +LA+V+
Sbjct: 416 VRVMIEGKDVDRVESLCRELAEVV 439


>gi|148361106|ref|YP_001252313.1| phosphoglucomutase/phosphomannomutase MrsA [Legionella pneumophila
           str. Corby]
 gi|296108436|ref|YP_003620137.1| phosphoglucomutase/phosphomannomutase [Legionella pneumophila
           2300/99 Alcoy]
 gi|158705799|sp|A5IHW7|GLMM_LEGPC RecName: Full=Phosphoglucosamine mutase
 gi|148282879|gb|ABQ56967.1| phosphoglucomutase/phosphomannomutase MrsA [Legionella pneumophila
           str. Corby]
 gi|295650338|gb|ADG26185.1| phosphoglucomutase/phosphomannomutase [Legionella pneumophila
           2300/99 Alcoy]
          Length = 455

 Score =  402 bits (1034), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 212/447 (47%), Positives = 299/447 (66%), Gaps = 5/447 (1%)

Query: 2   KRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENS 61
           +R++FGTDGIRG      I P F++++G AVG +     + ++VVIGKDTR+SGYMLE++
Sbjct: 3   QRKYFGTDGIRGHVGLSNINPEFVLKLGWAVGCVLANGAR-KKVVIGKDTRVSGYMLESA 61

Query: 62  LVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKV 121
           L AG +AAG+D  +LGP+P+P +A LT++LRA+ G++ISASHN ++DNGIK F  DG K+
Sbjct: 62  LEAGLSAAGVDVALLGPMPTPGIAYLTQTLRANAGIVISASHNLFEDNGIKFFSADGGKL 121

Query: 122 STDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVV 181
              +E  IE  LE  L +  S    +G A R++    RYIE  K T+P    L  L+IVV
Sbjct: 122 PDSVELAIEAQLEKQLQTVPSV--KLGKATRINDAAGRYIEFCKSTIPSLSRLSNLKIVV 179

Query: 182 DCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIA 241
           DCANGA+Y +AP VF ELGADVV IG KP+G NIN +CGST    L+ KV  V ADIGI 
Sbjct: 180 DCANGATYHIAPNVFSELGADVVPIGIKPDGFNINQECGSTAPELLREKVIAVGADIGIG 239

Query: 242 LDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLG 301
           LDGDGDRVI+VD  G +V+GDQI+ +IA++     +L G G+V T+MSN GLE  I  LG
Sbjct: 240 LDGDGDRVILVDSLGNLVDGDQIIYIIAKDRHQRGVLHG-GVVGTLMSNYGLELAITSLG 298

Query: 302 LSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKP 361
           +  +R++VGDRY++E ++   + +GGE SGHI+  D  +TGDG+VAALQVL  + + +K 
Sbjct: 299 VPFQRSKVGDRYVLETLREKDWKIGGETSGHIVCLDKTTTGDGIVAALQVLSIMVKQNKA 358

Query: 362 VSTICHCFEEYPQFLRSVSVKDTSILNSSS-IVQAIADAESELRGIDRLIVRASGTESLI 420
           +  +    +  PQ L ++   + ++L S+  ++QA+ + E  L G  R+++R SGTE L+
Sbjct: 359 LHELTAGIQLLPQTLVNLKTNNAALLASNPDVIQAVKNLEKHLNGEGRVLLRPSGTEPLL 418

Query: 421 RIMAEGDDLSRIKRIVDDLAKVIPMID 447
           R+M EG + S +K+    L   I  ID
Sbjct: 419 RVMVEGANASIVKQQAQMLCDDISQID 445


>gi|88812979|ref|ZP_01128222.1| Phosphoglucosamine mutase [Nitrococcus mobilis Nb-231]
 gi|88789757|gb|EAR20881.1| Phosphoglucosamine mutase [Nitrococcus mobilis Nb-231]
          Length = 460

 Score =  402 bits (1034), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 208/441 (47%), Positives = 299/441 (67%), Gaps = 4/441 (0%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M +R+FGTDGIRG+   FPITP+FM+R+G + G +       ++V+IGKDTR+S YM E+
Sbjct: 1   MDKRYFGTDGIRGRVGEFPITPDFMLRLGWSAGRVLSDCSASKQVLIGKDTRISNYMFES 60

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +L AG +AAG++  +LGP+P+PA+A LTR+L+A+ G++ISASHNP+ DNGIK F   G K
Sbjct: 61  ALQAGLSAAGINIQLLGPMPTPAIAYLTRALQANAGIVISASHNPHYDNGIKFFSTAGRK 120

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +  + E  IE  +E+ LT+  S    +G A R+     RYIE  K ++P    L   ++V
Sbjct: 121 LDDETELAIEAAIEEPLTTVAS--RRLGKAYRMVDAPGRYIEFCKHSVPFGTRLDDFKLV 178

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           VDCANGA Y+VAP VF ELGA V  +G  P+G+NIN+DCGS ++  LQ+ V    AD GI
Sbjct: 179 VDCANGAGYQVAPAVFRELGAKVDCLGVAPDGLNINVDCGSLHLGRLQQAVVNSGADAGI 238

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           ALDGDGDRVI+VDE GA+++GD+++ +IAR+      LRG  +V TVM+N+GLE+ +  L
Sbjct: 239 ALDGDGDRVIMVDESGAVLDGDELLWVIARDRQRQGTLRGP-VVGTVMTNLGLEQALGAL 297

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           G++L R +VGDRY++E +  +   VGGE SGHII  D  STGDG+V+ALQVL  +    +
Sbjct: 298 GVALLRAKVGDRYVLEMLLEHHGAVGGESSGHIICLDRTSTGDGIVSALQVLHCMSASRQ 357

Query: 361 PVSTICHCFEEYPQFLRSVSV-KDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESL 419
           P+S +     + PQ + SV V +        +IV A+ + E+EL    R+++R+SGTE +
Sbjct: 358 PLSRLREGMTKLPQHMVSVPVARRLDPFEVPAIVTAVREIETELGKHGRVLLRSSGTEPV 417

Query: 420 IRIMAEGDDLSRIKRIVDDLA 440
           +R+M EG D  R++R+ + LA
Sbjct: 418 VRVMIEGQDRQRVQRLTEQLA 438


>gi|83644096|ref|YP_432531.1| phosphoglucosamine mutase [Hahella chejuensis KCTC 2396]
 gi|123534481|sp|Q2SML8|GLMM_HAHCH RecName: Full=Phosphoglucosamine mutase
 gi|83632139|gb|ABC28106.1| phosphoglucosamine mutase [Hahella chejuensis KCTC 2396]
          Length = 445

 Score =  402 bits (1034), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 202/444 (45%), Positives = 296/444 (66%), Gaps = 4/444 (0%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M + +FGTDGIRG+    PITP FM+++G A G +FR + +  RV+IGKDTR+SGY+ E+
Sbjct: 1   MSKEYFGTDGIRGRVGEGPITPEFMLKLGWAAGRVFRQEGRRNRVLIGKDTRISGYIFES 60

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +L +G  AAG+D  +LGP+P+PA+A LTR+ RA  G++ISASHNP+ DNG+K F  +G K
Sbjct: 61  ALESGLAAAGVDVAMLGPMPTPAIAYLTRTFRACAGIVISASHNPFNDNGVKFFSAEGTK 120

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +    E++IE  +   +    S    +G A R +    RYIE  K T+P  ++  G+R+V
Sbjct: 121 LPDSTEEQIEHFIRQPMEIVPS--SQLGKAARFEDAKGRYIEFCKSTVPFHMSFAGMRVV 178

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           +DCA GA+Y+VAP VF ELGA V  IG  P+G+NIN + GST+   L  KV E  AD+GI
Sbjct: 179 LDCAQGATYQVAPSVFKELGAKVETIGVTPDGLNINHEIGSTHPDQLAAKVVEAGADLGI 238

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           A DGDGDRV++VD KG IV+GD+I+ +IAR+ M    L+G G+V T+M+N G E     L
Sbjct: 239 AFDGDGDRVVMVDHKGEIVDGDEILYIIARDKMRKGRLKG-GVVGTLMTNFGAELAFGEL 297

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           G+  +R  VGDRY+ME +  N + +GGE SGHI+  D  +TGDG++++LQVL  +     
Sbjct: 298 GIPFERANVGDRYVMEALLRNDWCLGGEGSGHIVCLDRTTTGDGIISSLQVLAALSDLGI 357

Query: 361 PVSTICHCFEEYPQFLRSVSV-KDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESL 419
            +        + PQ + +V V +   I   ++I  A+A+AE +  G  R+++R+SGTE +
Sbjct: 358 TLHEAKKGMSKLPQHMINVRVSQKVDIKGHTTIQSAVANAEKQFAGKGRVLLRSSGTEPV 417

Query: 420 IRIMAEGDDLSRIKRIVDDLAKVI 443
           IR+MAEG+D ++++ IV +LAK++
Sbjct: 418 IRVMAEGEDEAKVRSIVAELAKIV 441


>gi|251772966|gb|EES53525.1| phosphoglucosamine mutase [Leptospirillum ferrodiazotrophum]
          Length = 462

 Score =  402 bits (1033), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 206/442 (46%), Positives = 285/442 (64%), Gaps = 2/442 (0%)

Query: 4   RFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSLV 63
           R FGTDGIRG++N  P+T     R+G A  +LF    +   VVIGKDTR+SGYMLE +L 
Sbjct: 7   RLFGTDGIRGRANIHPVTGEMAFRLGRAAAHLFARAGEEHHVVIGKDTRISGYMLEMALT 66

Query: 64  AGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVST 123
           +G T+ G++  ++GP  +P +A LTRSLRAD G+MISASHNPY DNGIK F  +G K+  
Sbjct: 67  SGLTSMGVNVILVGPFTTPGIAHLTRSLRADAGIMISASHNPYDDNGIKFFSSEGLKLPD 126

Query: 124 DIEDRIETLLEDDLTSYLSCYDS-IGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVVD 182
           ++EDRIE L+  D   ++    + IG   R+ G   RY+E VK TLPR     G+RIV D
Sbjct: 127 ELEDRIERLVMGDEIDHIRPTGALIGKVTRLSGAEGRYVEFVKNTLPRKQKFDGVRIVAD 186

Query: 183 CANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIAL 242
            ANG +YKVAP  F ELGA+V+ + D P+G+NINL+CG+    +L RKV E  AD+G+A 
Sbjct: 187 MANGGAYKVAPMAFRELGAEVIALSDAPDGVNINLNCGALYPETLARKVVETGADLGVAF 246

Query: 243 DGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLGL 302
           DGD DR + V  KG I++GD+IMA+IA        L G+ +VTTVMSN+ LE  +   G+
Sbjct: 247 DGDADRSVFVTGKGQILDGDRIMAIIAPFLKKEGRLPGDTLVTTVMSNLALEEAMKRHGI 306

Query: 303 SLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKPV 362
           SL++T+VGDRYI+E +     + GGEQSGHII  DY +TGDGL+ ALQ+L  + +    +
Sbjct: 307 SLRKTQVGDRYILEELDRLALSFGGEQSGHIIFRDYLTTGDGLITALQLLSLLDKEGISL 366

Query: 363 STICHCFEEYPQFLRSVSVKDTSILNS-SSIVQAIADAESELRGIDRLIVRASGTESLIR 421
                  E YPQ L+++ V+    + S   + +  A  +S L G  RL++R SGTE  IR
Sbjct: 367 DDAARVMEPYPQILKTLPVRSKPPIESLPELSKRKAHVDSLLSGHGRLLLRYSGTEMAIR 426

Query: 422 IMAEGDDLSRIKRIVDDLAKVI 443
           IM EG D + + +++ +L + +
Sbjct: 427 IMLEGPDANVLNQMMQELEEAV 448


>gi|254468624|ref|ZP_05082030.1| phosphoglucosamine mutase [beta proteobacterium KB13]
 gi|207087434|gb|EDZ64717.1| phosphoglucosamine mutase [beta proteobacterium KB13]
          Length = 443

 Score =  402 bits (1033), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 208/450 (46%), Positives = 302/450 (67%), Gaps = 19/450 (4%)

Query: 3   RRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHR---RVVIGKDTRLSGYMLE 59
           R++FGTDGIRG++  FPIT +F  ++G A G +     +     +V+IGKDTR SGYMLE
Sbjct: 2   RKYFGTDGIRGRAGRFPITVDFFTKLGFAAGKVLTKDNQSSSKPKVIIGKDTRESGYMLE 61

Query: 60  NSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGY 119
           ++L AGF+AAG+D F+ GPIP+PA+A LT++LRA +GV+ISASHN YQDNGIK F  +G 
Sbjct: 62  SALEAGFSAAGVDVFLTGPIPTPAIAYLTKALRAQIGVVISASHNLYQDNGIKFFSSNGQ 121

Query: 120 KVSTDIEDRIETLLE--DDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGL 177
           K+  +IE  IE  ++  ++L S     ++IG AKRVD    RY+E  K T P+D++L+GL
Sbjct: 122 KLDDEIELEIEKTIDGIENLDS-----ENIGKAKRVDDAQGRYVEFCKNTFPKDLSLEGL 176

Query: 178 RIVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRAD 237
           +IV+DC++GA+Y+VAP++F ELGAD+  IG  PNG NIN  CGST++  L+R+V ++ AD
Sbjct: 177 KIVLDCSHGATYQVAPKIFTELGADINTIGVGPNGTNINDGCGSTSLELLRREVKKINAD 236

Query: 238 IGIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFI 297
           +GIA DGDGDRV++V+  G  V+GDQ++ +I R     +    +G+V T+M+N+  E  +
Sbjct: 237 LGIAFDGDGDRVLMVNSNGDKVDGDQLLFIIVRAAFEENHFD-SGVVGTLMTNLAFEENM 295

Query: 298 AGLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQ 357
             LG+   R+ VGDRY+ E M+   +  GGE SGHI+L D+ +TGDG+++ALQVL+ IK+
Sbjct: 296 KELGIGFSRSGVGDRYVSELMQEKNWIYGGENSGHILLKDFHTTGDGIISALQVLKAIKK 355

Query: 358 ----YDKPVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRA 413
               +D+ VS I      YPQ L ++ +     L +  I  +I +AE  +    R+++R 
Sbjct: 356 RQISFDQAVSEI----NLYPQILLNIPLDKEIDLEADEIQSSIHEAEKLMNNNGRVLLRK 411

Query: 414 SGTESLIRIMAEGDDLSRIKRIVDDLAKVI 443
           SGTE L+RIM EG D     +    + KVI
Sbjct: 412 SGTEPLVRIMTEGKDKDLALKAAQAIKKVI 441


>gi|152995053|ref|YP_001339888.1| phosphoglucosamine mutase [Marinomonas sp. MWYL1]
 gi|205830886|sp|A6VU24|GLMM_MARMS RecName: Full=Phosphoglucosamine mutase
 gi|150835977|gb|ABR69953.1| phosphoglucosamine mutase [Marinomonas sp. MWYL1]
          Length = 448

 Score =  402 bits (1032), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 209/442 (47%), Positives = 292/442 (66%), Gaps = 6/442 (1%)

Query: 3   RRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSL 62
           R++FGTDGIRGK  T PITP FM+++G A G +F  K+  ++++IGKDTR+SGYM E++L
Sbjct: 2   RKYFGTDGIRGKVGTTPITPEFMLKLGWAAGQVF--KENDKKILIGKDTRISGYMFESAL 59

Query: 63  VAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVS 122
            +G  AAG D  ++GP+P+PA+A LTR+ RA  G++ISASHNPY DNGIK F  +G K+S
Sbjct: 60  ESGIVAAGADVRLVGPMPTPAIAYLTRTFRASAGIVISASHNPYTDNGIKFFSAEGGKIS 119

Query: 123 TDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVVD 182
            ++E+RIE  LE  +    S    IG AKR+D    RYIE+ K T P  + L GL+IVVD
Sbjct: 120 DELEERIEYFLEQPMEVVESS--QIGRAKRIDDAAGRYIEYCKGTFPIGLQLSGLKIVVD 177

Query: 183 CANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIAL 242
           CA+GA+Y VAP VF ELGA+V+ IG  P+G+NIN   G+T    L++ V    AD+GIAL
Sbjct: 178 CADGATYHVAPRVFSELGAEVISIGVNPDGLNINEFSGATKPELLRKNVLAEEADLGIAL 237

Query: 243 DGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLGL 302
           DGDGDR+I+VD  G + +GD I+ +IA   M      G G+V T+MSN GLE   +  G+
Sbjct: 238 DGDGDRLILVDRHGVVRDGDDILYIIANHLMRTGRFSG-GVVGTLMSNFGLELAFSETGI 296

Query: 303 SLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKPV 362
              R  VGDRY+ E +  +G+ +GGE SGHI+     +TGDG++AALQVLR + +  K +
Sbjct: 297 GFSRAAVGDRYVNEKLMQHGWVLGGEPSGHIVCRSITTTGDGIIAALQVLRAMVEEGKAL 356

Query: 363 STICHCFEEYPQFLRSVSVKDTSILNSSSIVQ-AIADAESELRGIDRLIVRASGTESLIR 421
             +     ++PQ L+++ V    + N    +Q AIA A   L G+ R+++RASGTE LIR
Sbjct: 357 DELLVGLVKFPQKLKNIRVAKRFVPNEEPTLQKAIAVANERLNGLGRVLLRASGTEPLIR 416

Query: 422 IMAEGDDLSRIKRIVDDLAKVI 443
           +M EG D   +  +V+ L + +
Sbjct: 417 VMVEGRDNDTVDELVEYLVEEV 438


>gi|37528352|ref|NP_931697.1| phosphoglucosamine mutase [Photorhabdus luminescens subsp.
           laumondii TTO1]
 gi|81572266|sp|Q7MYY3|GLMM_PHOLL RecName: Full=Phosphoglucosamine mutase
 gi|36787790|emb|CAE16905.1| Phosphoglucomutase protein MrsA [Photorhabdus luminescens subsp.
           laumondii TTO1]
          Length = 445

 Score =  402 bits (1032), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 214/442 (48%), Positives = 297/442 (67%), Gaps = 5/442 (1%)

Query: 3   RRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSL 62
           R++FGTDGIRGK    PITP+F++++G A G +   +   R+++IGKDTR+SGYMLE+SL
Sbjct: 4   RKYFGTDGIRGKVGDSPITPDFVLKLGWAAGKVL-ARHGSRKIIIGKDTRISGYMLESSL 62

Query: 63  VAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVS 122
            AG  AAG+ A   GP+P+PAVA LTR+ RA+ G++ISASHNPY DNGIK F  DG K+ 
Sbjct: 63  EAGLAAAGLSASFTGPMPTPAVAYLTRTFRAEAGIVISASHNPYYDNGIKFFSIDGTKLP 122

Query: 123 TDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVVD 182
            D+E+ IE  +E  LT   S    +G A R+     RYIE  K T P + +L GL+IV+D
Sbjct: 123 DDVEEAIEAEMEKPLTCVESA--ELGRANRIVDAAGRYIEFCKGTFPSEQSLNGLKIVLD 180

Query: 183 CANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIAL 242
           CANGA+Y +AP V  ELGADVV IG +PNGININ  CG+T+V  LQ++V E +AD+G+A 
Sbjct: 181 CANGATYHIAPNVLRELGADVVTIGCEPNGININEKCGATDVRLLQQRVVEEKADVGLAF 240

Query: 243 DGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLGL 302
           DGDGDRVI+VD  G  V+GDQI+ +IARE +    LRG G+V T+MSN+GLE  +  LG+
Sbjct: 241 DGDGDRVIMVDHLGQKVDGDQILYIIAREALRQGQLRG-GVVGTLMSNMGLELALKQLGI 299

Query: 303 SLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKPV 362
              R +VGDRY++E ++  G+ +G E SGH+IL D  +TGDG+VA LQ+L  + +    +
Sbjct: 300 PFLRAKVGDRYVLEKLQEEGWRLGAENSGHVILLDKTTTGDGIVAGLQILSAMVRNHMSL 359

Query: 363 STICHCFEEYPQFLRSVSVKDT-SILNSSSIVQAIADAESELRGIDRLIVRASGTESLIR 421
             +C   +  PQ L +V    +   L S +++      E+EL G  R+++R SGTE LIR
Sbjct: 360 HDLCSGMKLLPQVLVNVRFSGSHDPLKSENVINITKSVETELNGRGRVLLRKSGTEPLIR 419

Query: 422 IMAEGDDLSRIKRIVDDLAKVI 443
           +M EG+D  ++  +   +A  +
Sbjct: 420 VMVEGEDDVQVTALAHRIADAV 441


>gi|257465213|ref|ZP_05629584.1| phosphoglucosamine mutase [Actinobacillus minor 202]
 gi|257450873|gb|EEV24916.1| phosphoglucosamine mutase [Actinobacillus minor 202]
          Length = 443

 Score =  402 bits (1032), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 202/446 (45%), Positives = 299/446 (67%), Gaps = 9/446 (2%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M R++FGTDG+RG+   FPITP F +++G A G +    +  ++V+IGKDTR+SGYMLE+
Sbjct: 1   MARKYFGTDGVRGEVGKFPITPEFALKLGWAAGKVL-ATQGTKKVLIGKDTRISGYMLES 59

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +L AG TAAG+ A  +GP+P+PA+A LTR+ RA+ G++ISASHNPY DNGIK F   G K
Sbjct: 60  ALEAGLTAAGLSAVFVGPMPTPAIAYLTRTFRAEAGIVISASHNPYYDNGIKFFSAVGEK 119

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDS--IGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLR 178
           +  ++E+ IE +L++ +     C DS  +G A R++    RYIE  K   P  ++L+G +
Sbjct: 120 LPDEVEEAIEAMLDEPM----DCVDSANLGKASRINDAAGRYIEFCKAGFPSHLSLEGYK 175

Query: 179 IVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADI 238
           IVVDCANGA+Y +AP V  ELGA+V+ IG  PNG+NIN  CG+T++ +LQ+ V E  ADI
Sbjct: 176 IVVDCANGATYHIAPNVMRELGAEVIEIGTHPNGLNINEKCGATDIKALQKVVVEAGADI 235

Query: 239 GIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIA 298
           G+A DGDGDR+++VD  G  V+GDQI+ ++ARE +    L+G G+V T+MSN+ LE  + 
Sbjct: 236 GLAYDGDGDRIMMVDHLGNKVDGDQILFILAREALRAGKLQG-GVVGTLMSNMSLEIALK 294

Query: 299 GLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQY 358
            L +   R  VGDRY++E +K  G+ +GGE SGHII+ D  +TGDG++A+L+VL  +  +
Sbjct: 295 ELAIPFSRANVGDRYVLEQLKEKGWKLGGENSGHIIVLDKNTTGDGIIASLEVLAAMVSH 354

Query: 359 DKPVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADA-ESELRGIDRLIVRASGTE 417
              ++ +      +PQ L +V     +    S  V+A+A A E  L G  R+++R SGTE
Sbjct: 355 KMTLNELAKAVPLFPQVLINVRFSGGNNPLESEEVKAVAKAVEERLAGKGRILLRKSGTE 414

Query: 418 SLIRIMAEGDDLSRIKRIVDDLAKVI 443
            LIR+M E +D +  +   +++A+ +
Sbjct: 415 PLIRVMVECEDGTLAQSCAEEIAEAV 440


>gi|291276376|ref|YP_003516148.1| putative phospho-sugar mutase [Helicobacter mustelae 12198]
 gi|290963570|emb|CBG39402.1| putative phospho-sugar mutase [Helicobacter mustelae 12198]
          Length = 444

 Score =  401 bits (1031), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 201/446 (45%), Positives = 288/446 (64%), Gaps = 7/446 (1%)

Query: 4   RFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSLV 63
           + FGTDG+RGK+ +  ITP  ++R+GIA G  FR      ++++GKDTR SGYM+EN+LV
Sbjct: 2   KIFGTDGVRGKAGS-DITPFLVLRLGIAAGLYFRKHSVTNKILVGKDTRRSGYMIENALV 60

Query: 64  AGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVST 123
           +  T+ G D   +GP+P+PAVA LT  +R D G+MISASHNPY+DNGIK F   G+K+  
Sbjct: 61  SALTSVGYDVIQVGPMPTPAVAFLTEDMRCDGGIMISASHNPYEDNGIKFFDRLGFKLDE 120

Query: 124 DIEDRIETLLEDD--LTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVV 181
             E  IE + +++  + +    +  IG +KR+D V+ RYI  +K++ P+D T+QG+R+V+
Sbjct: 121 GAEREIEEIFKNENLIQNSFKTHVEIGSSKRIDDVNGRYIVQIKKSFPKDFTMQGIRVVL 180

Query: 182 DCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIA 241
           D ANG++YKVAP +F ELGADV+VI ++PNG NIN  CG+    +L   V   RAD+G  
Sbjct: 181 DAANGSAYKVAPTIFSELGADVIVIHNQPNGYNINEQCGAIAPNALSEAVKTYRADVGFG 240

Query: 242 LDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLG 301
           LDGD DR+++VD +GAIV+GDQ++  +AR       L+   IV TVMSN GLE F+ G+ 
Sbjct: 241 LDGDADRLVVVDNEGAIVHGDQLIGALARYQFLTGRLKNQKIVATVMSNFGLEEFLNGMD 300

Query: 302 LSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKP 361
           + L R +VGD+Y+ + M+    N GGEQSGHII SDY  TGDGLV+ALQV+ Y+K   + 
Sbjct: 301 IKLIRCDVGDKYVSDCMQREDLNFGGEQSGHIIFSDYAKTGDGLVSALQVVAYLKHIGQR 360

Query: 362 VSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGID-RLIVRASGTESLI 420
            S   H FE  PQ L ++ V     L     ++   +   E+ G   R +VR SGTE+ +
Sbjct: 361 ASQALHPFELTPQLLCNLPVSQKKPLEE---IEGYGEWLQEIEGRHIRHLVRYSGTENKL 417

Query: 421 RIMAEGDDLSRIKRIVDDLAKVIPMI 446
           RI+ EG D   +  ++ D  + +  +
Sbjct: 418 RILFEGRDKKELDTLMQDFTEFLSKV 443


>gi|323144911|ref|ZP_08079474.1| phosphoglucosamine mutase [Succinatimonas hippei YIT 12066]
 gi|322415309|gb|EFY06080.1| phosphoglucosamine mutase [Succinatimonas hippei YIT 12066]
          Length = 447

 Score =  401 bits (1031), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 203/444 (45%), Positives = 302/444 (68%), Gaps = 5/444 (1%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           MKR++FGTDG+RG+   +PITP+F++++G+A G +   +KK  +V+IGKDTRLSGYMLE 
Sbjct: 1   MKRKYFGTDGVRGRVGQYPITPDFVLKLGMAAGKVL-SRKKGGKVIIGKDTRLSGYMLEA 59

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +L +GF+AAG+   +LGP+P+PA++ LT++ RAD+GV+ISASHNPY DNGIK F  +G K
Sbjct: 60  ALESGFSAAGVSTVLLGPMPTPAISYLTKAFRADLGVVISASHNPYYDNGIKFFSREGTK 119

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +  ++E  IE +LE D+   L+     G A R +    RYIE  K +    ++L GL+IV
Sbjct: 120 LPDEVELEIEKILESDIV--LADSAEFGRAYRQEDAPGRYIEFCKSSFANHMSLSGLKIV 177

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           +DCANGA+Y VAP VF ELGA V+ IGD+P+GININ   GST+  +L  KV   +AD+GI
Sbjct: 178 IDCANGATYHVAPMVFRELGAKVITIGDRPDGININDGVGSTHPEALIEKVLATKADLGI 237

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           A DGDGDRV++VD  G +++GD ++ +IA++    + L G G+V T+MSN+GLE  +   
Sbjct: 238 AFDGDGDRVMMVDSHGHLLDGDALLYIIAKDRFVQNKLHG-GVVGTLMSNLGLELALKRE 296

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           G+   R+ VGDRY+ME + +  +N+GGE SGHII  +Y STGDG+V+ALQVL+   +  K
Sbjct: 297 GIEFTRSAVGDRYVMETLLDKKWNLGGENSGHIICLNYVSTGDGIVSALQVLKAAIRQGK 356

Query: 361 PVSTICHCFEEYPQFLRSVSVK-DTSILNSSSIVQAIADAESELRGIDRLIVRASGTESL 419
            +  +    + +PQ L ++ +      L+   ++  +   E+EL    R+++R SGTE +
Sbjct: 357 SLEDLVRSLDMFPQELVNLRLSAGFDALSDEKVLSEVKAVENELGSRGRVLLRKSGTEPV 416

Query: 420 IRIMAEGDDLSRIKRIVDDLAKVI 443
           +R+M EG+D   + R+   ++ VI
Sbjct: 417 VRVMVEGEDREYVHRLAQRISNVI 440


>gi|255349218|ref|ZP_05381225.1| phosphoglucosamine mutase [Chlamydia trachomatis 70]
 gi|255503755|ref|ZP_05382145.1| phosphoglucosamine mutase [Chlamydia trachomatis 70s]
          Length = 458

 Score =  401 bits (1031), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 207/443 (46%), Positives = 294/443 (66%), Gaps = 6/443 (1%)

Query: 3   RRFFGTDGIRGKSNTFPITPNFMMRIGIAV-GYLFRGKKKHRRVVIGKDTRLSGYMLENS 61
           R+ FGTDG+RG++N  P+T    + +G AV G L        RVV+GKDTRLSGYM EN+
Sbjct: 6   RQLFGTDGVRGRANFEPMTVETSVLLGKAVAGVLLEKHAGKHRVVVGKDTRLSGYMFENA 65

Query: 62  LVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKV 121
           L+AG T+ G++  +LGPIP+P VA +TR+ RAD G+MISASHNPY+DNGIK+F  DG+K+
Sbjct: 66  LIAGLTSMGIETLMLGPIPTPGVAFITRAYRADAGIMISASHNPYRDNGIKIFSSDGFKI 125

Query: 122 STDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVV 181
              +E+RIE ++       L    ++G  KRV     RYIE+ K T P+  TL+GLRIV+
Sbjct: 126 GQAVEERIEAMVASKDFGKLPDDHAVGKNKRVKDATGRYIEYAKATFPKGRTLKGLRIVL 185

Query: 182 DCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIA 241
           DCA+GA+Y+VAP VF EL A+V+  G +P+G NIN  CG+    ++Q+ V E +AD+GIA
Sbjct: 186 DCAHGATYRVAPSVFEELDAEVICYGCEPSGCNINAGCGALWPSTIQKAVIEHKADVGIA 245

Query: 242 LDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLG 301
           LDGDGDR+I+VDEKG IV+GD ++++ A +      L  N +V TVM+N  + R++  LG
Sbjct: 246 LDGDGDRLIMVDEKGHIVDGDMLLSICASDLKRRQALPDNRVVATVMTNFSVLRYLESLG 305

Query: 302 LSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKP 361
           + +  + VGDR+++++M  N   +GGEQSGH+I  DY +TGDG+V+ALQVLR + + +  
Sbjct: 306 IQVTISPVGDRHVLQHMLENQAVLGGEQSGHMIFLDYNTTGDGIVSALQVLRIMIESEST 365

Query: 362 VSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGID-RLIVRASGTESLI 420
           +S +  C  + PQ L +V V     L S + VQ +     E+ G   R+++R SGTE++ 
Sbjct: 366 LSDLTACIVKSPQALINVPVTKKVPLESLANVQGVLKEVKEVLGDSGRILLRYSGTENIC 425

Query: 421 RIMAEGDDLSRIKRIVDDLAKVI 443
           R+M EG      K  VD LAK I
Sbjct: 426 RVMVEGTK----KHQVDSLAKTI 444


>gi|114563986|ref|YP_751500.1| phosphoglucosamine mutase [Shewanella frigidimarina NCIMB 400]
 gi|122299120|sp|Q07ZA3|GLMM2_SHEFN RecName: Full=Phosphoglucosamine mutase 2
 gi|114335279|gb|ABI72661.1| phosphoglucosamine mutase [Shewanella frigidimarina NCIMB 400]
          Length = 450

 Score =  401 bits (1031), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 206/449 (45%), Positives = 298/449 (66%), Gaps = 8/449 (1%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M R++FGTDG+RG+  TFPITP+F M++G A G +       + V+IGKDTR SGYMLE+
Sbjct: 1   MSRKYFGTDGVRGRVGTFPITPDFAMKLGWAAGKVL-ASTGTQEVLIGKDTRSSGYMLES 59

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           ++ AG +AAG++  ++GP+P+PAVA L  + RAD GV+ISASHNP+ DNGIK F   G K
Sbjct: 60  AIEAGLSAAGVNVALIGPMPTPAVAYLASTFRADAGVVISASHNPFYDNGIKFFSNSGTK 119

Query: 121 VSTDIEDRIETLLEDDLT-SYLSCYDS--IGHAKRVDGVHDRYIEHVKRTLPRDVTLQGL 177
           ++   E  IE LL+  L  + + C  S  +G  +R+     RYIE  K    +D+TL GL
Sbjct: 120 LNDQQELEIEALLDQALNHNAMECVSSELLGKVRRITDAAGRYIEFCKGVFAKDLTLAGL 179

Query: 178 RIVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRAD 237
           +IVVD ANGA+Y +AP V+ ELGA+V+ I DKPNG NIN  CG+T++ SLQ  V    AD
Sbjct: 180 KIVVDSANGAAYHIAPNVYRELGAEVISINDKPNGTNINDHCGATHLDSLQTAVMVHEAD 239

Query: 238 IGIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFI 297
           +GIA+DGD DRV+ VD  G +V+GDQI+ ++A+       + G G+V T+MSN+GLE  +
Sbjct: 240 LGIAMDGDADRVMFVDHNGHVVDGDQILYILAKSAKQQGTMTG-GVVGTLMSNLGLEIAL 298

Query: 298 AGLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQ 357
             + +  KR +VGDRY++E +K  G+ +GGE SGHI+  D+ STGD +VA+L VL+ + Q
Sbjct: 299 KEMDIPFKRAKVGDRYVVEQLKQTGWRIGGEGSGHILHLDHASTGDAVVASLLVLQAVLQ 358

Query: 358 YDKPVSTICHCFEEYPQFLRSVSVKDTS---ILNSSSIVQAIADAESELRGIDRLIVRAS 414
             + ++ I  C ++ PQ L +V +   +   IL S+++ QA+ +AE+ L    R+++R S
Sbjct: 359 SGQSLAEIVSCMKKLPQVLLNVRLTANNADEILASAAVKQAVIEAEAVLAENGRVLLRKS 418

Query: 415 GTESLIRIMAEGDDLSRIKRIVDDLAKVI 443
           GTE LIR+M E  D    +   + +AKV+
Sbjct: 419 GTEPLIRVMVESTDPEMSQAQAEHIAKVV 447


>gi|91775138|ref|YP_544894.1| phosphoglucosamine mutase [Methylobacillus flagellatus KT]
 gi|123254701|sp|Q1H384|GLMM_METFK RecName: Full=Phosphoglucosamine mutase
 gi|91709125|gb|ABE49053.1| phosphoglucosamine mutase [Methylobacillus flagellatus KT]
          Length = 453

 Score =  401 bits (1030), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 207/450 (46%), Positives = 297/450 (66%), Gaps = 10/450 (2%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKH------RRVVIGKDTRLS 54
           M R++FGTDG+RGK  TFPITP+F+MR+G A G +      H        V+IGKDTR+S
Sbjct: 1   MSRKYFGTDGVRGKVGTFPITPDFVMRLGYAAGRVLTRMDHHLVPGTKPLVIIGKDTRIS 60

Query: 55  GYMLENSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLF 114
           GYM E +LV+G  A G++  I GP+P+PA+A +TR+ RA  G++ISASHNP+ DNGIK F
Sbjct: 61  GYMFETALVSGLCAGGVNVRITGPLPTPAIAHVTRAQRAQAGIVISASHNPFDDNGIKFF 120

Query: 115 GPDGYKVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTL 174
              G K+  ++E  IE  L+  +   L   + IG  KR+D    RYIE  K T P  + L
Sbjct: 121 SAQGTKLPDEVELAIEAELDQPME--LVPTEQIGRVKRIDDAAGRYIEFCKSTFPNALDL 178

Query: 175 QGLRIVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEV 234
           +GL+IV+DCANGA+Y VAP VF ELGA+V+ IG +PNG+NINL+ GST+  SLQ+ V E 
Sbjct: 179 RGLKIVLDCANGATYHVAPPVFHELGAEVISIGTQPNGLNINLNVGSTHPESLQQAVVEH 238

Query: 235 RADIGIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLE 294
           +AD+GIA DGDGDRV++ D +G +++GDQ++ +IA          G G+V T+M+N+ LE
Sbjct: 239 QADLGIAFDGDGDRVVMADNQGQLLDGDQLLYIIASH-RHQRGRLGGGVVGTLMTNLALE 297

Query: 295 RFIAGLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRY 354
             +   G+  +R +VGDRY++E +  N + +GGE SGHI+  D  S+GDG++AALQVL  
Sbjct: 298 HALGKEGIPFQRAKVGDRYVLELLNANEWQLGGENSGHILCLDKHSSGDGIIAALQVLHA 357

Query: 355 IKQYDKPVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQ-AIADAESELRGIDRLIVRA 413
           ++     ++        YPQ L +V V     L+S++ +Q A+  AE  L+G  R+++RA
Sbjct: 358 LRASGLSLADWAKRLPLYPQVLINVKVAQRIDLDSNTALQAAVTSAEGALKGTGRVLLRA 417

Query: 414 SGTESLIRIMAEGDDLSRIKRIVDDLAKVI 443
           SGTE  IR+M EG D   ++R+ +++A V+
Sbjct: 418 SGTEPKIRVMVEGQDRPLVQRLAEEIAAVV 447


>gi|307129380|ref|YP_003881396.1| phosphomannomutase/phosphoglucosamine mutase [Dickeya dadantii
           3937]
 gi|306526909|gb|ADM96839.1| Phosphomannomutase / Phosphoglucosamine mutase [Dickeya dadantii
           3937]
          Length = 445

 Score =  401 bits (1030), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 212/444 (47%), Positives = 301/444 (67%), Gaps = 9/444 (2%)

Query: 3   RRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSL 62
           R++FGTDGIRGK    PITP+F++++G A G +   +   R+++IGKDTR+SGYMLE++L
Sbjct: 4   RKYFGTDGIRGKVGDLPITPDFVLKLGWAAGKVL-ARHGSRKIIIGKDTRISGYMLESAL 62

Query: 63  VAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVS 122
            AG  AAG+ A   GP+P+PAVA LTR+ RA+ G++ISASHNPY DNGIK F  DG K+ 
Sbjct: 63  EAGLAAAGLSASFTGPMPTPAVAYLTRTFRAEAGIVISASHNPYYDNGIKFFSIDGTKLP 122

Query: 123 TDIEDRIETLLEDDLTSYLSCYDS--IGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
            ++E+ IE  +E  LT    C +S  +G A R+     RYIE  K T P +++L GL+IV
Sbjct: 123 DEVEEAIEAEMEKPLT----CVESAELGKANRIVDAAGRYIEFCKGTFPSELSLSGLKIV 178

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           VDCANGA+Y +AP V  ELGA V+ IG +P+G+NIN  CG+T+V  LQ +V   +ADIG+
Sbjct: 179 VDCANGATYHIAPSVLRELGARVIAIGCEPDGMNINEQCGATDVTQLQARVLAEKADIGL 238

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           A DGDGDR+I+VD +G  V+GDQI+ +IARE +    LRG G V T+MSN+GLE  +  L
Sbjct: 239 AFDGDGDRLIMVDHQGNKVDGDQILYIIAREALRQGQLRG-GAVGTLMSNMGLELALKQL 297

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           G+   R +VGDRY++E M++ G+ +G E SGH+IL D  +TGDG++A LQVL  + +   
Sbjct: 298 GVPFARAKVGDRYVLELMQSKGWRLGAENSGHVILLDKTTTGDGVIAGLQVLTAMVRNHM 357

Query: 361 PVSTICHCFEEYPQFLRSVSVK-DTSILNSSSIVQAIADAESELRGIDRLIVRASGTESL 419
            +  +C   + +PQ L +V    +   L S S+ QA    E +L G  R+++R SGTE L
Sbjct: 358 SLHDLCSGMKLFPQILVNVHFSGEGDPLESESVKQAAQAVEEQLAGRGRVLLRKSGTEPL 417

Query: 420 IRIMAEGDDLSRIKRIVDDLAKVI 443
           IR+M EG+D + + ++ + +A  +
Sbjct: 418 IRVMVEGEDEATVTQMANRIADAV 441


>gi|94264458|ref|ZP_01288246.1| Phosphoglucosamine mutase [delta proteobacterium MLMS-1]
 gi|93455089|gb|EAT05313.1| Phosphoglucosamine mutase [delta proteobacterium MLMS-1]
          Length = 453

 Score =  401 bits (1030), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 199/443 (44%), Positives = 295/443 (66%), Gaps = 2/443 (0%)

Query: 3   RRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSL 62
           RR FGTDGIRG +N +P+T    M++G  + ++ + + +  R+VIGKDTR+SGYM+EN+L
Sbjct: 2   RRLFGTDGIRGVANLYPMTTEIAMQVGRGIAFVVKRQGRRHRIVIGKDTRISGYMIENAL 61

Query: 63  VAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVS 122
            AG  + G+D  ++GP+P+P +A +T S+RAD GV+ISASHNP+ DNGIK+F  DGYK+ 
Sbjct: 62  AAGICSMGVDILLVGPLPTPGIAFITTSMRADAGVVISASHNPFPDNGIKIFAADGYKLP 121

Query: 123 TDIEDRIETLL-EDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVV 181
              E  IE L+    + S     + IG A R+D    RYI  +K T P + TL    IV+
Sbjct: 122 DAQELEIEELIFSQKMASLRPTAEEIGKASRIDDARGRYIVFLKNTFPAEYTLDDFHIVL 181

Query: 182 DCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIA 241
           DCA+GA+Y VAP VF ELGA V  +G +P+G NIN DCG+    ++  +V E+ AD+GIA
Sbjct: 182 DCAHGATYGVAPAVFAELGARVSCLGVEPDGTNINHDCGALQPQAMAARVRELGADLGIA 241

Query: 242 LDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLG 301
           LDGDGDR+++ DE G I++GDQ+MA+ A + +    L    +V TVMSNIGLE F+ GLG
Sbjct: 242 LDGDGDRLMVADETGQILDGDQVMAICAADLLKRKKLNKKTLVATVMSNIGLEHFMKGLG 301

Query: 302 LSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKP 361
             L+R++VGDRY++E M+  G+N GGEQSGH+I  D+ +TGDG++AAL++L  +   ++ 
Sbjct: 302 GRLERSQVGDRYVVEKMRAKGYNFGGEQSGHLIFLDHNTTGDGILAALRLLAVMIGENRR 361

Query: 362 VSTICHCFEEYPQFLRSVSVKDTSILNS-SSIVQAIADAESELRGIDRLIVRASGTESLI 420
           +S +    +  PQ LR+V ++    + +   +   +   E+EL    R+++RASGTE L+
Sbjct: 362 LSELASRLQLLPQVLRNVRLEQPVAVKAIGGLKSLVKKLEAELGSDGRILIRASGTEPLL 421

Query: 421 RIMAEGDDLSRIKRIVDDLAKVI 443
           R+M EG    RI+ + +++ + I
Sbjct: 422 RVMIEGPHRERIEAMAEEICQHI 444


>gi|307546732|ref|YP_003899211.1| phosphoglucosamine mutase [Halomonas elongata DSM 2581]
 gi|307218756|emb|CBV44026.1| phosphoglucosamine mutase [Halomonas elongata DSM 2581]
          Length = 449

 Score =  401 bits (1030), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 208/451 (46%), Positives = 298/451 (66%), Gaps = 11/451 (2%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M RR+FGTDGIRG     PIT +FM+++G A G +   +    +V+IGKDTR+SGYM E+
Sbjct: 1   MTRRYFGTDGIRGTVGEAPITADFMLKLGWATGRVLARESGQAKVLIGKDTRISGYMFES 60

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +L AG +AAG+D  +LGP+P+P +A LTR+ RAD G++ISASHN + DNGIK F  +G K
Sbjct: 61  ALEAGLSAAGVDVILLGPMPTPGIAYLTRTFRADAGIVISASHNAFADNGIKFFSAEGVK 120

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +   +E+RIE +L++ LT+       +G A+RVD    RYIE  K T+P  V L GLR+V
Sbjct: 121 LPDAVEERIEAMLDEPLTTV--APHELGKARRVDDAAGRYIEFCKSTIPDRVNLHGLRMV 178

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           VDCA+GA+Y +AP VF ELGADV +IG  P+G+NIN + GST   +L+  V    AD+G+
Sbjct: 179 VDCAHGATYHIAPSVFRELGADVSLIGASPDGLNINHEVGSTQPAALRAAVIREGADLGV 238

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           A DGDGDRV++VD  G  V+GD I+ +IAR+  +   L G G+V T MSN GL   +  L
Sbjct: 239 AFDGDGDRVLLVDVDGREVDGDDILYIIARDRHARGEL-GGGVVGTQMSNFGLAAALEAL 297

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           G+  +R +VGDRY+ME +  NG+ +GGE SGHI+     +TGDG+V+ALQVL  + +  +
Sbjct: 298 GIPFERAKVGDRYVMERLAANGWQLGGESSGHIVCGHVQTTGDGIVSALQVLSVMAREGR 357

Query: 361 PVSTICHCFEEYPQFLRSVSVKD----TSILNSSSIVQAIADAESELRGIDRLIVRASGT 416
            +S +    E+ PQ L +V +       S++  +++ +A+A  E EL+   R+++R SGT
Sbjct: 358 ALSELMVGLEKAPQALINVRLTPGTDARSLMKDAALREAVAALEGELKDEGRVLLRPSGT 417

Query: 417 ESLIRIMAEG----DDLSRIKRIVDDLAKVI 443
           E LIR+M EG    D  S  +R+ DD+  ++
Sbjct: 418 EPLIRVMVEGRPHLDVQSLARRLADDVESML 448


>gi|261345165|ref|ZP_05972809.1| phosphoglucosamine mutase [Providencia rustigianii DSM 4541]
 gi|282566857|gb|EFB72392.1| phosphoglucosamine mutase [Providencia rustigianii DSM 4541]
          Length = 445

 Score =  400 bits (1029), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 208/442 (47%), Positives = 298/442 (67%), Gaps = 5/442 (1%)

Query: 3   RRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSL 62
           R++FGTDGIRGK    PITP+F++++G A G +   +   R+++IGKDTR+SGYMLE+SL
Sbjct: 4   RKYFGTDGIRGKVGDSPITPDFVLKLGWAAGKVL-ARHGSRKIIIGKDTRISGYMLESSL 62

Query: 63  VAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVS 122
            AG  AAG+ A   GP+P+PAVA LTR+ RA+ G++ISASHNPY DNGIK F  DG K+ 
Sbjct: 63  EAGLAAAGLSASFTGPMPTPAVAYLTRTFRAEAGIVISASHNPYYDNGIKFFSIDGTKLP 122

Query: 123 TDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVVD 182
            ++E+ IE  +E  +T   S    +G A R+     RYIE  K T P + +L  L++V+D
Sbjct: 123 DEVEEAIEAEMEKPITCVESA--ELGRANRIVDAAGRYIEFCKGTFPNEQSLNSLKVVLD 180

Query: 183 CANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIAL 242
           CANGA+Y +AP VF ELGA+V+ IG  PNGININ +CG+T+V  LQ +V   +AD+G+A 
Sbjct: 181 CANGATYHIAPNVFSELGAEVIAIGCDPNGININEECGATDVRMLQERVIAEKADVGLAF 240

Query: 243 DGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLGL 302
           DGDGDR+I+VD +G  V+GDQI+ +IARE +    L+G G++ T+MSN+GLE  +  LG+
Sbjct: 241 DGDGDRIIMVDHEGNKVDGDQILYIIAREALRQGQLKG-GVIGTLMSNMGLEIALKQLGI 299

Query: 303 SLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKPV 362
             +R +VGDRY++E ++  G+ +G E SGH+IL D  +TGDG+VA LQVL  + +    +
Sbjct: 300 PFERAKVGDRYVLEKLQEKGWRMGAENSGHVILLDKTTTGDGIVAGLQVLSAMVRNQMSL 359

Query: 363 STICHCFEEYPQFLRSVSVKDT-SILNSSSIVQAIADAESELRGIDRLIVRASGTESLIR 421
             +C   +  PQ L +V  K     L S +++ A    E EL G  R+++R SGTE LIR
Sbjct: 360 HDLCSGMKLLPQVLVNVRFKGKHDPLQSDAVIAANEQVEKELAGKGRVLLRKSGTEPLIR 419

Query: 422 IMAEGDDLSRIKRIVDDLAKVI 443
           +M EG+D   + ++ + +A  +
Sbjct: 420 VMVEGEDEETVTKMANHIADAV 441


>gi|166154159|ref|YP_001654277.1| phosphoglucosamine mutase [Chlamydia trachomatis 434/Bu]
 gi|166155034|ref|YP_001653289.1| phosphoglucosamine mutase [Chlamydia trachomatis
           L2b/UCH-1/proctitis]
 gi|301335402|ref|ZP_07223646.1| phosphoglucosamine mutase [Chlamydia trachomatis L2tet1]
 gi|226722722|sp|B0B944|GLMM_CHLT2 RecName: Full=Phosphoglucosamine mutase
 gi|226722723|sp|B0BAS3|GLMM_CHLTB RecName: Full=Phosphoglucosamine mutase
 gi|165930147|emb|CAP03631.1| phosphoglucosamine mutase [Chlamydia trachomatis 434/Bu]
 gi|165931022|emb|CAP06585.1| phosphoglucosamine mutase [Chlamydia trachomatis
           L2b/UCH-1/proctitis]
          Length = 458

 Score =  400 bits (1029), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 206/442 (46%), Positives = 294/442 (66%), Gaps = 6/442 (1%)

Query: 4   RFFGTDGIRGKSNTFPITPNFMMRIGIAV-GYLFRGKKKHRRVVIGKDTRLSGYMLENSL 62
           + FGTDG+RG++N  P+T    + +G A+ G L        RVV+GKDTRLSGYM EN+L
Sbjct: 7   QLFGTDGVRGRANFEPMTVETSVLLGKAIAGVLLEKHAGKHRVVVGKDTRLSGYMFENAL 66

Query: 63  VAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVS 122
           +AG T+ G++  +LGPIP+P VA +TR+ RAD G+MISASHNPY+DNGIK+F  DG+K+ 
Sbjct: 67  IAGLTSMGIETLMLGPIPTPGVAFITRAYRADAGIMISASHNPYRDNGIKIFSSDGFKIG 126

Query: 123 TDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVVD 182
             +E+RIE ++       L    ++G  KRV     RYIE+ K T P+  TL+GLRIV+D
Sbjct: 127 QAVEERIEAMVASKDFGKLPDDHAVGKNKRVKDATGRYIEYAKATFPKGRTLKGLRIVLD 186

Query: 183 CANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIAL 242
           CA+GA+Y+VAP VF EL A+V+  G +P+G NIN  CG+    ++Q+ V E +AD+GIAL
Sbjct: 187 CAHGATYRVAPSVFEELDAEVICYGCEPSGCNINAGCGALWPSTIQKAVIEHKADVGIAL 246

Query: 243 DGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLGL 302
           DGDGDR+I+VDEKG IV+GD ++++ A +      L  N +V TVM+N G+ R++  LG+
Sbjct: 247 DGDGDRLIMVDEKGHIVDGDMLLSICASDLKRRQALPDNRVVATVMTNFGVLRYLESLGI 306

Query: 303 SLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKPV 362
            +  + VGDR+++++M  N   +GGEQSGH+I  DY +TGDG+V+ALQVLR + + +  +
Sbjct: 307 QVTISPVGDRHVLQHMLENQAVLGGEQSGHMIFLDYNTTGDGIVSALQVLRIMIESESTL 366

Query: 363 STICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGID-RLIVRASGTESLIR 421
           S +  C  + PQ L +V V     L S + VQ +     E+ G   R+++R SGTE++ R
Sbjct: 367 SDLTACIVKSPQALINVPVTKKVPLESLANVQGVLKEVKEVLGDSGRILLRYSGTENICR 426

Query: 422 IMAEGDDLSRIKRIVDDLAKVI 443
           +M EG      K  VD LAK I
Sbjct: 427 VMVEGTK----KHQVDSLAKTI 444


>gi|315453084|ref|YP_004073354.1| Phosphoglucosamine mutase [Helicobacter felis ATCC 49179]
 gi|315132136|emb|CBY82764.1| Phosphoglucosamine mutase [Helicobacter felis ATCC 49179]
          Length = 444

 Score =  400 bits (1029), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 201/437 (45%), Positives = 288/437 (65%), Gaps = 7/437 (1%)

Query: 6   FGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSLVAG 65
           FGTDG+RG++    ITP F++++GIA G  F+ +   R++++GKDTR SGYM+EN+LV+ 
Sbjct: 3   FGTDGVRGRAGV-EITPMFVIQLGIAAGLYFKEQGASRKILVGKDTRKSGYMIENALVSA 61

Query: 66  FTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVSTDI 125
            T+ G D   +GP+P+PA+A LT ++R D GVMISASHNP++DNGIK F   GYK+    
Sbjct: 62  LTSVGYDVMQIGPMPTPAIAFLTENMRCDAGVMISASHNPFEDNGIKFFDRFGYKLQKQS 121

Query: 126 EDRIETLLEDD--LTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVVDC 183
           E  IE +  D   L S      +IG +KR+D V  RYI H+K + P+ ++LQG+R+V+D 
Sbjct: 122 EAEIEKIFADSKRLESSYQSGVAIGSSKRIDDVIGRYIVHLKNSFPKHLSLQGMRVVIDV 181

Query: 184 ANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIALD 243
           ANGA YKVAP VF ELGADV+VI D+PNG NIN  CG+   L L ++V   RAD+GIALD
Sbjct: 182 ANGAGYKVAPIVFSELGADVIVINDEPNGSNINAQCGALYPLGLSQEVKRYRADLGIALD 241

Query: 244 GDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLGLS 303
           GD DR+++VDE G +V+GD+++ ++A      + L  N +V T MSN+ L+ +++G G+S
Sbjct: 242 GDADRLVVVDELGQVVHGDKLIGVLAMYQKQRTKLASNKVVATTMSNLALQEYLSGQGIS 301

Query: 304 LKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKPVS 363
           L R EVGD+++   M+    N GGEQSGHII  DY  TGDG+++ALQV   + +  K  S
Sbjct: 302 LVRCEVGDKFVSACMQEQEANFGGEQSGHIIFGDYSKTGDGIMSALQVAACVIESRKRSS 361

Query: 364 TICHCFEEYPQFLRSVSVKDTSILNS-SSIVQAIADAESELRGIDRLIVRASGTESLIRI 422
            +   FE YPQ L +V +K    L       + + + E E     R ++R SGTE+++RI
Sbjct: 362 QVLSPFELYPQLLENVRIKTKKPLEKLPHFKEMLKNLEQE---NIRHLIRYSGTENILRI 418

Query: 423 MAEGDDLSRIKRIVDDL 439
           + EG D S +++   +L
Sbjct: 419 LLEGQDRSLLEKRAQEL 435


>gi|294634510|ref|ZP_06713045.1| phosphoglucosamine mutase [Edwardsiella tarda ATCC 23685]
 gi|291092024|gb|EFE24585.1| phosphoglucosamine mutase [Edwardsiella tarda ATCC 23685]
          Length = 445

 Score =  400 bits (1029), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 206/448 (45%), Positives = 303/448 (67%), Gaps = 9/448 (2%)

Query: 2   KRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENS 61
           +R++FGTDGIRGK  + PITP+F++++G A G +   +   R+++IGKDTR+SGYMLE++
Sbjct: 3   ERKYFGTDGIRGKVGSNPITPDFVLKLGWAAGKVL-ARHGSRKIIIGKDTRISGYMLESA 61

Query: 62  LVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKV 121
           L AG  AAG+ A   GP+P+PA+A LTR+ RA+ G++ISASHNPY DNGIK F  DG K+
Sbjct: 62  LEAGLAAAGLSAAFTGPMPTPAIAYLTRTFRAEAGIVISASHNPYYDNGIKFFSIDGTKL 121

Query: 122 STDIEDRIETLLEDDLTSYLSCYDS--IGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRI 179
             ++E  IE  LE  LT    C +S  +G A R+     RYIE  K T P  ++L GL+I
Sbjct: 122 PDEVEAAIEAELEKPLT----CVESAELGKASRIVDAAGRYIEFCKSTFPNALSLNGLKI 177

Query: 180 VVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIG 239
           V DCANGA+Y +AP V  ELGA+V+ IG  P+G+NIN +CG+T+V +LQ +V   +AD+G
Sbjct: 178 VADCANGATYHIAPNVLRELGAEVITIGTSPDGMNINKECGATDVRALQARVVAEQADLG 237

Query: 240 IALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAG 299
           +A DGDGDR+I+VD +G  V+GDQI+ ++ARE +    L G G+V T+MSN+GLE  +  
Sbjct: 238 MAFDGDGDRLIMVDHQGNKVDGDQILYIVAREALRQGKLHG-GVVGTLMSNMGLELALKQ 296

Query: 300 LGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYD 359
           LG+   R +VGDRY++E ++  G+ +G E SGH+I+ D  +TGDG+VA LQVL  + +  
Sbjct: 297 LGIPFARAKVGDRYVLETLQEKGWRMGAENSGHVIILDQTTTGDGIVAGLQVLAAMARNH 356

Query: 360 KPVSTICHCFEEYPQFLRSVSVK-DTSILNSSSIVQAIADAESELRGIDRLIVRASGTES 418
             ++ +C      PQ L +V        L  +++ QA  + E +L G  R+++R SGTE 
Sbjct: 357 MSLADLCSGMTLLPQVLVNVRFAGQNDPLQDAAVQQACVEVEQQLAGRGRVLLRKSGTEP 416

Query: 419 LIRIMAEGDDLSRIKRIVDDLAKVIPMI 446
           LIR+M EG++L+++ R+ + +A  +  +
Sbjct: 417 LIRVMVEGEELAQVTRLAESIAAAVKAV 444


>gi|229592641|ref|YP_002874760.1| phosphoglucosamine mutase [Pseudomonas fluorescens SBW25]
 gi|259647725|sp|C3K264|GLMM_PSEFS RecName: Full=Phosphoglucosamine mutase
 gi|229364507|emb|CAY52358.1| phosphoglucosamine mutase [Pseudomonas fluorescens SBW25]
          Length = 445

 Score =  400 bits (1029), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 201/444 (45%), Positives = 295/444 (66%), Gaps = 5/444 (1%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M +++FGTDGIRG+   FPITP+FM+++G A G  FR     R +++GKDTR+SGYM E+
Sbjct: 1   MTKKYFGTDGIRGRVGEFPITPDFMLKLGWAAGMAFRSMGACR-ILVGKDTRISGYMFES 59

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +L AG +AAG D  +LGP+P+PA+A LTR+  A+ G++ISASHNP+ DNGIK F   G K
Sbjct: 60  ALEAGLSAAGADVMLLGPMPTPAIAYLTRTFHAEAGIVISASHNPHDDNGIKFFSGQGTK 119

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +  +IE  IE LL+  +T   S    +G   R++    RYIE  K ++P      GL+IV
Sbjct: 120 LPDEIELMIEELLDAPMTVVES--SKLGKVSRINDASGRYIEFCKSSVPSSTNFAGLKIV 177

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           VDCA+GA+YKVAP VF ELGADV V+  +PNG+NIN +CGST++  LQ  V    AD+GI
Sbjct: 178 VDCAHGATYKVAPSVFKELGADVTVLSAQPNGLNINDNCGSTHMEQLQAAVLAEHADLGI 237

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           A DGDGDRV++VD  GAIV+GD ++ +IAR+    + L+G G+V T+MSN+GLE  +A L
Sbjct: 238 AFDGDGDRVLMVDHTGAIVDGDDLLFIIARDLHERNKLQG-GVVGTLMSNLGLELALADL 296

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           G+   R  VGDRY++  +    + VGGE SGH++   + +TGD ++AALQVL  +++ ++
Sbjct: 297 GIPFVRANVGDRYVIAELLERNWQVGGENSGHVVCFQHTTTGDAIIAALQVLLSLRRREE 356

Query: 361 PVSTICHCFEEYPQFLRSVSVK-DTSILNSSSIVQAIADAESELRGIDRLIVRASGTESL 419
            ++       + PQ L +V      + +   ++ +A       + G  R+++R SGTE L
Sbjct: 357 SLAQARQALRKCPQVLLNVRFAGGENPIEHPAVKEACERVTLAMAGRGRVLLRKSGTEPL 416

Query: 420 IRIMAEGDDLSRIKRIVDDLAKVI 443
           +R+M EGDD ++++   +DLAK++
Sbjct: 417 VRVMVEGDDETQVRGHAEDLAKLV 440


>gi|261380990|ref|ZP_05985563.1| phosphoglucosamine mutase [Neisseria subflava NJ9703]
 gi|284796020|gb|EFC51367.1| phosphoglucosamine mutase [Neisseria subflava NJ9703]
          Length = 445

 Score =  400 bits (1028), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 201/445 (45%), Positives = 298/445 (66%), Gaps = 6/445 (1%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRR--VVIGKDTRLSGYML 58
           M +++FGTDG+RG+   FPI P+F++++G A G +    +   +  V+IGKDTR+SGYML
Sbjct: 1   MAKKYFGTDGVRGEVGQFPINPDFVLKLGYAAGQVLVQHEGEIKPTVLIGKDTRISGYML 60

Query: 59  ENSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDG 118
           E +L+AGFTAAG++    GP+P+P VA LTR+LR   GVMISASHN Y DNGIK F   G
Sbjct: 61  EAALIAGFTAAGVNVIQTGPLPTPGVAYLTRALRLSAGVMISASHNVYSDNGIKFFAEGG 120

Query: 119 YKVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLR 178
            K+S +IE  IE  +++++ +  S    +G A+R++G  DRYIE  K T P  + L+GL+
Sbjct: 121 VKLSDEIELEIEAKIDEEMKTQPSS--RLGRARRINGADDRYIEFCKSTFPSHLDLRGLK 178

Query: 179 IVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADI 238
           +VVD ANGA Y VAP+VF ELGA VV IGD+PNG NIN  CG+T+  +LQ  V +  AD 
Sbjct: 179 LVVDTANGAGYAVAPKVFHELGAQVVSIGDEPNGYNINEKCGATHPKALQAAVLQNEADY 238

Query: 239 GIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIA 298
           GIALDGDGDR+++VD  G + +GD ++ +IA+   +H  +   G+V TVM+N+ +E  + 
Sbjct: 239 GIALDGDGDRLMMVDRNGKVYDGDSLIYVIAKA-RAHEGVEIGGVVGTVMTNMAMEVALK 297

Query: 299 GLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQY 358
             G+   R +VGDRY++E +   G+ +GGE SGHI+  D  +TGDG+++ALQVL  ++  
Sbjct: 298 EQGVDFCRAKVGDRYVLEQLHQRGWLIGGEASGHILCMDKHNTGDGIISALQVLAALQTL 357

Query: 359 DKPVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTES 418
           ++ ++T+C  ++ YPQ + +V +K       +S  +A+A+ E EL G  R+++RASGTE 
Sbjct: 358 NQDLATVCADWQPYPQTMINVRIKKGQNWQDAS-KEALAEVEKELEGKGRVVLRASGTEP 416

Query: 419 LIRIMAEGDDLSRIKRIVDDLAKVI 443
           ++R+M E       K+  + +A  I
Sbjct: 417 VVRVMVEAKQADWAKKGAEKIAAAI 441


>gi|268592829|ref|ZP_06127050.1| phosphoglucosamine mutase [Providencia rettgeri DSM 1131]
 gi|291311615|gb|EFE52068.1| phosphoglucosamine mutase [Providencia rettgeri DSM 1131]
          Length = 445

 Score =  400 bits (1028), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 210/442 (47%), Positives = 299/442 (67%), Gaps = 5/442 (1%)

Query: 3   RRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSL 62
           R++FGTDGIRGK    PITP+F++++G A G +   +   R+++IGKDTR+SGYMLE+SL
Sbjct: 4   RKYFGTDGIRGKVGDSPITPDFVLKLGWAAGKVL-ARHGSRKIIIGKDTRISGYMLESSL 62

Query: 63  VAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVS 122
            AG  AAG+ A   GP+P+PAVA LTR+ RA+ G++ISASHNPY DNGIK F  DG K+ 
Sbjct: 63  EAGLAAAGLSASFTGPMPTPAVAYLTRTFRAEAGIVISASHNPYYDNGIKFFSIDGTKLP 122

Query: 123 TDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVVD 182
            ++E+ IE  +E  +T   S    +G A R+     RYIE  K T P + +L  L+IV+D
Sbjct: 123 DEVEEAIEAEMEKPITCVESA--ELGRANRIVDAAGRYIEFCKGTFPNEQSLASLKIVID 180

Query: 183 CANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIAL 242
           CANGA+Y +AP VF ELGA+V+ IG  PNGININ +CG+T+V  LQ+KV E +A +G+A 
Sbjct: 181 CANGATYHIAPNVFRELGAEVITIGCDPNGININEECGATDVRQLQQKVLEEKAHVGLAF 240

Query: 243 DGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLGL 302
           DGDGDR+I+VD  G  V+GDQI+ +IARE +    L+G G+V T+MSN+GLE  +  LG+
Sbjct: 241 DGDGDRIIMVDHLGEKVDGDQILFIIAREALRQGQLKG-GVVGTLMSNMGLEIALKQLGI 299

Query: 303 SLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKPV 362
             +R +VGDRY++E ++  G+ +G E SGH+IL D  +TGDG+VA LQVL  + +    +
Sbjct: 300 PFERAKVGDRYVLEKLQEKGWRMGAENSGHVILLDKTTTGDGIVAGLQVLSAMVRNHMSL 359

Query: 363 STICHCFEEYPQFLRSVSVK-DTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLIR 421
             +C   +  PQ L +V  K     L S ++V A  + E +L G  R+++R SGTE LIR
Sbjct: 360 HDLCSGMKLLPQVLVNVRFKGQHDPLQSDAVVAANEEVEKQLAGKGRVLLRKSGTEPLIR 419

Query: 422 IMAEGDDLSRIKRIVDDLAKVI 443
           +M EG++ + +  + + +A  +
Sbjct: 420 VMVEGENEADVTAMANHIADAV 441


>gi|237745686|ref|ZP_04576166.1| phosphoglucosamine mutase [Oxalobacter formigenes HOxBLS]
 gi|229377037|gb|EEO27128.1| phosphoglucosamine mutase [Oxalobacter formigenes HOxBLS]
          Length = 448

 Score =  400 bits (1028), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 209/444 (47%), Positives = 296/444 (66%), Gaps = 8/444 (1%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHR---RVVIGKDTRLSGYM 57
           MKRR+FGTDG+RG+    PITP+F+M++G A G +            V+IGKDTR+SGYM
Sbjct: 1   MKRRYFGTDGVRGRVGKTPITPDFVMKLGYAAGKVLTRTSMSSGSPTVLIGKDTRISGYM 60

Query: 58  LENSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPD 117
           LE SL AG +AAG+D  + GP+P+PAVA LTR+LR   G++ISASHNPYQDNGIK F   
Sbjct: 61  LEASLQAGLSAAGVDVMLSGPMPTPAVAYLTRALRLSAGIVISASHNPYQDNGIKFFSAS 120

Query: 118 GYKVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGL 177
           G K+  D+E  IE+L+E  +    +  + +G  +R+D    RYIE  K T P D  L+GL
Sbjct: 121 GNKLPDDMEFEIESLIEKPMDC--ASPEFLGKVRRLDDAQGRYIEFCKSTFPNDFDLRGL 178

Query: 178 RIVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRAD 237
           +IVVDCANGA+Y +AP VF ELGADVV IG +P+G+NIN +CG+T+V SL   V E RAD
Sbjct: 179 KIVVDCANGAAYHIAPCVFHELGADVVSIGVQPDGLNINENCGATSVDSLVSAVVENRAD 238

Query: 238 IGIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFI 297
           +GIALDGD DR+++VD +G + NGDQ++ LIA++ +++S ++  G+V T+M+N+GLE   
Sbjct: 239 LGIALDGDADRLVMVDAEGQVYNGDQLLYLIAKDRLAYSDVK--GVVGTLMTNMGLEVAF 296

Query: 298 AGLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQ 357
               +   R  VGDRY++E +   G+ +GGE SGH+I  D  +TGDG+++ALQVL  +K+
Sbjct: 297 REKQVGFARANVGDRYVLETLLEKGWLLGGEGSGHLICLDKHTTGDGIISALQVLAALKR 356

Query: 358 YDKPVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQA-IADAESELRGIDRLIVRASGT 416
           +   +         +PQ L +V +        ++ +QA     E EL    R+++RASGT
Sbjct: 357 HKTTLPAFLSELTLFPQTLVNVRIDPGFNWKENTSMQAEKQKVEKELGNRGRVLIRASGT 416

Query: 417 ESLIRIMAEGDDLSRIKRIVDDLA 440
           E LIR+M E +D S+ K + + +A
Sbjct: 417 EPLIRVMVEAEDASQAKEMAERIA 440


>gi|302879455|ref|YP_003848019.1| phosphoglucosamine mutase [Gallionella capsiferriformans ES-2]
 gi|302582244|gb|ADL56255.1| phosphoglucosamine mutase [Gallionella capsiferriformans ES-2]
          Length = 450

 Score =  400 bits (1028), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 209/448 (46%), Positives = 296/448 (66%), Gaps = 8/448 (1%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHR----RVVIGKDTRLSGY 56
           M +++FGTDGIRG+   FPITP F+M++G A G +    +  R     V+IGKDTR+SGY
Sbjct: 1   MSKKYFGTDGIRGRVGDFPITPQFVMQLGYAAGRVLASAEHTRGERSAVLIGKDTRISGY 60

Query: 57  MLENSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGP 116
           MLE++L AG  AAG+D ++ GPIP+PAVA LTR+LR   G++ISASHNPY+DNGIK F  
Sbjct: 61  MLESALQAGLIAAGVDVYLAGPIPTPAVAYLTRTLRLQAGIVISASHNPYEDNGIKFFSA 120

Query: 117 DGYKVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQG 176
           +G K+  DIE  IE  L+ +++  +     +G AKR+D    RYIE  K T P  + L+G
Sbjct: 121 NGSKLPDDIEHAIEAGLDGEIS--IDSATGLGKAKRLDDAVGRYIEFCKSTFPSAMNLRG 178

Query: 177 LRIVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRA 236
           ++IVVDCA+GA+Y +A  V  ELGA+V+ IG KP+G NIN   G+T   +LQ  V E +A
Sbjct: 179 MKIVVDCAHGATYHIAQHVLHELGAEVIAIGVKPDGKNINDGYGATAPANLQAAVVEHQA 238

Query: 237 DIGIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERF 296
           D+GIALDGDGDR+++VD KG + +GDQ++ +IAR+      L G G+V T+M+N+  E  
Sbjct: 239 DLGIALDGDGDRLVMVDSKGVLYDGDQLIYVIARQRQEQGRLVG-GVVGTLMTNLAFEHA 297

Query: 297 IAGLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIK 356
           +  +G+   R  VGDRY+ME +  NG+ +GGE SGHII  D  STGDG+V+AL+VL  ++
Sbjct: 298 MQKMGVPFLRARVGDRYVMELLHQNGWELGGENSGHIICLDKHSTGDGIVSALEVLHALR 357

Query: 357 QYDKPVSTICHCFEEYPQFLRSVSV-KDTSILNSSSIVQAIADAESELRGIDRLIVRASG 415
             +  +S      + YPQ L  V V K    L  + +  A+A AE  L G  R+++R SG
Sbjct: 358 TQNVSLSEAAGDLKLYPQVLIYVRVAKGVDCLGHADVKAAVAIAERALDGRGRVLLRPSG 417

Query: 416 TESLIRIMAEGDDLSRIKRIVDDLAKVI 443
           TE L+R+M EG+D + +++    +A V+
Sbjct: 418 TEPLLRVMVEGEDKALVEQSAKQIADVV 445


>gi|330807479|ref|YP_004351941.1| phosphoglucosamine mutase [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
 gi|327375587|gb|AEA66937.1| phosphoglucosamine mutase [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
          Length = 445

 Score =  400 bits (1028), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 201/449 (44%), Positives = 299/449 (66%), Gaps = 5/449 (1%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M +++FGTDGIRG+   +PITP+FM+++G A G  FR K    +V++GKDTR+SGYM E+
Sbjct: 1   MSKKYFGTDGIRGRVGEYPITPDFMLKLGWAAGMAFR-KMGACKVLVGKDTRISGYMFES 59

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +L AG T+AG D  +LGP+P+PA+A LTR+ +A  G++ISASHNP+ DNGIK F   G K
Sbjct: 60  ALEAGLTSAGADVMLLGPMPTPAIAYLTRTFQAQAGIVISASHNPHDDNGIKFFSGQGTK 119

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +  DIE  IE LL+  +T   S    IG   R++    RYIE  K ++P   +  GL++V
Sbjct: 120 LPDDIELMIEELLDTPMTVVES--SKIGKVSRINDASGRYIEFCKGSVPTGTSFSGLKVV 177

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           VDCA+GA+YKVAP VF ELGA+VVV+  +PNG+NIN +CGST+  +LQ  V   +AD+GI
Sbjct: 178 VDCAHGATYKVAPSVFRELGAEVVVLSAQPNGLNINHNCGSTHTEALQAAVLAEQADLGI 237

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           A DGDGDRV++VD  G +V+GD+++ +IAR+      L+G G+V T+MSN+GLE  +A L
Sbjct: 238 AFDGDGDRVLMVDHTGTVVDGDELLFIIARDLHGRGKLQG-GVVGTLMSNLGLELALADL 296

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
            +   R  VGDRY++  +    + +GGE SGHI+  D+ +TGD ++AALQVL  +K  ++
Sbjct: 297 DIPFVRANVGDRYVISELLERNWVIGGENSGHIVCFDHTTTGDAIIAALQVLMALKARNE 356

Query: 361 PVSTICHCFEEYPQFLRSVSV-KDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESL 419
            ++       + PQ L +V      + L  + + QA       + G  R+++R SGTE L
Sbjct: 357 GLAQSRQALRKCPQVLINVRFGGGVNPLEHAKVKQASEHVTQAMAGRGRVLLRKSGTEPL 416

Query: 420 IRIMAEGDDLSRIKRIVDDLAKVIPMIDS 448
           +R+M EG+D ++++   ++LAK++  + +
Sbjct: 417 VRVMVEGEDEAQVRGYAEELAKLVTEVSA 445


>gi|332993367|gb|AEF03422.1| phosphoglucosamine mutase [Alteromonas sp. SN2]
          Length = 447

 Score =  400 bits (1027), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 204/444 (45%), Positives = 302/444 (68%), Gaps = 6/444 (1%)

Query: 2   KRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENS 61
           +R++FGTDGIRGK     I P F++++G A G +  G+  ++ V+IGKDTR+SGYMLE+S
Sbjct: 3   QRKYFGTDGIRGKVGESNINPEFVIKLGWAAGKVLAGRGTNK-VLIGKDTRISGYMLESS 61

Query: 62  LVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKV 121
           L AG +AAG+D+ +LGP+P+PA+A LT++ R++ G++ISASHNPY DNGIK F  DG+K+
Sbjct: 62  LEAGLSAAGIDSGLLGPMPTPAIAYLTKTFRSEAGIVISASHNPYYDNGIKFFSADGFKL 121

Query: 122 STDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVV 181
             DIE  IE +L+  +T   S  D +G A R++    RYIE  K + P D++L GL+IVV
Sbjct: 122 DDDIELAIEDMLDKPMTCVAS--DKLGKATRINDAAGRYIEFCKGSFPSDLSLTGLKIVV 179

Query: 182 DCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIA 241
           DCA+GA+Y +AP V  ELGA VV IG  PNG+NIN   G+T++ ++  KV E  A +G A
Sbjct: 180 DCAHGATYHIAPNVLRELGATVVEIGTAPNGLNINEGVGATSMDAIVEKVKETNAHLGFA 239

Query: 242 LDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLG 301
           LDGDGDR+++VD  G +++GDQI+ +IAR+ + +  ++G G+V T+MSN+GLE   + LG
Sbjct: 240 LDGDGDRIMMVDHLGNVIDGDQIVYMIARDALKNGRMQG-GVVGTLMSNLGLEIAFSKLG 298

Query: 302 LSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKP 361
           +   R++VGDRY+ME ++  G+ +GGE SGHI+     STGDG++A LQVL  + + D  
Sbjct: 299 VPFARSKVGDRYVMEMLQQKGWAIGGENSGHILNLATSSTGDGIIAGLQVLAAMLRSDLD 358

Query: 362 VSTICHCFEEYPQFLRSVSVKDTS--ILNSSSIVQAIADAESELRGIDRLIVRASGTESL 419
           +  +   F+ YPQ L +V  +D S   L  + +  A  +AE+ L    R+++R SGTE L
Sbjct: 359 LHDLSSGFDMYPQCLVNVRYQDASQDYLAHADVQGAKQEAEAALGKKGRVLLRKSGTEPL 418

Query: 420 IRIMAEGDDLSRIKRIVDDLAKVI 443
           IR+M E D+     +  + +A+ +
Sbjct: 419 IRVMVESDNEGHSSKWAEHIAETV 442


>gi|319957816|ref|YP_004169079.1| phosphoglucosamine mutase [Nitratifractor salsuginis DSM 16511]
 gi|319420220|gb|ADV47330.1| phosphoglucosamine mutase [Nitratifractor salsuginis DSM 16511]
          Length = 448

 Score =  400 bits (1027), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 199/431 (46%), Positives = 287/431 (66%), Gaps = 7/431 (1%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M  + FGTDG+RGK+      P   MR+ +A G  FR   +  ++++GKDTR SGYM+EN
Sbjct: 1   MMGKLFGTDGVRGKAGVKVSAPA-AMRLAMATGAYFRPHSRTNKILVGKDTRRSGYMIEN 59

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           ++V+G TA G D   +GP+P+PAVA LT ++R D G+MISASHNPY DNGIK F  +G K
Sbjct: 60  AIVSGLTAVGYDVIQIGPMPTPAVAFLTENMRCDAGIMISASHNPYYDNGIKFFDAEGNK 119

Query: 121 VSTDIEDRIETLLEDD--LTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLR 178
           ++ ++E++IE + +DD  +         IG +KR+D V  RYI H+K + PR +TL GLR
Sbjct: 120 LNREVEEKIEAIYQDDEAIARAQKTGKEIGKSKRIDDVIGRYIVHIKNSFPRSLTLSGLR 179

Query: 179 IVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADI 238
           +VVDCANGA Y+VAP V  ELGADVVV+GD+PNG NIN  CG+ +   L ++V   RAD+
Sbjct: 180 VVVDCANGAGYRVAPTVLSELGADVVVLGDEPNGFNINEGCGAMHPEYLAKEVLRYRADV 239

Query: 239 GIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIA 298
           G+ALDGD DR+++VDE+G +++GD++M ++A        LR +G+V TVMSN  L+ ++A
Sbjct: 240 GVALDGDADRLVMVDERGEVIDGDKLMGVLAIYLKEQGTLRNDGMVATVMSNQALDDYLA 299

Query: 299 GLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQY 358
              ++L R+ VGD+ ++E M++ G N GGEQSGHII SD+  TGDG+ +ALQ L Y+   
Sbjct: 300 RHAITLYRSAVGDKNVVEMMQSKGLNFGGEQSGHIIFSDFAKTGDGISSALQALAYLVSS 359

Query: 359 DKPVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGID-RLIVRASGTE 417
            K  S   + FE YPQ L +++V     L     ++ +A+ + ++     R + R SGTE
Sbjct: 360 GKRASEAFNPFELYPQKLVNLNVATKRPLEE---IRGLAELQEKIEAAGMRHLFRYSGTE 416

Query: 418 SLIRIMAEGDD 428
           + IR++ EG D
Sbjct: 417 NKIRLLIEGKD 427


>gi|74317153|ref|YP_314893.1| phosphoglucosamine mutase [Thiobacillus denitrificans ATCC 25259]
 gi|123612002|sp|Q3SJR2|GLMM_THIDA RecName: Full=Phosphoglucosamine mutase
 gi|74056648|gb|AAZ97088.1| phosphoglucosamine mutase [Thiobacillus denitrificans ATCC 25259]
          Length = 458

 Score =  400 bits (1027), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 210/444 (47%), Positives = 301/444 (67%), Gaps = 10/444 (2%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLF---RGK---KKHRRVVIGKDTRLS 54
           M R++FGTDG+RGK    PITP F+MR+G A G +    RG     +H  V+IGKDTR+S
Sbjct: 1   MGRKYFGTDGVRGKVGETPITPEFVMRLGYAAGKVLVSDRGSLPANEHPTVLIGKDTRIS 60

Query: 55  GYMLENSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLF 114
           GYMLE +L AGFTAAG++  + GP+P+PAVA LTR+LR   GV+ISASHNP++DNGIK F
Sbjct: 61  GYMLEAALEAGFTAAGVNVLMTGPMPTPAVAYLTRALRLQAGVVISASHNPFEDNGIKFF 120

Query: 115 GPDGYKVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTL 174
              G K+   +E+ IE  L+  L +  +    +G A+R++    RYIE  K T P  + L
Sbjct: 121 SASGQKLPDSVEEAIEAALDQPLATVAA--RQLGRARRIEDAAARYIEFCKSTFPNRLDL 178

Query: 175 QGLRIVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEV 234
           +G+RIVVDCA+GA+Y VAP V  ELGA+VV IG++PNG NIN  CG+T+  +L   V   
Sbjct: 179 RGMRIVVDCAHGATYHVAPHVLHELGAEVVAIGNEPNGFNINEACGATHTPALADAVRAH 238

Query: 235 RADIGIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLE 294
            ADIGI+LDGDGDR+++ D  G I +GDQ++ +IAR  +    ++G G+V T+M+N+G E
Sbjct: 239 HADIGISLDGDGDRLMMADAHGRIYDGDQLVYVIARHRLETGYMKG-GVVGTLMTNLGTE 297

Query: 295 RFIAGLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRY 354
             +A + +  +R +VGDRY+++ +  NG+ +GGE SGHI+  D  +TGDG+V++LQVLR 
Sbjct: 298 HALARIHVPFERAKVGDRYVLKRLHANGWFLGGETSGHILCLDKHTTGDGIVSSLQVLRA 357

Query: 355 IKQYDKPVSTICHCFEEYPQFLRSVS-VKDTSILNSSSIVQAIADAESELRGIDRLIVRA 413
           +++  K +       E YPQ + +V  VK   + +++++  A+ADAES L G  R+++RA
Sbjct: 358 LRETGKTLDAFTADLETYPQVMINVPVVKGFRLSDAAAVTVAVADAESALNGSGRIVLRA 417

Query: 414 SGTESLIRIMAEGDDLSRIKRIVD 437
           SGTE LIR+M EG D   ++R  +
Sbjct: 418 SGTEPLIRVMVEGRDGDLVRRTAE 441


>gi|153209330|ref|ZP_01947349.1| phosphoglucosamine mutase [Coxiella burnetii 'MSU Goat Q177']
 gi|165924042|ref|ZP_02219874.1| phosphoglucosamine mutase [Coxiella burnetii RSA 334]
 gi|212212275|ref|YP_002303211.1| phosphoglucosamine mutase [Coxiella burnetii CbuG_Q212]
 gi|212218756|ref|YP_002305543.1| phosphoglucosamine mutase [Coxiella burnetii CbuK_Q154]
 gi|226722729|sp|B6J7Z9|GLMM_COXB1 RecName: Full=Phosphoglucosamine mutase
 gi|226722730|sp|B6IZD8|GLMM_COXB2 RecName: Full=Phosphoglucosamine mutase
 gi|120575401|gb|EAX32025.1| phosphoglucosamine mutase [Coxiella burnetii 'MSU Goat Q177']
 gi|165916501|gb|EDR35105.1| phosphoglucosamine mutase [Coxiella burnetii RSA 334]
 gi|212010685|gb|ACJ18066.1| phosphoglucosamine mutase [Coxiella burnetii CbuG_Q212]
 gi|212013018|gb|ACJ20398.1| phosphoglucosamine mutase [Coxiella burnetii CbuK_Q154]
          Length = 446

 Score =  399 bits (1026), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 200/447 (44%), Positives = 305/447 (68%), Gaps = 10/447 (2%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M++++FGTDGIRGK     I   FM+++G AVG +         V+IGKDTR+SGYM+E+
Sbjct: 1   MQKKYFGTDGIRGKVGNSLINAEFMLKLGWAVGRVL-ANSHSATVLIGKDTRISGYMIES 59

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +L AG +AAG++  + GP+P+PA+A LT S+RAD G++ISASHN Y DNG+K F  DG+K
Sbjct: 60  ALQAGLSAAGVNIKLTGPMPTPAIAYLTHSVRADAGIVISASHNHYPDNGVKFFNKDGFK 119

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +S ++E  IE  ++  + + ++  D +G A R++  H RYIE  K T P ++TL+GL+IV
Sbjct: 120 LSDELELAIEKQIDKPMKTVVA--DRLGKAARMNEAHGRYIEFCKSTFPSNLTLKGLKIV 177

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           VDCANGA+Y VAP +F ELGA+VV I D P+G NIN  CG+T+   LQ  V +  AD+GI
Sbjct: 178 VDCANGAAYAVAPSIFHELGAEVVAIADDPDGFNINQTCGATDTAHLQEMVVKHNADVGI 237

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGN---GIVTTVMSNIGLERFI 297
           A DGDGDR+I+VD  G  V+GD+++ ++A   +    L+ N   G+V T+MSN+GLE+ +
Sbjct: 238 AFDGDGDRLIMVDHHGLRVDGDELLCIMA---IDRFYLKENAPLGVVGTIMSNLGLEQTL 294

Query: 298 AGLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQ 357
               ++ +R+ VGDRY+++ M+  G+ +GGE SGHI+   + +TGDG++ ALQ+LR ++Q
Sbjct: 295 KRHHIAFERSPVGDRYVLDLMQQKGWFLGGESSGHIVDLGFTTTGDGVITALQILRIMQQ 354

Query: 358 YDKPVSTICHCFEEYPQFLRSVSVKDT-SILNSSSIVQAIADAESELRGIDRLIVRASGT 416
            +KP++ +     ++PQ L +V +K    I  + +I +AI +AE +L G  R+++R SGT
Sbjct: 355 AEKPLADLKKVMVKHPQVLINVPIKGILDIAQNPNIKKAITEAEKQLNGAGRILLRPSGT 414

Query: 417 ESLIRIMAEGDDLSRIKRIVDDLAKVI 443
           E +IR+M EG D   +++  + LA  +
Sbjct: 415 EPVIRVMVEGSDEGIVRQTAEMLAAAV 441


>gi|225077423|ref|ZP_03720622.1| hypothetical protein NEIFLAOT_02484 [Neisseria flavescens
           NRL30031/H210]
 gi|224951241|gb|EEG32450.1| hypothetical protein NEIFLAOT_02484 [Neisseria flavescens
           NRL30031/H210]
          Length = 445

 Score =  399 bits (1026), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 202/445 (45%), Positives = 297/445 (66%), Gaps = 6/445 (1%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRR--VVIGKDTRLSGYML 58
           M +++FGTDG+RG+   FPI P+F++++G A G +    K   +  V+IGKDTR+SGYML
Sbjct: 1   MAKKYFGTDGVRGEVGQFPINPDFVLKLGYAAGQVLVQHKGEIKPTVLIGKDTRISGYML 60

Query: 59  ENSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDG 118
           E +L+AGFTAAG++    GP+P+P VA LTR+LR   GVMISASHN Y DNGIK F   G
Sbjct: 61  EAALIAGFTAAGVNVIQTGPLPTPGVAYLTRALRLSAGVMISASHNVYSDNGIKFFAEGG 120

Query: 119 YKVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLR 178
            K+S +IE  IE  +++++ +  S    +G A+R++G  DRYIE  K T P  + L+GL+
Sbjct: 121 VKLSDEIELEIEAKIDEEMKAQPSS--RLGRARRINGADDRYIEFCKSTFPSYLDLRGLK 178

Query: 179 IVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADI 238
           +VVD ANGA Y VAP+VF ELGA VV IGD PNG NIN  CG+T+  +LQ  V +  AD 
Sbjct: 179 LVVDTANGAGYAVAPKVFHELGAQVVSIGDDPNGYNINEKCGATHPKALQAAVLQNEADY 238

Query: 239 GIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIA 298
           GIALDGDGDR+++VD  G + +GD ++ +IA+   +H  +   G+V TVM+N+ +E  + 
Sbjct: 239 GIALDGDGDRLMMVDRNGKVYDGDSLIYVIAKA-RAHEGVEIGGVVGTVMTNMAMEIALK 297

Query: 299 GLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQY 358
             G+   R +VGDRY++E +   G+ +GGE SGHI+  D  +TGDG+++ALQVL  ++  
Sbjct: 298 EQGVDFCRAKVGDRYVLEQLHQRGWLIGGEASGHILCMDKHNTGDGIISALQVLAALQTL 357

Query: 359 DKPVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTES 418
           ++ ++T+C  ++ YPQ + +V +K       +S  +A+A+ E EL G  R+++RASGTE 
Sbjct: 358 NQDLATVCADWQPYPQTMINVRIKKGQNWQDAS-KEALAEVEKELEGKGRVVLRASGTEP 416

Query: 419 LIRIMAEGDDLSRIKRIVDDLAKVI 443
           ++R+M E       K+  + +A  I
Sbjct: 417 VVRVMVEAKQADWAKKGAEKIAAAI 441


>gi|241759823|ref|ZP_04757923.1| phosphoglucosamine mutase [Neisseria flavescens SK114]
 gi|241319831|gb|EER56227.1| phosphoglucosamine mutase [Neisseria flavescens SK114]
          Length = 478

 Score =  399 bits (1026), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 201/445 (45%), Positives = 298/445 (66%), Gaps = 6/445 (1%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRR--VVIGKDTRLSGYML 58
           M +++FGTDG+RG+   FPI P+F++++G A G +    +   +  V+IGKDTR+SGYML
Sbjct: 34  MAKKYFGTDGVRGEVGQFPINPDFVLKLGYAAGQVLVQHEGEIKPTVLIGKDTRISGYML 93

Query: 59  ENSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDG 118
           E +L+AGFTAAG++    GP+P+P VA LTR+LR   GVMISASHN Y DNGIK F   G
Sbjct: 94  EAALIAGFTAAGVNVIQTGPLPTPGVAYLTRALRLSAGVMISASHNVYSDNGIKFFAEGG 153

Query: 119 YKVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLR 178
            K+S +IE  IE  +++++ +  S    +G A+R++G  DRYIE  K T P  + L+GL+
Sbjct: 154 VKLSDEIELEIEAKIDEEMKAQPS--GRLGRARRINGADDRYIEFCKSTFPSHLDLRGLK 211

Query: 179 IVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADI 238
           +VVD ANGA Y VAP+VF ELGA VV IGD+PNG NIN  CG+T+  +LQ  V +  AD 
Sbjct: 212 LVVDTANGAGYAVAPKVFHELGAQVVSIGDEPNGYNINEKCGATHPKALQAAVLQNEADY 271

Query: 239 GIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIA 298
           GIALDGDGDR+++VD  G + +GD ++ +IA+   +H  +   G+V TVM+N+ +E  + 
Sbjct: 272 GIALDGDGDRLMMVDRNGKVYDGDSLIYVIAKA-RAHEGVEIGGVVGTVMTNMAMEIALK 330

Query: 299 GLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQY 358
             G+   R +VGDRY++E +   G+ +GGE SGHI+  D  +TGDG+++ALQVL  ++  
Sbjct: 331 EQGVDFCRAKVGDRYVLEQLHQRGWLIGGEASGHILCMDKHNTGDGIISALQVLAALQTL 390

Query: 359 DKPVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTES 418
           ++ ++T+C  ++ YPQ + +V +K       +S  +A+A+ E EL G  R+++RASGTE 
Sbjct: 391 NQDLATVCADWQPYPQTMINVRIKKGQNWQDAS-KEALAEVEKELEGKGRVVLRASGTEP 449

Query: 419 LIRIMAEGDDLSRIKRIVDDLAKVI 443
           ++R+M E       K+  + +A  I
Sbjct: 450 VVRVMVEAKQADWAKKGAEKIAAAI 474


>gi|161506143|ref|YP_001573255.1| phosphoglucosamine mutase [Salmonella enterica subsp. arizonae
           serovar 62:z4,z23:-- str. RSK2980]
 gi|189040793|sp|A9MP31|GLMM_SALAR RecName: Full=Phosphoglucosamine mutase
 gi|160867490|gb|ABX24113.1| hypothetical protein SARI_04331 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
          Length = 445

 Score =  399 bits (1026), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 212/448 (47%), Positives = 303/448 (67%), Gaps = 10/448 (2%)

Query: 3   RRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSL 62
           R++FGTDGIRG+    PITP+F++++G A G +   +   R+++IGKDTR+SGYMLE++L
Sbjct: 4   RKYFGTDGIRGRVGDAPITPDFVLKLGWAAGKVL-ARHGSRKIIIGKDTRISGYMLESAL 62

Query: 63  VAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVS 122
            AG  AAG+ A   GP+P+PAVA LTR+ RA+ G++ISASHNP+ DNGIK F  DG K+ 
Sbjct: 63  EAGLAAAGLSASFTGPMPTPAVAYLTRTFRAEAGIVISASHNPFYDNGIKFFSIDGTKLP 122

Query: 123 TDIEDRIETLLEDDLTSYLSCYDS--IGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
            D+E+ IE  +E ++T    C DS  +G A R+     RYIE  K T P +++L GL++V
Sbjct: 123 DDVEEAIEAEMEKEIT----CVDSAELGKASRIVDAAGRYIEFCKGTFPNELSLNGLKVV 178

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           VDCANGA+Y +AP V  ELGA V+ IG +PNG+NIN + G+T+V +LQ +V   +AD+GI
Sbjct: 179 VDCANGATYHIAPNVLRELGASVIAIGCEPNGVNINEEVGATDVRALQARVLAEKADLGI 238

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           ALDGDGDRVI+VD +GA V+GDQIM +IARE +    LRG G V T+MSN+GLE  +  L
Sbjct: 239 ALDGDGDRVIMVDHEGAKVDGDQIMYIIAREGLRQGQLRG-GAVGTLMSNMGLELALKQL 297

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           G+   R +VGDRY++E ++  G+ +G E SGH+IL D  +TGDG+VA LQVL  + +   
Sbjct: 298 GIPFARAKVGDRYVLEKLQEKGWRIGAENSGHVILLDKTTTGDGIVAGLQVLAAMVRNHM 357

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTS--ILNSSSIVQAIADAESELRGIDRLIVRASGTES 418
            +  +C   + +PQ L +V     S   L + ++    AD E+ L    R+++R SGTE 
Sbjct: 358 SLHDLCSGMKMFPQILVNVRYTAGSGDPLENEAVKAVTADVEATLGNRGRVLLRKSGTEP 417

Query: 419 LIRIMAEGDDLSRIKRIVDDLAKVIPMI 446
           LIR+M EG+D ++++     +A  +  +
Sbjct: 418 LIRVMVEGEDEAQVRAFAHRIADAVKAV 445


>gi|282892167|ref|ZP_06300641.1| hypothetical protein pah_c209o043 [Parachlamydia acanthamoebae str.
           Hall's coccus]
 gi|281497968|gb|EFB40313.1| hypothetical protein pah_c209o043 [Parachlamydia acanthamoebae str.
           Hall's coccus]
          Length = 459

 Score =  399 bits (1026), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 196/440 (44%), Positives = 289/440 (65%), Gaps = 2/440 (0%)

Query: 3   RRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSL 62
            + FGTDG+RGK+N  P+T    + +G A G +FR  +   RVVIGKDTRLS YM EN+L
Sbjct: 8   EKIFGTDGVRGKANRSPMTVETALALGRAAGKIFRSHEGKHRVVIGKDTRLSCYMFENAL 67

Query: 63  VAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVS 122
           ++G  + G+D  ++GP+P+P VA +TR+ RAD G++ISASHNPY DNGIK F  DG+K+ 
Sbjct: 68  ISGLCSMGVDTLMVGPLPTPGVAFITRAYRADAGIVISASHNPYYDNGIKFFSSDGFKLP 127

Query: 123 TDIEDRIETLLE-DDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVV 181
              E ++E L+  ++    L     IG   +V     RYIE  K T PR ++L+ L I +
Sbjct: 128 DTWEKQMEELVSTNNFDDSLPADHDIGKNFKVTDADGRYIEFAKATFPRRLSLKNLTIAL 187

Query: 182 DCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIA 241
           DCANGA YKVAP +F EL A V V G+ P+G+NINL CGS    ++Q+ V E RAD+GIA
Sbjct: 188 DCANGAGYKVAPLIFRELDAKVFVYGNNPDGLNINLQCGSLYPETIQKAVIEHRADVGIA 247

Query: 242 LDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLG 301
           LDGD DRVI+VDE   I++GD I+A+ A++     +L+GN +V+T+MSN G  + +  LG
Sbjct: 248 LDGDADRVIMVDENAQIIDGDTILAICAKDMQRRGILKGNKVVSTIMSNFGFVKAMEELG 307

Query: 302 LSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKP 361
           + + +++VGDRY+++ M  +  N+GGEQSGH+I  D+ +TGDGLV ALQV+R + + D  
Sbjct: 308 IEVIKSQVGDRYVIQDMLEHDANLGGEQSGHLIFLDHNTTGDGLVCALQVMRIMIETDSK 367

Query: 362 VSTICHCFEEYPQFLRSVSVKDTSILNS-SSIVQAIADAESELRGIDRLIVRASGTESLI 420
           +S +    ++YPQ   +V V       +   + Q +A+ E  L    R+++R SGTE++ 
Sbjct: 368 LSDLAALVKKYPQVCVNVKVSSKPTFEALPGVNQKVAEVEEILGDSGRVLLRYSGTENIC 427

Query: 421 RIMAEGDDLSRIKRIVDDLA 440
           R+M EG  L +++++ + +A
Sbjct: 428 RVMVEGPKLQQVQQLANQIA 447


>gi|29654647|ref|NP_820339.1| phosphoglucosamine mutase [Coxiella burnetii RSA 493]
 gi|161830736|ref|YP_001597191.1| phosphoglucosamine mutase [Coxiella burnetii RSA 331]
 gi|81628793|sp|Q83BY7|GLMM_COXBU RecName: Full=Phosphoglucosamine mutase
 gi|189040782|sp|A9N8M1|GLMM_COXBR RecName: Full=Phosphoglucosamine mutase
 gi|29541915|gb|AAO90853.1| phosphoglucosamine mutase [Coxiella burnetii RSA 493]
 gi|161762603|gb|ABX78245.1| phosphoglucosamine mutase [Coxiella burnetii RSA 331]
          Length = 446

 Score =  399 bits (1026), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 200/447 (44%), Positives = 304/447 (68%), Gaps = 10/447 (2%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M++++FGTDGIRGK     I   FM+++G AVG +         V+IGKDTR+SGYM+E+
Sbjct: 1   MQKKYFGTDGIRGKVGNSLINAEFMLKLGWAVGRVL-ANSHSATVLIGKDTRISGYMIES 59

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +L AG +AAG++  + GP+P+PA+A LT S+RAD G++ISASHN Y DNG+K F  DG+K
Sbjct: 60  ALQAGLSAAGVNIKLTGPMPTPAIAYLTHSVRADAGIVISASHNHYPDNGVKFFNKDGFK 119

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +S ++E  IE  ++  + + ++  D +G A R++  H RYIE  K T P ++TL+GL+IV
Sbjct: 120 LSDELELAIEKQIDKPMKTVVA--DRLGKAARMNEAHGRYIEFCKSTFPSNLTLKGLKIV 177

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           VDCANGA+Y VAP +F ELGA+VV I D P+G NIN  CG+T+   LQ  V +  AD+GI
Sbjct: 178 VDCANGAAYAVAPSIFHELGAEVVAIADDPDGFNINQTCGATDTAHLQEMVVKHNADVGI 237

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGN---GIVTTVMSNIGLERFI 297
           A DGDGDR+I+VD  G  V+GD+++ ++A   +    L+ N   G+V T+MSN+GLE  +
Sbjct: 238 AFDGDGDRLIMVDHHGLRVDGDELLCIMA---IDRFYLKENAPLGVVGTIMSNLGLEHTL 294

Query: 298 AGLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQ 357
               ++ +R+ VGDRY+++ M+  G+ +GGE SGHI+   + +TGDG++ ALQ+LR ++Q
Sbjct: 295 KRHHIAFERSPVGDRYVLDLMQQKGWFLGGESSGHIVDLGFTTTGDGVITALQILRIMQQ 354

Query: 358 YDKPVSTICHCFEEYPQFLRSVSVKDT-SILNSSSIVQAIADAESELRGIDRLIVRASGT 416
            +KP++ +     ++PQ L +V +K    I  + +I +AI +AE +L G  R+++R SGT
Sbjct: 355 AEKPLADLKKVMVKHPQVLINVPIKGILDIAQNPNIKKAITEAEKQLNGAGRILLRPSGT 414

Query: 417 ESLIRIMAEGDDLSRIKRIVDDLAKVI 443
           E +IR+M EG D   +++  + LA  +
Sbjct: 415 EPVIRVMVEGSDEGIVRQTAEMLAAAV 441


>gi|240949732|ref|ZP_04754064.1| phosphoglucosamine mutase [Actinobacillus minor NM305]
 gi|240295764|gb|EER46451.1| phosphoglucosamine mutase [Actinobacillus minor NM305]
          Length = 443

 Score =  399 bits (1026), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 201/446 (45%), Positives = 298/446 (66%), Gaps = 9/446 (2%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M R++FGTDG+RG+   FPITP F +++G A G +    +  ++V+IGKDTR+SGYMLE+
Sbjct: 1   MARKYFGTDGVRGEVGKFPITPEFALKLGWAAGKVL-ATQGTKKVLIGKDTRISGYMLES 59

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +L AG TAAG+ A  +GP+P+PA+A LTR+ RA+ G++ISASHNPY DNGIK F   G K
Sbjct: 60  ALEAGLTAAGLSAVFVGPMPTPAIAYLTRTFRAEAGIVISASHNPYYDNGIKFFSAVGEK 119

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDS--IGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLR 178
           +  ++E+ IE +L++ +     C DS  +G A R++    RYIE  K   P  ++L G +
Sbjct: 120 LPDEVEEAIEAMLDEPM----DCVDSANLGKASRINDAAGRYIEFCKAGFPSHLSLDGYK 175

Query: 179 IVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADI 238
           IVVDCANGA+Y +AP V  ELGA+V+ IG  PNG+NIN  CG+T++ +LQ+ V E  ADI
Sbjct: 176 IVVDCANGATYHIAPNVMRELGAEVIEIGTHPNGLNINEKCGATDIKALQKVVVEAGADI 235

Query: 239 GIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIA 298
           G+A DGDGDR+++VD  G  V+GDQI+ ++ARE +    L+G G+V T+MSN+ LE  + 
Sbjct: 236 GLAYDGDGDRIMMVDHLGNKVDGDQILFILAREALRAGKLQG-GVVGTLMSNMSLEIALK 294

Query: 299 GLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQY 358
            L +   R  VGDRY++E +K  G+ +GGE SGHII+ D  +TGDG++A+L+VL  +  +
Sbjct: 295 ELAIPFSRANVGDRYVLEQLKEKGWKLGGENSGHIIVLDKNTTGDGIIASLEVLAAMVSH 354

Query: 359 DKPVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADA-ESELRGIDRLIVRASGTE 417
              ++ +      +PQ L +V     +    S  V+A+A + E  L G  R+++R SGTE
Sbjct: 355 KMTLNELAKAVPLFPQVLINVRFSGGNNPLESEEVKAVAKSVEERLAGKGRILLRKSGTE 414

Query: 418 SLIRIMAEGDDLSRIKRIVDDLAKVI 443
            LIR+M E +D +  +   +++A+ +
Sbjct: 415 PLIRVMVECEDGTLAQSCAEEIAEAV 440


>gi|255019903|ref|ZP_05291978.1| phosphoglucosamine mutase [Acidithiobacillus caldus ATCC 51756]
 gi|254970683|gb|EET28170.1| phosphoglucosamine mutase [Acidithiobacillus caldus ATCC 51756]
          Length = 454

 Score =  399 bits (1025), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 207/430 (48%), Positives = 290/430 (67%), Gaps = 7/430 (1%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGY-LFRGKKKHRRVVIGKDTRLSGYMLE 59
           M R+FFGTDG+RG+    P+ P +++R+G A G+ L  G +   RVVIGKDTRLSGY+LE
Sbjct: 1   MARQFFGTDGVRGRVGDLPMHPEWVLRLGWAAGHVLTAGAQGRPRVVIGKDTRLSGYLLE 60

Query: 60  NSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGY 119
           ++L +G  AAG+D  ++GP+P+PA+A LTR+LRAD G++ISASHNP+ DNGIK F  DG 
Sbjct: 61  SALESGLAAAGVDVLLVGPLPTPAIAYLTRTLRADAGIVISASHNPFPDNGIKFFSGDGL 120

Query: 120 KVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRI 179
           K++ +IE+ IE  +   LT  L   D +G A+RVD    RY+E  K T P  + L+GLR+
Sbjct: 121 KLADEIEEAIEARMNLPLT--LPEADRLGKARRVDDAAGRYVEFCKTTFPSHLDLRGLRL 178

Query: 180 VVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIG 239
           V+DCA+GA+YKVAP VF ELGA +  IG +P+G+NIN + GST    L+ +V    AD+G
Sbjct: 179 VLDCAHGATYKVAPMVFAELGAQIEAIGVQPDGLNINAEVGSTAPELLRSQVVASGADMG 238

Query: 240 IALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAG 299
           IA DGDGDR+++VD +G + +GD I+ L+A        L  NG+V T+MSN+ LE+  A 
Sbjct: 239 IAFDGDGDRLLLVDGEGELWDGDSILWLLAGAMREAGTL--NGVVGTLMSNLALEQAFAD 296

Query: 300 LGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYD 359
            G+   R  VGDRY++E M+  G+ +GGE SGHII +   +TGDG++AALQVL  ++Q  
Sbjct: 297 WGVPFVRAAVGDRYVLEQMRARGYPLGGESSGHII-TPANTTGDGILAALQVLAIVQQRR 355

Query: 360 KPVSTICHCFEEYPQFLRSVSVKDT-SILNSSSIVQAIADAESELRGIDRLIVRASGTES 418
           +P+  +   F   PQ LRS+ + D  + +  + + +AI    +EL G  RL+VR SGTE 
Sbjct: 356 QPLHALRGDFRLAPQILRSLPITDARAFVQRADVQEAIRRTAAELGGRGRLLVRPSGTEP 415

Query: 419 LIRIMAEGDD 428
           L+RIM E  D
Sbjct: 416 LLRIMVEASD 425


>gi|326794265|ref|YP_004312085.1| phosphoglucosamine mutase [Marinomonas mediterranea MMB-1]
 gi|326545029|gb|ADZ90249.1| phosphoglucosamine mutase [Marinomonas mediterranea MMB-1]
          Length = 443

 Score =  399 bits (1024), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 206/439 (46%), Positives = 296/439 (67%), Gaps = 5/439 (1%)

Query: 3   RRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSL 62
           R++FGTDGIRG+     ITP FM+++G A G +F G+ K++ ++IGKDTR+SGYM E++L
Sbjct: 2   RKYFGTDGIRGQVGKGVITPEFMLKLGWAAGKVFNGQSKNK-ILIGKDTRISGYMFESAL 60

Query: 63  VAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVS 122
            AG  AAG D  ++GP+P+PA+A LTR+ RA  G++ISASHNPY DNGIK F  +G K+S
Sbjct: 61  EAGIVAAGADVRLVGPMPTPAIAYLTRTFRACAGIVISASHNPYTDNGIKFFSSEGGKIS 120

Query: 123 TDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVVD 182
            ++E+ IE  L+  +    S  D IG AKR+D    RYIE+ K T P  + + GL++V+D
Sbjct: 121 DELEEEIEYWLDQPMEVVES--DKIGKAKRIDDAAGRYIEYCKGTFPIGLRITGLKMVLD 178

Query: 183 CANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIAL 242
           CA+GA+Y VAP VF ELGADV+VIG  P+G+NIN   G+T    LQ+ V    ADIGIAL
Sbjct: 179 CADGATYHVAPRVFSELGADVIVIGASPDGLNINEVSGATKPELLQKNVVAHGADIGIAL 238

Query: 243 DGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLGL 302
           DGDGDR+I+VD+ G + +GD ++ +IA    S     G G+V T+M+N GLE  ++  G+
Sbjct: 239 DGDGDRLILVDKFGKVCDGDDVLYIIANHLSSKGQFSG-GVVGTLMTNFGLELALSERGV 297

Query: 303 SLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKPV 362
              R  VGDRY+ E +  +G+++GGE SGHI+     +TGDG++AALQ+L+ + +  KP+
Sbjct: 298 GFSRANVGDRYVNEKLTQHGWSLGGEPSGHIVCKSITTTGDGIIAALQILQAMLEEGKPL 357

Query: 363 STICHCFEEYPQFLRSVSVKDTSILNSSSIVQ-AIADAESELRGIDRLIVRASGTESLIR 421
             +     ++PQ L+++ VK+  I +    +Q AIA A   L G  R+++RASGTE LIR
Sbjct: 358 HELLEGLVKFPQKLKNIRVKERFIPSEVPALQKAIAHANERLNGSGRVLLRASGTEPLIR 417

Query: 422 IMAEGDDLSRIKRIVDDLA 440
           +M EG D   +  ++D L+
Sbjct: 418 VMVEGRDDELVSDLIDYLS 436


>gi|226946311|ref|YP_002801384.1| phosphoglucosamine mutase [Azotobacter vinelandii DJ]
 gi|259647713|sp|C1DFL3|GLMM_AZOVD RecName: Full=Phosphoglucosamine mutase
 gi|226721238|gb|ACO80409.1| phosphoglucosamine mutase [Azotobacter vinelandii DJ]
          Length = 445

 Score =  399 bits (1024), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 203/444 (45%), Positives = 303/444 (68%), Gaps = 5/444 (1%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M +++FGTDGIRG+   +PITP+FM+++G A G  FR ++   RV++GKDTR+SGYM E+
Sbjct: 1   MSKKYFGTDGIRGRVGEYPITPDFMLKLGWAAGKAFR-RQGICRVLVGKDTRISGYMFES 59

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
            L AG +AAG D  +LGP+P+PA+A LTR+  A+ G++ISASHNP+ DNGIK F   G K
Sbjct: 60  VLEAGLSAAGADVLLLGPMPTPAIAYLTRTFHAEAGIVISASHNPHYDNGIKFFSGQGTK 119

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +  ++E  IE LL++ +T   S    +G   R++    RYIE  K ++P   +  GL++V
Sbjct: 120 LPDELELVIEELLDNPMTVVDSA--QLGKVSRINDAAGRYIEFCKSSVPTGTSFAGLKMV 177

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           VDCA+GA+YKVAP VF ELGA+V V+  +PNG+NIN  CGST++++LQ +V   RAD+G+
Sbjct: 178 VDCAHGATYKVAPNVFRELGAEVAVLAAQPNGLNINDRCGSTDIVALQAEVLMQRADLGV 237

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           A DGDGDRV++VD  GA+V+GD+++ LIAR+   H  L+G G+V T+MSN+GLE  +  +
Sbjct: 238 AFDGDGDRVLMVDHTGAVVDGDELLFLIARDMHEHGKLQG-GVVGTLMSNLGLELALQDM 296

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           G+   R +VGDRY+M  +    + +GGE SGHI+   + +TGDG++AALQVLR +K   +
Sbjct: 297 GIPFVRAKVGDRYVMAELLARNWQLGGEGSGHIVCCHHSTTGDGIIAALQVLRALKHRGQ 356

Query: 361 PVSTICHCFEEYPQFLRSVS-VKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESL 419
            ++       ++PQ L +V    D   +    + +A      ++ G  R+++R SGTE L
Sbjct: 357 RLAEARQGMRKFPQVLVNVRYAGDKDPVGHPVVQEACERVTEQMAGRGRVLLRKSGTEPL 416

Query: 420 IRIMAEGDDLSRIKRIVDDLAKVI 443
           +R+M EGDD S+++   D+LAK++
Sbjct: 417 VRVMVEGDDESQVRLHADNLAKIV 440


>gi|70734333|ref|YP_257973.1| phosphoglucosamine mutase [Pseudomonas fluorescens Pf-5]
 gi|84029250|sp|Q4KIG0|GLMM_PSEF5 RecName: Full=Phosphoglucosamine mutase
 gi|68348632|gb|AAY96238.1| phosphoglucosamine mutase [Pseudomonas fluorescens Pf-5]
          Length = 445

 Score =  399 bits (1024), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 199/449 (44%), Positives = 298/449 (66%), Gaps = 5/449 (1%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M +++FGTDGIRG+   FPITP+FM+++G A G  FR     R V++GKDTR+SGYM E+
Sbjct: 1   MTKKYFGTDGIRGRVGEFPITPDFMLKLGWAAGMAFRSMGACR-VLVGKDTRISGYMFES 59

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +L AG +AAG D  +LGP+P+PA+A LTR+  A+ G++ISASHNP+ DNGIK F  +G K
Sbjct: 60  ALEAGLSAAGADVMLLGPMPTPAIAYLTRTFHAEAGIVISASHNPHDDNGIKFFSGEGTK 119

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +  ++E  IE LL+  +T   S    +G   R++    RYIE  K ++P   +  GL++V
Sbjct: 120 LPDEVELMIEELLDAPMTVVES--SKLGKVSRINDASGRYIEFCKSSVPSSTSFAGLKVV 177

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           +DCA+GA+YKVAP VF ELGA V V+  +PNG+NIN +CGST++  LQ  V    AD+GI
Sbjct: 178 LDCAHGATYKVAPSVFRELGAQVTVLSAQPNGLNINENCGSTHMSQLQAAVLAEHADLGI 237

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           A DGDGDRV++VD+ GAIV+GD+++ +IAR+      L+G G+V T+MSN+GLE  +A L
Sbjct: 238 AFDGDGDRVLMVDQTGAIVDGDELLFIIARDLHERDKLQG-GVVGTLMSNLGLELALADL 296

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           G+   R  VGDRY++  +    + VGGE SGHI+   + +TGD ++AALQVL  +K   +
Sbjct: 297 GIPFVRANVGDRYVIAELLERNWLVGGENSGHIVCFRHATTGDAIIAALQVLMALKARGE 356

Query: 361 PVSTICHCFEEYPQFLRSVSV-KDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESL 419
            ++       + PQ L +V      + +   ++ +A     + + G  R+++R SGTE L
Sbjct: 357 SLAQSRQGLRKCPQVLVNVRFGGGENPVEHPAVKEACERVTAAMAGRGRVLLRKSGTEPL 416

Query: 420 IRIMAEGDDLSRIKRIVDDLAKVIPMIDS 448
           +R+M EGDD ++++   ++LAK++  + +
Sbjct: 417 VRVMVEGDDEAQVRAYAEELAKLVAEVSA 445


>gi|319638687|ref|ZP_07993447.1| phosphoglucosamine mutase [Neisseria mucosa C102]
 gi|317400071|gb|EFV80732.1| phosphoglucosamine mutase [Neisseria mucosa C102]
          Length = 445

 Score =  399 bits (1024), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 200/445 (44%), Positives = 298/445 (66%), Gaps = 6/445 (1%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRR--VVIGKDTRLSGYML 58
           M +++FGTDG+RG+   FPI P+F++++G A G +    +   +  V+IGKDTR+SGYML
Sbjct: 1   MAKKYFGTDGVRGEVGQFPINPDFVLKLGYAAGQVLVQHEGEIKPTVLIGKDTRISGYML 60

Query: 59  ENSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDG 118
           E +L+AGFTAAG++    GP+P+P VA LTR+LR   GVMISASHN Y DNGIK F   G
Sbjct: 61  EAALIAGFTAAGVNVIQTGPLPTPGVAYLTRALRLSAGVMISASHNVYSDNGIKFFAEGG 120

Query: 119 YKVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLR 178
            K+S +IE  IE  +++++ +  S    +G A+R++G  DRYIE  K T P  + L+GL+
Sbjct: 121 VKLSDEIELEIEAKIDEEMKTQPSS--RLGRARRINGADDRYIEFCKSTFPSHLDLRGLK 178

Query: 179 IVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADI 238
           +VVD ANGA Y VAP+VF ELGA VV IG++PNG NIN  CG+T+  +LQ  V +  AD 
Sbjct: 179 LVVDTANGAGYAVAPKVFHELGAQVVSIGNEPNGYNINEKCGATHPKALQAAVLQNEADY 238

Query: 239 GIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIA 298
           GIALDGDGDR+++VD  G + +GD ++ +IA+   +H  +   G+V TVM+N+ +E  + 
Sbjct: 239 GIALDGDGDRLMMVDRNGKVYDGDSLIYVIAKA-RAHEGVEIGGVVGTVMTNMAMEVALK 297

Query: 299 GLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQY 358
             G+   R +VGDRY++E +   G+ +GGE SGHI+  D  +TGDG+++ALQVL  ++  
Sbjct: 298 EQGVDFCRAKVGDRYVLEQLHQRGWLIGGEASGHILCMDKHNTGDGIISALQVLAALQTL 357

Query: 359 DKPVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTES 418
           ++ ++T+C  ++ YPQ + +V +K       +S  +A+A+ E EL G  R+++RASGTE 
Sbjct: 358 NQDLATVCADWQPYPQTMINVRIKKGQNWQDAS-KEALAEVEKELEGKGRVVLRASGTEP 416

Query: 419 LIRIMAEGDDLSRIKRIVDDLAKVI 443
           ++R+M E       K+  + +A  I
Sbjct: 417 VVRVMVEAKQADWAKKGAEKIAAAI 441


>gi|160876127|ref|YP_001555443.1| phosphoglucosamine mutase [Shewanella baltica OS195]
 gi|205830871|sp|A9KVT4|GLMM2_SHEB9 RecName: Full=Phosphoglucosamine mutase 2
 gi|160861649|gb|ABX50183.1| phosphoglucosamine mutase [Shewanella baltica OS195]
 gi|315268324|gb|ADT95177.1| phosphoglucosamine mutase [Shewanella baltica OS678]
          Length = 450

 Score =  398 bits (1023), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 207/434 (47%), Positives = 291/434 (67%), Gaps = 8/434 (1%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M R++FGTDG+RGK   FPITP+F M++G A G +       + V+IGKDTR+SGYMLE+
Sbjct: 1   MSRKYFGTDGVRGKVGDFPITPDFAMKLGWAAGTVL-ASTGTKEVLIGKDTRISGYMLES 59

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           ++ AGF+AAG++  ++GP+P+PAVA L  + RAD GV+ISASHNP+ DNGIK F   G K
Sbjct: 60  AMEAGFSAAGVNVALIGPMPTPAVAYLASTFRADAGVVISASHNPFYDNGIKFFSNSGTK 119

Query: 121 VSTDIEDRIETLLEDDLT-SYLSCYDS--IGHAKRVDGVHDRYIEHVKRTLPRDVTLQGL 177
           ++   E  IE LLE  L  + + C  S  +G  +R+D    RYIE  K T P  ++L GL
Sbjct: 120 LNDAQELEIEALLEKALNQNAMQCVASEKLGKVRRIDDAAGRYIEFCKGTFPNHLSLAGL 179

Query: 178 RIVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRAD 237
           +IVVD A+GA+Y +AP V+ ELGA+V+ I DKPNG+NIN  CG+T++ SLQ  V    AD
Sbjct: 180 KIVVDSAHGAAYHIAPNVYRELGAEVISINDKPNGVNINDHCGATHLDSLQTAVMVHEAD 239

Query: 238 IGIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFI 297
           +GIALDGD DRV+ VD  G +V+GD+I+ ++A+   S   + G G+V T+MSN+GLE  +
Sbjct: 240 LGIALDGDADRVMFVDHNGHVVDGDEILFILAQAAHSKGEMTG-GVVGTLMSNLGLELAL 298

Query: 298 AGLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQ 357
             + +   R +VGDRY++E +K+ G+ +GGE SGHI+   + STGDG+VA+LQVL+ + +
Sbjct: 299 KQMDIPFVRAKVGDRYVVEQLKHTGWQLGGEGSGHILSLQHASTGDGIVASLQVLKAVLE 358

Query: 358 YDKPVSTICHCFEEYPQFL---RSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRAS 414
             K +S I     + PQ L   R  +    SIL ++S+ QA+  AE  L    R+++R S
Sbjct: 359 SQKSLSEIKAGMTKLPQVLINVRLATADADSILATTSVQQAVIKAEEFLGDQGRVLLRKS 418

Query: 415 GTESLIRIMAEGDD 428
           GTE LIR+M E  D
Sbjct: 419 GTEPLIRVMVESTD 432


>gi|154707057|ref|YP_001424785.1| phosphoglucosamine mutase [Coxiella burnetii Dugway 5J108-111]
 gi|189040781|sp|A9KGE3|GLMM_COXBN RecName: Full=Phosphoglucosamine mutase
 gi|154356343|gb|ABS77805.1| phosphoglucosamine mutase [Coxiella burnetii Dugway 5J108-111]
          Length = 446

 Score =  398 bits (1023), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 200/447 (44%), Positives = 304/447 (68%), Gaps = 10/447 (2%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M++++FGTDGIRGK     I   FM+++G AVG +         V+IGKDTR+SGYM+E+
Sbjct: 1   MQKKYFGTDGIRGKVGNSLINAEFMLKLGWAVGRVL-ANSHSATVLIGKDTRISGYMIES 59

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +L AG +AAG++  + GP+P+PA+A LT S+RAD G++ISASHN Y DNG+K F  DG+K
Sbjct: 60  ALQAGLSAAGVNIKLTGPMPTPAIAYLTNSVRADAGIVISASHNHYPDNGVKFFNKDGFK 119

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +S ++E  IE  ++  + + ++  D +G A R++  H RYIE  K T P ++TL+GL+IV
Sbjct: 120 LSDELELAIEKQIDKPMKTVVA--DRLGKAARMNEAHGRYIEFCKSTFPSNLTLKGLKIV 177

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           VDCANGA+Y VAP +F ELGA+VV I D P+G NIN  CG+T+   LQ  V +  AD+GI
Sbjct: 178 VDCANGAAYAVAPSIFHELGAEVVAIADDPDGFNINQTCGATDTAHLQEMVVKHNADVGI 237

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGN---GIVTTVMSNIGLERFI 297
           A DGDGDR+I+VD  G  V+GD+++ ++A   +    L+ N   G+V T+MSN+GLE+ +
Sbjct: 238 AFDGDGDRLIMVDHHGLRVDGDELLCIMA---IDRFYLKENAPLGVVGTIMSNLGLEQTL 294

Query: 298 AGLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQ 357
               ++ +R+ VGDRY+++ M+  G+ +GGE SGHI+   + +TGDG++ ALQ+LR ++Q
Sbjct: 295 KRHHIAFERSPVGDRYVLDLMQQKGWFLGGESSGHIVDLGFTTTGDGVITALQILRIMQQ 354

Query: 358 YDKPVSTICHCFEEYPQFLRSVSVKDT-SILNSSSIVQAIADAESELRGIDRLIVRASGT 416
            +KP++ +     + PQ L +V +K    I  + +I +AI +AE +L G  R+++R SGT
Sbjct: 355 AEKPLADLKKVMVKNPQVLINVPIKGILDIAQNPNIKKAITEAEKQLNGAGRILLRPSGT 414

Query: 417 ESLIRIMAEGDDLSRIKRIVDDLAKVI 443
           E +IR+M EG D   +++  + LA  +
Sbjct: 415 EPVIRVMVEGSDEGIVRQTAEMLAAAV 441


>gi|269137759|ref|YP_003294459.1| phosphoglucosamine mutase [Edwardsiella tarda EIB202]
 gi|267983419|gb|ACY83248.1| phosphoglucosamine mutase [Edwardsiella tarda EIB202]
 gi|304557816|gb|ADM40480.1| Phosphoglucosamine mutase [Edwardsiella tarda FL6-60]
          Length = 445

 Score =  398 bits (1023), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 212/445 (47%), Positives = 300/445 (67%), Gaps = 13/445 (2%)

Query: 2   KRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENS 61
           +R++FGTDGIRGK  + PITP+F++++G A G +   +   R+++IGKDTR+SGYMLE++
Sbjct: 3   ERKYFGTDGIRGKVGSSPITPDFVLKLGWAAGKVL-ARHGSRKIIIGKDTRISGYMLESA 61

Query: 62  LVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKV 121
           L AG  AAG+ A   GP+P+PAVA LTR+ RA+ G++ISASHNPY DNGIK F  DG   
Sbjct: 62  LEAGLAAAGLSAAFTGPMPTPAVAYLTRTFRAEAGIVISASHNPYYDNGIKFFSIDG--- 118

Query: 122 STDIEDRIETLLEDDLTSYLSCYDS--IGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRI 179
            T + D +E  +E +L   L+C +S  +G A R+     RYIE  K T P  ++L GL+I
Sbjct: 119 -TKLPDEVEAAIEAELDKPLTCVESAELGKASRIVDAAGRYIEFCKSTFPNALSLSGLKI 177

Query: 180 VVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIG 239
           V DCANGA+Y +AP V  ELGA+V+ IG  P+G+NIN +CG+T+V +LQ +V    AD+G
Sbjct: 178 VADCANGATYHIAPNVLRELGAEVITIGTSPDGMNINKECGATDVRALQARVVAENADLG 237

Query: 240 IALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAG 299
           +A DGDGDR+I+VD +G  V+GDQI+ ++ARE +    L G G+V T+MSN+GLE  +  
Sbjct: 238 MAFDGDGDRLIMVDHRGDKVDGDQILYIVAREALRQGKLHG-GVVGTLMSNMGLELALKQ 296

Query: 300 LGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYD 359
           LG+   R +VGDRY++E M+  G+ +G E SGH+I+ D  +TGDG+VA LQVL  + +  
Sbjct: 297 LGIPFARAKVGDRYVLETMQEKGWRMGAENSGHVIILDQTTTGDGIVAGLQVLAAMARNH 356

Query: 360 KPVSTICHCFEEYPQFLRSVSVK-DTSILNSSSIVQAIADAESELRGIDRLIVRASGTES 418
             ++ +C      PQ L +V        L  +++ QA A+ E +L G  R+++R SGTE 
Sbjct: 357 MSLADLCSGMTLLPQVLINVRFAGQCDPLQDAAVQQACAEVERQLAGRGRVLLRKSGTEP 416

Query: 419 LIRIMAEGDDLSRIKRIVDDLAKVI 443
           LIR+M EG+DL +    V DLA VI
Sbjct: 417 LIRVMVEGEDLQQ----VTDLANVI 437


>gi|167552061|ref|ZP_02345814.1| phosphoglucosamine mutase [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA29]
 gi|205323181|gb|EDZ11020.1| phosphoglucosamine mutase [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA29]
          Length = 445

 Score =  398 bits (1023), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 210/445 (47%), Positives = 304/445 (68%), Gaps = 10/445 (2%)

Query: 3   RRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSL 62
           R++FGTDGIRG+    PITP+F++++G A G +   +   R+++IGKDTR+SGYMLE++L
Sbjct: 4   RKYFGTDGIRGRVGNAPITPDFVLKLGWAAGKVL-ARHGSRKIIIGKDTRISGYMLESAL 62

Query: 63  VAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVS 122
            AG  AAG+ A   GP+P+PAVA LTR+ RA+ G++ISASHNP+ DNGIK F  DG K+ 
Sbjct: 63  EAGLAAAGLSASFTGPMPTPAVAYLTRTFRAEAGIVISASHNPFYDNGIKFFSIDGTKLP 122

Query: 123 TDIEDRIETLLEDDLTSYLSCYDS--IGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
            ++E+ IE  +E ++T    C DS  +G A R+     RYIE  K T P +++L GL++V
Sbjct: 123 DEVEEAIEAEMEKEIT----CVDSAELGKASRIVDAAGRYIEFCKGTFPNELSLNGLKVV 178

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           VDCANGA+Y +AP V  ELGA V+ IG +PNG+NIN + G+T+V +LQ +V   +AD+GI
Sbjct: 179 VDCANGATYHIAPNVLRELGATVIAIGCEPNGVNINEEVGATDVRALQARVLAEKADVGI 238

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           ALDGDGDRVI+VD +G  V+GDQIM +IARE +    LRG G V T+MSN+GLE  +  L
Sbjct: 239 ALDGDGDRVIMVDHQGHKVDGDQIMYIIAREALRQGQLRG-GAVGTLMSNMGLEVGLKQL 297

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           G+   R +VGDRY++E M+  G+ +G E SGH+IL D  +TGDG+VA LQV+  + +   
Sbjct: 298 GIPFTRAKVGDRYVLEKMQERGWRIGAENSGHVILLDKTTTGDGIVAGLQVVAAMVRNHM 357

Query: 361 PVSTICHCFEEYPQFLRSVSVKD--TSILNSSSIVQAIADAESELRGIDRLIVRASGTES 418
            +  +C   + +PQ L +V   D  ++ L S ++  A  +AE+ +    R+++R SGTE 
Sbjct: 358 SLHDLCSGMKMFPQVLVNVRYTDGKSNPLESDAVKTAALEAEAAMGNRGRVLLRKSGTEP 417

Query: 419 LIRIMAEGDDLSRIKRIVDDLAKVI 443
           LIR+M EG+D +++  +   +A  +
Sbjct: 418 LIRVMVEGEDEAQVTELAHRIADAV 442


>gi|104780023|ref|YP_606521.1| phosphoglucosamine mutase [Pseudomonas entomophila L48]
 gi|158564146|sp|Q1IF48|GLMM_PSEE4 RecName: Full=Phosphoglucosamine mutase
 gi|95109010|emb|CAK13706.1| phosphoglucosamine mutase [Pseudomonas entomophila L48]
          Length = 446

 Score =  398 bits (1023), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 202/445 (45%), Positives = 298/445 (66%), Gaps = 6/445 (1%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M R++FGTDGIRG+   FPITP+FM+++G A G  FR K+ H RV++GKDTR+SGYM E+
Sbjct: 1   MSRKYFGTDGIRGRVGQFPITPDFMLKLGWAAGMAFR-KQGHCRVLVGKDTRISGYMFES 59

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +L AG +AAG D  +LGP+P+PA+A LTR+  A+ G++ISASHNP+ DNGIK F   G K
Sbjct: 60  ALEAGLSAAGADVMLLGPMPTPAIAYLTRTFHAEAGIVISASHNPHDDNGIKFFSGSGTK 119

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +  ++E  IE LL+  +T   S    +G   R++    RYIE  K ++P     +GL+IV
Sbjct: 120 LPDEVELMIEELLDQPMTVVES--GKLGKVSRINDAAGRYIEFCKSSVPSSTNFEGLKIV 177

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           VDCA+GA+YKVAP VF ELGA+V V+   P+G+NIN +CGST++ SLQ  V    AD+GI
Sbjct: 178 VDCAHGATYKVAPSVFRELGAEVTVLHASPDGLNINENCGSTHIESLQAAVLVGHADLGI 237

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           A DGDGDRV++VD  GAIV+GD+++ +I R+    + L+G G+V T+MSN+GLE     L
Sbjct: 238 AFDGDGDRVLMVDHTGAIVDGDELLYIIGRDLHDRNKLQG-GVVGTLMSNLGLELAFKEL 296

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
            +   R +VGDRY+M  +    + +GGE SGH++  ++ +TGD ++AALQVL  +K+  +
Sbjct: 297 DIPFVRAKVGDRYVMAELLEREWLLGGENSGHVVCCNHTTTGDAIIAALQVLMALKRKGE 356

Query: 361 PVSTICHCFEEYPQFLRSVSVK--DTSILNSSSIVQAIADAESELRGIDRLIVRASGTES 418
            ++       + PQ L +V  +   +  L +  + +A   A   + G  R+++R SGTE 
Sbjct: 357 TLAQARQGVRKCPQVLINVRFEAGKSDPLQNPLVKEASDKATEAMAGRGRVLLRKSGTEP 416

Query: 419 LIRIMAEGDDLSRIKRIVDDLAKVI 443
           L+R+M EGDD ++++   + LAK++
Sbjct: 417 LVRVMVEGDDENQVRGHAEALAKLV 441


>gi|329297288|ref|ZP_08254624.1| phosphoglucosamine mutase [Plautia stali symbiont]
          Length = 444

 Score =  398 bits (1023), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 212/447 (47%), Positives = 302/447 (67%), Gaps = 9/447 (2%)

Query: 3   RRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSL 62
           R++FGTDGIRGK    PITP+F++++G A G +   +   R+V+IGKDTR+SGYMLE++L
Sbjct: 4   RKYFGTDGIRGKVGEAPITPDFVLKLGFAAGKVL-ARSGSRKVLIGKDTRISGYMLESAL 62

Query: 63  VAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVS 122
            AG  AAG+ A   GP+P+PA+A LTR+ RA+ G++ISASHNP+ DNGIK F  +G K+ 
Sbjct: 63  EAGLAAAGLSAAFTGPMPTPAIAYLTRTFRAEAGIVISASHNPFDDNGIKFFSAEGTKLP 122

Query: 123 TDIEDRIETLLEDDLTSYLSCYDS--IGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
            D+E  IE  LE  LT    C +S  +G A R+     RYIE  K T P +++L GL+IV
Sbjct: 123 DDVEAAIELELEKPLT----CVESAGLGRASRIVDAAGRYIEFCKGTFPSELSLNGLKIV 178

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           VDCANGA+Y +AP V  ELGA V+ IG +P+G+NIN +CG+T++  LQ++V + +AD+G+
Sbjct: 179 VDCANGATYHIAPNVLRELGAKVIAIGVQPDGMNINKECGATDMRQLQQRVLDEKADLGL 238

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           A DGDGDR+++VD  G  V+GDQI+ +IARE +    LRG G+V T+MSN+GLE  +  L
Sbjct: 239 AYDGDGDRIMMVDHLGQKVDGDQILYIIAREALRQGQLRG-GVVGTLMSNMGLELALKQL 297

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           G+   R +VGDRY++E M+  G+ +G E SGH+IL D  STGDG+VA+LQVL  I +   
Sbjct: 298 GIPFTRAKVGDRYVLEKMQEKGWRMGAENSGHVILLDKISTGDGIVASLQVLTAIVRNHI 357

Query: 361 PVSTICHCFEEYPQFLRSVSVKDT-SILNSSSIVQAIADAESELRGIDRLIVRASGTESL 419
            +  +C   +  PQ L +V    +   L S S+  A A+ E  L G  R+++R SGTE L
Sbjct: 358 SLHDLCSGMKMLPQVLVNVRFSGSHDPLESDSVKAAAAEVEKTLAGRGRVLLRKSGTEPL 417

Query: 420 IRIMAEGDDLSRIKRIVDDLAKVIPMI 446
           IR+M EG+D +++  +   +A  +  +
Sbjct: 418 IRVMVEGEDEAQVTELAHKIADAVKAV 444


>gi|152987269|ref|YP_001350791.1| phosphoglucosamine mutase [Pseudomonas aeruginosa PA7]
 gi|166990420|sp|A6VCK6|GLMM_PSEA7 RecName: Full=Phosphoglucosamine mutase
 gi|150962427|gb|ABR84452.1| phosphoglucosamine mutase [Pseudomonas aeruginosa PA7]
          Length = 445

 Score =  398 bits (1022), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 203/444 (45%), Positives = 294/444 (66%), Gaps = 5/444 (1%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M R++FGTDGIRG+   FPITP+F++++G AVG  FR ++ + RV+IGKDTR SGYM E+
Sbjct: 1   MSRKYFGTDGIRGRVGEFPITPDFVLKLGWAVGMAFR-RQGNCRVLIGKDTRSSGYMFES 59

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +  AG +A+G D  +LGP+P+P +A LTR+  A+ GV+ISASHNP+ DNGIK F   G K
Sbjct: 60  AFEAGLSASGADTLLLGPMPTPGIAYLTRTFHAEAGVVISASHNPHDDNGIKFFSGQGTK 119

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +  D+E  IE LL+  +T   S    +G   R++    RYIE  K ++P      GL++V
Sbjct: 120 LPDDVELMIEELLDAPMTVVESA--RLGKVSRINDAAGRYIEFCKSSVPTSTDFNGLKVV 177

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           +DCANGA+YK+AP VF ELGA+V V+   PNG+NIN  CGST++  LQ  V E  AD+GI
Sbjct: 178 LDCANGATYKIAPNVFRELGAEVTVLAASPNGLNINDKCGSTHLDGLQAAVIEHHADLGI 237

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           A DGDGDRV++VD  GAIV+GD+++ LIAR+      L+G G+V T+MSN+GLE  +  L
Sbjct: 238 AFDGDGDRVMMVDHTGAIVDGDELLFLIARDMQESGRLQG-GVVGTLMSNLGLELALQDL 296

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
            +   R +VGDRY+M  +    + +GGE SGHI+     +TGD ++AALQVL  +K+  +
Sbjct: 297 HIPFVRAKVGDRYVMAELLARNWMLGGENSGHIVCCQNTTTGDAIIAALQVLMALKRRGQ 356

Query: 361 PVSTICHCFEEYPQFLRSVSVK-DTSILNSSSIVQAIADAESELRGIDRLIVRASGTESL 419
            ++       + PQ L +V  K ++  L   S+ +A A    ++ G  R+++R SGTE L
Sbjct: 357 TLAEARQGIRKCPQVLINVRFKGESDPLEHPSVKEASARVTEQMGGRGRVLLRKSGTEPL 416

Query: 420 IRIMAEGDDLSRIKRIVDDLAKVI 443
           +R+M EGD+ + ++   + LAK++
Sbjct: 417 VRVMVEGDEEATVRAHAEQLAKIV 440


>gi|269302758|gb|ACZ32858.1| phosphoglucosamine mutase [Chlamydophila pneumoniae LPCoLN]
          Length = 458

 Score =  398 bits (1022), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 204/443 (46%), Positives = 298/443 (67%), Gaps = 2/443 (0%)

Query: 3   RRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFR-GKKKHRRVVIGKDTRLSGYMLENS 61
           R+ FGTDG+RG++N  P+T    + +G AV  + R G+    RVV+GKDTRLSGYM EN+
Sbjct: 6   RKLFGTDGVRGRANFEPMTVETTVLLGKAVARVLREGRSGKHRVVVGKDTRLSGYMFENA 65

Query: 62  LVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKV 121
           L+AG  + G++  +LGPIP+P VA +TR+ RAD G+MISASHNPY+DNGIK+F  +G+K+
Sbjct: 66  LIAGLNSMGIETLVLGPIPTPGVAFITRAYRADAGIMISASHNPYRDNGIKIFSSEGFKI 125

Query: 122 STDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVV 181
           S  +E RIET++ +     L    ++G  KRV     RYIE VK T P+  TL+GL+IV+
Sbjct: 126 SDVLEQRIETMVSEADFGPLPEDHAVGKNKRVIDAMGRYIEFVKATFPKGRTLKGLKIVL 185

Query: 182 DCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIA 241
           DCA+GASYKVAP VF EL A+V+  G +P GININ  CG+     +Q+ V E +A +GIA
Sbjct: 186 DCAHGASYKVAPSVFEELDAEVICYGCEPTGININEHCGALFPQVIQKVVIEHQAHLGIA 245

Query: 242 LDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLG 301
           LDGDGDR+I+VDEKG IV+GD I+++ A +    S L  N +V T+M+N G+ +++ GLG
Sbjct: 246 LDGDGDRIIMVDEKGHIVDGDMILSICAGDLKKRSALPHNRVVATIMTNFGVLKYLEGLG 305

Query: 302 LSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKP 361
           L +  + VGDR+++  M  +   +GGEQSGH+I  DY +TGDG+V+ALQVLR + + +  
Sbjct: 306 LQVFTSPVGDRHVLHAMLEHEVTLGGEQSGHMIFLDYNTTGDGIVSALQVLRIMIESEST 365

Query: 362 VSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQ-AIADAESELRGIDRLIVRASGTESLI 420
           +S +     + PQ L +V+V++   L +  +++  + D +  L    R+++R SGTE++ 
Sbjct: 366 LSDLTAPIVKSPQTLINVAVREKIPLETIPLIERTLRDVQDALGPSGRILLRYSGTENIC 425

Query: 421 RIMAEGDDLSRIKRIVDDLAKVI 443
           R+M EG    ++  +   LA VI
Sbjct: 426 RVMVEGHKKHQVDCLAKALADVI 448


>gi|298369433|ref|ZP_06980751.1| phosphoglucosamine mutase [Neisseria sp. oral taxon 014 str. F0314]
 gi|298283436|gb|EFI24923.1| phosphoglucosamine mutase [Neisseria sp. oral taxon 014 str. F0314]
          Length = 446

 Score =  397 bits (1021), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 203/445 (45%), Positives = 298/445 (66%), Gaps = 6/445 (1%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGY-LFRGKKKHR-RVVIGKDTRLSGYML 58
           M +++FGTDG+RG+   FPITP+F++++G A G  L +   +HR  V+IGKDTR+SGYML
Sbjct: 1   MAKKYFGTDGVRGEVGQFPITPDFVLKLGYAAGQVLVQHDSEHRPTVLIGKDTRISGYML 60

Query: 59  ENSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDG 118
           E +LVAGFT+AG++    GP+P+P VA LTR+LR   GVMISASHN Y DNGIK F   G
Sbjct: 61  EAALVAGFTSAGVNVIQTGPLPTPGVAYLTRALRLSAGVMISASHNVYSDNGIKFFAEGG 120

Query: 119 YKVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLR 178
            K+S +IE  IE  +++++ +  S  D +G A+R++G  DRYIE  K T P  + L+GL+
Sbjct: 121 VKLSDEIELEIEAKIDEEMKTQPS--DRLGRARRINGADDRYIEFCKSTFPNHLDLRGLK 178

Query: 179 IVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADI 238
           +VVD ANGA Y VAP+VF ELGA VV IGD+PNG NIN  CG+T+  +LQ  V +  AD 
Sbjct: 179 LVVDTANGAGYHVAPKVFHELGAQVVSIGDEPNGYNINEKCGATHPKTLQAAVLQNEADY 238

Query: 239 GIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIA 298
           G+ALDGDGDR+++VD  G + +GD ++ +IA+      +  G G+V TVM+N+ +E  + 
Sbjct: 239 GLALDGDGDRLMMVDRNGKVYDGDSLIYVIAKARALEGIEIG-GVVGTVMTNMAMEIALK 297

Query: 299 GLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQY 358
             G+   R +VGDRY++E +   G+ +GGE SGHI+  D  +TGDG+++ALQVL  ++  
Sbjct: 298 EQGVQFCRAKVGDRYVLEQLHQRGWLIGGEASGHILCMDKHNTGDGIISALQVLAALRIL 357

Query: 359 DKPVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTES 418
            + ++T+C  ++ YPQ + +V ++       +S    +A+ E EL G  R+++RASGTE 
Sbjct: 358 GQDLATVCADWQPYPQTMINVRIQKGQKWQEAS-AGVLAEVEKELEGRGRVVLRASGTEP 416

Query: 419 LIRIMAEGDDLSRIKRIVDDLAKVI 443
           ++R+M E       K+  + +A  I
Sbjct: 417 VVRVMVEAKQADWAKKGAERIAAAI 441


>gi|284006664|emb|CBA71926.1| phosphoglucosamine mutase [Arsenophonus nasoniae]
          Length = 445

 Score =  397 bits (1021), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 210/443 (47%), Positives = 301/443 (67%), Gaps = 5/443 (1%)

Query: 2   KRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENS 61
           KR++FGTDGIRGK    PITP+F++++G A G +   +   R+++IGKDTR+SGYMLE+S
Sbjct: 3   KRKYFGTDGIRGKVGENPITPDFVLKLGWAAGKVL-ARHGSRKIIIGKDTRISGYMLESS 61

Query: 62  LVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKV 121
           L AG  AAG+ A   GP+P+PA+A LTR+ RA+ G++ISASHNPY DNGIK F  DG K+
Sbjct: 62  LEAGLAAAGLSAAFTGPMPTPAIAYLTRTYRAEAGIVISASHNPYYDNGIKFFSIDGTKL 121

Query: 122 STDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVV 181
             D+E+ IE  +E  LT   S    +G A R+     RYIE+ K T P D +L GL+IV+
Sbjct: 122 PDDVEEAIEAEMEKPLTCVESA--ELGRASRIVDAAGRYIEYCKGTFPSDQSLSGLKIVL 179

Query: 182 DCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIA 241
           DCANGA+Y +AP V  ELGA+VV IG +PNG+NIN DCG+T+V  LQ+ V   +ADIG+A
Sbjct: 180 DCANGATYHIAPNVLTELGAEVVTIGCEPNGLNINQDCGATDVALLQKHVVAEKADIGLA 239

Query: 242 LDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLG 301
            DGDGDR+I+VD +G  ++GDQI+ +IAR+ +    L G G+V T+MSN+GLE  +  L 
Sbjct: 240 FDGDGDRLIMVDHRGNRIDGDQIIYIIARDALRQGQLHG-GVVGTLMSNMGLELALQQLD 298

Query: 302 LSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKP 361
           +   R +VGDRY++E ++  G+ +G E SGHIIL D  +TGDG++A LQVL  + +    
Sbjct: 299 IPFIRAKVGDRYVLEKLQEQGWRLGAENSGHIILLDKTTTGDGIIAGLQVLSAMIRNKTS 358

Query: 362 VSTICHCFEEYPQFLRSVSVKDT-SILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
           +  +C   +  PQ L +V    T + L +  ++  +   E++L G  R+++R SGTE LI
Sbjct: 359 LYDLCREVKLMPQVLVNVRFSGTHNPLVTEDVLNVVNQVENDLAGRGRVLLRKSGTEPLI 418

Query: 421 RIMAEGDDLSRIKRIVDDLAKVI 443
           RIM EG++  ++  + + +A+V+
Sbjct: 419 RIMVEGENEKQVTAMANRIAEVV 441


>gi|322831211|ref|YP_004211238.1| phosphoglucosamine mutase [Rahnella sp. Y9602]
 gi|321166412|gb|ADW72111.1| phosphoglucosamine mutase [Rahnella sp. Y9602]
          Length = 446

 Score =  397 bits (1021), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 210/447 (46%), Positives = 300/447 (67%), Gaps = 5/447 (1%)

Query: 3   RRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSL 62
           R++FGTDGIRGK    PITP+F++++G A G +   +   R+V+IGKDTR+SGYMLE++L
Sbjct: 4   RKYFGTDGIRGKVGDTPITPDFVLKLGWAAGKVL-ARHGSRKVIIGKDTRISGYMLESAL 62

Query: 63  VAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVS 122
            AG  AAG+ A   GP+P+PAVA LTR+ RA+ G++ISASHNPY DNGIK F  DG K+ 
Sbjct: 63  EAGLAAAGLSASFTGPMPTPAVAYLTRTFRAEAGIVISASHNPYYDNGIKFFTIDGTKLP 122

Query: 123 TDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVVD 182
            ++E+ IE  LE  LT   S    +G A R+     RYIE  K T P +++L  L+IVVD
Sbjct: 123 DEVEEAIEAELEKPLTCVESA--ELGKASRIVDAAGRYIEFCKGTFPTELSLNSLKIVVD 180

Query: 183 CANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIAL 242
           CANGA+Y +AP V  ELGA V+ IG +P+G+NIN +CG+T+V  LQ++V   +AD+G+A 
Sbjct: 181 CANGATYHIAPSVLRELGAKVIAIGCEPDGMNINEECGATDVRQLQQRVLAEKADVGLAF 240

Query: 243 DGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLGL 302
           DGDGDR+I+VD +G  V+GDQI+ +IARE +    L+G G V T+MSN+GLE  +  LG+
Sbjct: 241 DGDGDRLIMVDHEGNKVDGDQILYIIAREGLRQGQLKG-GAVGTLMSNMGLELALKQLGI 299

Query: 303 SLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKPV 362
              R +VGDRY++E M+  G+ +G E SGHIIL D  +TGDG+VA LQVL  + +    +
Sbjct: 300 PFTRAKVGDRYVLEKMQEKGWRIGAENSGHIILLDKTTTGDGIVAGLQVLTAMVRNHMSL 359

Query: 363 STICHCFEEYPQFLRSVSVK-DTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLIR 421
             +C   +  PQ L +V    +   L S  + Q  A+ E +L G  R+++R SGTE L+R
Sbjct: 360 HDLCSGMKLLPQVLINVRFAGEHDPLESDEVKQVTAEVEKQLAGRGRVLLRKSGTEPLLR 419

Query: 422 IMAEGDDLSRIKRIVDDLAKVIPMIDS 448
           +M EG+D   ++++ + +A  +  + +
Sbjct: 420 VMVEGEDAELVEKLANRIADAVKAVKA 446


>gi|313681235|ref|YP_004058973.1| phosphoglucosamine mutase [Sulfuricurvum kujiense DSM 16994]
 gi|313154095|gb|ADR32773.1| phosphoglucosamine mutase [Sulfuricurvum kujiense DSM 16994]
          Length = 446

 Score =  397 bits (1021), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 206/439 (46%), Positives = 287/439 (65%), Gaps = 7/439 (1%)

Query: 4   RFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSLV 63
           + FGTDG+RG++ +F +T    MR+ +A G  F    + +++++GKDTR SGYM+EN++V
Sbjct: 2   KLFGTDGVRGEAGSF-LTAELAMRVAMAAGIYFSEHARTKKILLGKDTRKSGYMIENAIV 60

Query: 64  AGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVST 123
           +G TA G D   +GP+P+PA+A LT ++R D G+MISASHNP++DNGIK F   G K+S 
Sbjct: 61  SGLTAVGYDVVQIGPMPTPAIAFLTLNMRCDAGIMISASHNPFEDNGIKFFDAHGNKLSE 120

Query: 124 DIEDRIETLLEDD--LTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVV 181
           +IE +IE +  D   L        +IG AKR+D V  RYI  +K +  R++TLQGLRIV+
Sbjct: 121 EIEAQIEAIAHDKARLEEGQVTGKNIGSAKRIDDVIGRYIVQLKNSFSRELTLQGLRIVL 180

Query: 182 DCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIA 241
           D ANGA YKV P V  ELGA+V+V+ DKPNG NIN  CG+ +   L+  V + RADIG+A
Sbjct: 181 DTANGAGYKVGPTVLEELGAEVIVLHDKPNGFNINEGCGAMHTKDLREAVKQYRADIGLA 240

Query: 242 LDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLG 301
           LDGD DR+I+VDE G  V+GDQI+  +      +  L+G GIV TVMSN  LE  +   G
Sbjct: 241 LDGDADRLIVVDENGDEVDGDQILGSLGLFLNKNGQLKGGGIVATVMSNQALEDTMNENG 300

Query: 302 LSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKP 361
           L L R+ VGD+Y++E M+ NG N GGEQSGHIIL DY  TGDGLV+ALQ+L  +    + 
Sbjct: 301 LKLFRSNVGDKYVLEVMRENGINFGGEQSGHIILHDYAKTGDGLVSALQILALLLTSGQK 360

Query: 362 VSTICHCFEEYPQFLRSVSVKDTSILNS-SSIVQAIADAESELRGIDRLIVRASGTESLI 420
            S +   F+ YPQ L ++ VK    L+    + + +A  ES      R ++R SGTE+ +
Sbjct: 361 ASKVLRPFKLYPQKLVNIKVKTKKPLDQIEGLSEELAKIESAHM---RHLIRYSGTENKL 417

Query: 421 RIMAEGDDLSRIKRIVDDL 439
           RI+ EG D   +++ ++ L
Sbjct: 418 RILLEGKDAKVMEKSMEHL 436


>gi|119477407|ref|ZP_01617598.1| phosphoglucosamine mutase [marine gamma proteobacterium HTCC2143]
 gi|119449333|gb|EAW30572.1| phosphoglucosamine mutase [marine gamma proteobacterium HTCC2143]
          Length = 445

 Score =  397 bits (1021), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 203/444 (45%), Positives = 300/444 (67%), Gaps = 5/444 (1%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M R++FGTDGIRG+  T PITP F++++G AVG +F G  + + V+IGKDTR+SGYM E+
Sbjct: 1   MSRKYFGTDGIRGRVGTGPITPEFVLKLGWAVGKVFAGSGRSK-VIIGKDTRISGYMFES 59

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +L AG  AAG+D  +LGP+P+PAVA LTR+  A  G++ISASHNPY DNGIK F   G K
Sbjct: 60  ALEAGLVAAGVDVAMLGPMPTPAVAYLTRTFHAQAGIVISASHNPYPDNGIKFFSSHGAK 119

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +   +E  IE  ++  +T   S    +G   RVD    RYIE  K T+P   +L+G+++V
Sbjct: 120 LDDAVELAIEAQMDQPMTIVESA--DLGKVTRVDDAAGRYIEFCKSTIPSSFSLRGVKMV 177

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           +DCA+GA+Y+VAP V  ELGA V+++G +PNG+NIN + GST   +LQ +V +  AD+GI
Sbjct: 178 IDCAHGATYQVAPAVMEELGASVILMGAQPNGLNINDEVGSTEPAALQARVLQESADLGI 237

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           A DGDGDR++ VD  G +V+GD+++ +IA++ +  +   G G+V T+MSN+G E  +  L
Sbjct: 238 AFDGDGDRLLFVDRNGEVVDGDELLFIIAKDQLRSAGSCG-GVVGTLMSNLGFELALKEL 296

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
            +   R++VGDRY++E M + G+ +GGE SGHII +D  +TGD LVAAL+VL  +     
Sbjct: 297 EIPFVRSKVGDRYVVELMTSRGWKLGGENSGHIICADVTTTGDALVAALKVLYALVDGGV 356

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTSIL-NSSSIVQAIADAESELRGIDRLIVRASGTESL 419
           P+        ++PQ + +V++ D S L N+  I +AIA AE  L G  R+++R SGTE +
Sbjct: 357 PLHDAKLGMNKFPQTMINVALADKSRLQNNPEIDRAIAAAEKSLNGRGRVLLRPSGTEPV 416

Query: 420 IRIMAEGDDLSRIKRIVDDLAKVI 443
           +R+M EG+D + +  +  ++A V+
Sbjct: 417 VRVMVEGEDEALVNTLAAEIAAVV 440


>gi|239996536|ref|ZP_04717060.1| PGM/PMM-family protein [Alteromonas macleodii ATCC 27126]
          Length = 447

 Score =  397 bits (1021), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 201/444 (45%), Positives = 302/444 (68%), Gaps = 6/444 (1%)

Query: 2   KRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENS 61
           +R++FGTDGIRGK     I P F+ ++G A G +  G+  ++ V+IGKDTR+SGYMLE+S
Sbjct: 3   QRKYFGTDGIRGKVGESNINPEFVTKLGWAAGKVLAGRGTNK-VLIGKDTRISGYMLESS 61

Query: 62  LVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKV 121
           L AG +AAG++  +LGP+P+PA+A LT++ R++ G++ISASHNP+ DNGIK F   G+K+
Sbjct: 62  LEAGLSAAGINIGLLGPMPTPAIAYLTKTFRSEAGIVISASHNPFYDNGIKFFSAQGFKL 121

Query: 122 STDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVV 181
             DIE  IE +LE  +T   S  D +G A R++    RYIE  K T P +++L  L+IVV
Sbjct: 122 DDDIELAIEDMLERPMTCVAS--DKLGKATRINDAAGRYIEFCKGTFPSELSLTDLKIVV 179

Query: 182 DCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIA 241
           DCA+GA+Y +AP V  ELGA V+ +G  PNG+NIN   G+T++ ++  KV E  AD+G A
Sbjct: 180 DCAHGATYHIAPNVLRELGATVIELGTAPNGLNINDGVGATSMDAIVEKVKETGADLGFA 239

Query: 242 LDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLG 301
           LDGDGDR+++VD  G +++GDQI+ +IAR+ + +  ++G G+V T+MSN+GLE  ++ LG
Sbjct: 240 LDGDGDRIMMVDHLGNVLDGDQIVYIIARDALKNGKMQG-GVVGTLMSNLGLENALSKLG 298

Query: 302 LSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKP 361
           +   R+ VGDRY+ME ++  G+++GGE SGH++  +  STGDG+VA LQVL  + +    
Sbjct: 299 VPFARSNVGDRYVMELLQQKGWSIGGENSGHVLNLNMSSTGDGIVAGLQVLAAMLRSHMD 358

Query: 362 VSTICHCFEEYPQFLRSVSVKDTSI--LNSSSIVQAIADAESELRGIDRLIVRASGTESL 419
           +  +   FE YPQ L +V   +  +  L  S++  A  +AES L    R+++R SGTE L
Sbjct: 359 LHDLASGFEMYPQTLVNVRYANQEVDYLAHSNVQNAKKEAESALGKTGRVLLRKSGTEPL 418

Query: 420 IRIMAEGDDLSRIKRIVDDLAKVI 443
           IR+M E +D S+  +  + +A+ +
Sbjct: 419 IRVMVESNDESQSHKWAEHIAETV 442


>gi|94676980|ref|YP_589059.1| phosphoglucosamine mutase [Baumannia cicadellinicola str. Hc
           (Homalodisca coagulata)]
 gi|158564230|sp|Q1LSK5|GLMM_BAUCH RecName: Full=Phosphoglucosamine mutase
 gi|94220130|gb|ABF14289.1| phosphoglucosamine mutase [Baumannia cicadellinicola str. Hc
           (Homalodisca coagulata)]
          Length = 445

 Score =  397 bits (1021), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 203/445 (45%), Positives = 294/445 (66%), Gaps = 9/445 (2%)

Query: 2   KRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENS 61
           K+R+FGTDGIRGK    PITP F++++G A G +   +    +++IGKDTR+SGYMLE+ 
Sbjct: 3   KKRYFGTDGIRGKVGDNPITPEFILKLGWAAGKVL-ARHGSNKIIIGKDTRISGYMLESV 61

Query: 62  LVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKV 121
           L AG  +AG+ A   GPIP+PA+A LT++LRA+ G++ISASHNP+ DNGIK F  +G   
Sbjct: 62  LHAGLASAGLSAVFTGPIPTPAIAYLTKTLRAEAGIVISASHNPFYDNGIKFFSIEG--- 118

Query: 122 STDIEDRIETLLEDDLTSYLSCYDS--IGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRI 179
            T I D IE  +E +L   L C  S  +G   R+D    RYI   K T    ++L GL++
Sbjct: 119 -TKIPDAIEQAIEAELGKKLICVASAKLGRISRIDDAAKRYIAFCKGTFSESISLNGLKV 177

Query: 180 VVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIG 239
           VVDCANGA+Y++AP +  ELGA VV IG +P+G+NIN DCG+T++  LQ +V    A+IG
Sbjct: 178 VVDCANGATYQIAPNILRELGAKVVAIGCQPDGMNINKDCGTTDIRKLQHRVLAENANIG 237

Query: 240 IALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAG 299
           IA DGDGDR+I+VD  G  V+GDQI+ +IAR+ M    L G G+V T+MSN+GLE  +  
Sbjct: 238 IAYDGDGDRMIMVDHLGYKVDGDQIIYIIARDKMQQGKLVG-GVVGTLMSNMGLELSLKR 296

Query: 300 LGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYD 359
           LG+   RT VGDRY++  M+  G+ +G E SGH+IL D+ +TGDG++A LQVL  +    
Sbjct: 297 LGIPFIRTSVGDRYVLNKMQETGWRIGAENSGHVILLDHNTTGDGIIAGLQVLSAMVNNS 356

Query: 360 KPVSTICHCFEEYPQFLRSVSVKDT-SILNSSSIVQAIADAESELRGIDRLIVRASGTES 418
             +  +C   + +PQ L ++ +    + L S++++ A   AE EL    R+++R SGTE+
Sbjct: 357 MTLHNLCRDIQLFPQKLINICLTSKYNPLISTTVIHACKVAEQELAKHGRILIRKSGTEN 416

Query: 419 LIRIMAEGDDLSRIKRIVDDLAKVI 443
           +IR+M EG D +++  + + +A  +
Sbjct: 417 IIRVMVEGKDENQVTDLANYIADAV 441


>gi|15834822|ref|NP_296581.1| phosphoglucomutase/phosphomannomutase family protein [Chlamydia
           muridarum Nigg]
 gi|270284988|ref|ZP_06194382.1| phosphoglucosamine mutase [Chlamydia muridarum Nigg]
 gi|270289011|ref|ZP_06195313.1| phosphoglucosamine mutase [Chlamydia muridarum Weiss]
 gi|301336385|ref|ZP_07224587.1| phosphoglucosamine mutase [Chlamydia muridarum MopnTet14]
 gi|81624136|sp|Q9PLA5|GLMM_CHLMU RecName: Full=Phosphoglucosamine mutase
 gi|7190239|gb|AAF39074.1| phosphoglucomutase/phosphomannomutase family protein [Chlamydia
           muridarum Nigg]
          Length = 459

 Score =  397 bits (1020), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 208/441 (47%), Positives = 291/441 (65%), Gaps = 6/441 (1%)

Query: 5   FFGTDGIRGKSNTFPITPNFMMRIGIAV-GYLFRGKKKHRRVVIGKDTRLSGYMLENSLV 63
            FGTDGIRG++N  P+T    + +G AV G L        RVV+GKDTRLSGYM EN+L+
Sbjct: 8   LFGTDGIRGRANFEPMTVETSVLLGKAVAGVLLERHSGKHRVVVGKDTRLSGYMFENALI 67

Query: 64  AGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVST 123
           AG T+ G++  +LGPIP+P VA +TR+ RAD G+MISASHNPY+DNGIK+F  DG+K+  
Sbjct: 68  AGLTSMGIETLMLGPIPTPGVAFITRAYRADAGIMISASHNPYRDNGIKIFSSDGFKIGQ 127

Query: 124 DIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVVDC 183
            +E+RIE ++       L    ++G  KRV     RYIE+ K T P+  TL+GLRIV+DC
Sbjct: 128 AVEERIEAMIASKSFGGLPEDHAVGKNKRVKDAMGRYIEYAKATFPKGRTLKGLRIVLDC 187

Query: 184 ANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIALD 243
           A+GA+Y+VAP VF EL A+V+  G +P+G NIN  CG+     +Q+ V E  AD+GIALD
Sbjct: 188 AHGAAYRVAPSVFEELDAEVICYGCEPSGCNINEGCGALWPSIIQKAVIEHEADVGIALD 247

Query: 244 GDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLGLS 303
           GDGDR+I+VDEKG IV+GD ++++ A +      L  N +V TVM+N G+ R++  LG+ 
Sbjct: 248 GDGDRLIMVDEKGHIVDGDMLLSICASDLKRRQALPENRVVATVMTNFGVLRYLESLGIQ 307

Query: 304 LKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKPVS 363
           +  + VGDR+++++M      +GGEQSGH+I  DY +TGDG+V+ALQVLR + + +  +S
Sbjct: 308 VTISPVGDRHVLQHMLETKAILGGEQSGHMIFLDYNTTGDGIVSALQVLRIMIESESTLS 367

Query: 364 TICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGID-RLIVRASGTESLIRI 422
            +  C  + PQ L +V V     L+S S VQ +     E+ G   R+++R SGTE++ R+
Sbjct: 368 DLTACIVKSPQSLINVPVAKKVPLDSLSNVQVVLQEVKEILGDSGRILLRYSGTENICRV 427

Query: 423 MAEGDDLSRIKRIVDDLAKVI 443
           M EG      K  VD LAK I
Sbjct: 428 MVEGTK----KHQVDSLAKTI 444


>gi|212710004|ref|ZP_03318132.1| hypothetical protein PROVALCAL_01055 [Providencia alcalifaciens DSM
           30120]
 gi|212687413|gb|EEB46941.1| hypothetical protein PROVALCAL_01055 [Providencia alcalifaciens DSM
           30120]
          Length = 445

 Score =  397 bits (1020), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 208/442 (47%), Positives = 296/442 (66%), Gaps = 5/442 (1%)

Query: 3   RRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSL 62
           R++FGTDGIRGK    PITP+F++++G A G +   +   R+++IGKDTR+SGYMLE+SL
Sbjct: 4   RKYFGTDGIRGKVGDSPITPDFVLKLGWAAGKVL-ARHGSRKIIIGKDTRISGYMLESSL 62

Query: 63  VAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVS 122
            AG  AAG+ A   GP+P+PAVA LTR+ RA+ G++ISASHNPY DNGIK F  DG K+ 
Sbjct: 63  EAGLAAAGLSASFTGPMPTPAVAYLTRTFRAEAGIVISASHNPYYDNGIKFFSIDGTKLP 122

Query: 123 TDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVVD 182
            ++E+ IE  +E  +T   S    +G A R+     RYIE  K T P + +L  L++V+D
Sbjct: 123 DEVEEAIEAEMEKPITCVESA--ELGRANRIVDAAGRYIEFCKGTFPNEQSLNSLKVVLD 180

Query: 183 CANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIAL 242
           CANGA+Y +AP VF ELGA V+ +G  PNGININ +CG+T+V  LQ +V   +AD+G+A 
Sbjct: 181 CANGATYHIAPNVFSELGAQVITMGCDPNGININEECGATDVRKLQERVIAEKADVGLAF 240

Query: 243 DGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLGL 302
           DGDGDR+I+VD +G  V+GDQI+ +IARE +    L+G G+V T+MSN+GLE  +  LG+
Sbjct: 241 DGDGDRIIMVDHQGNKVDGDQILYIIAREALRQGQLKG-GVVGTLMSNMGLEIALKQLGI 299

Query: 303 SLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKPV 362
             +R +VGDRY++E ++  G+ +G E SGH+IL D  +TGDG+VA LQVL  + +    +
Sbjct: 300 PFERAKVGDRYVLEKLQEKGWRMGAENSGHVILLDKTTTGDGIVAGLQVLSAMVRNHMSL 359

Query: 363 STICHCFEEYPQFLRSVSVKDT-SILNSSSIVQAIADAESELRGIDRLIVRASGTESLIR 421
             +C   +  PQ L +V  K     L S ++V A    E EL G  R+++R SGTE LIR
Sbjct: 360 HDLCSGMKLLPQILVNVRFKGKHDPLQSEAVVAANEQVEKELAGKGRVLLRKSGTEPLIR 419

Query: 422 IMAEGDDLSRIKRIVDDLAKVI 443
           +M EG++   +  + + +A  +
Sbjct: 420 VMVEGENEDVVTEMANRIADAV 441


>gi|92115194|ref|YP_575122.1| phosphoglucosamine mutase [Chromohalobacter salexigens DSM 3043]
 gi|122419131|sp|Q1QSY5|GLMM_CHRSD RecName: Full=Phosphoglucosamine mutase
 gi|91798284|gb|ABE60423.1| phosphoglucosamine mutase [Chromohalobacter salexigens DSM 3043]
          Length = 453

 Score =  397 bits (1019), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 209/452 (46%), Positives = 301/452 (66%), Gaps = 18/452 (3%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFR---GKKKHRRVVIGKDTRLSGYM 57
           M RR+FGTDGIRG     PIT +F++++G A+G +     G+K   +V+IGKDTR+SGYM
Sbjct: 1   MTRRYFGTDGIRGTVGEAPITADFVLKLGWAMGRVLSRRTGRKSRAKVLIGKDTRISGYM 60

Query: 58  LENSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPD 117
            E++L AG +AAG+D  +LGP+P+P +A LTR+ RAD G++ISASHNP+QDNGIK F  +
Sbjct: 61  FESALEAGLSAAGVDVSLLGPMPTPGIAYLTRTFRADAGIVISASHNPFQDNGIKFFSAE 120

Query: 118 GYKVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGL 177
           G K++  +E+ IE  L  DL       D++G A R+     RYIE  K T+P  +TL+GL
Sbjct: 121 GVKLADAVEEEIEAEL--DLPLSTVAPDALGKALRIQDAAGRYIEFCKSTVPDRLTLEGL 178

Query: 178 RIVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRAD 237
           ++V+DCA+GA+Y +AP V  ELGA+V +IG +P+G+NIN   GST+  +L+  V E  AD
Sbjct: 179 KVVLDCAHGATYHIAPSVLRELGAEVSLIGAEPDGLNINHGVGSTHPAALRAAVIERGAD 238

Query: 238 IGIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFI 297
           +G+ALDGDGDRV++VD +G  V+GD I+ LIAR+  +  LL G G+V T+MSN GL   +
Sbjct: 239 LGVALDGDGDRVVLVDAEGREVDGDDILYLIARDRRARDLL-GGGVVGTLMSNFGLAAAL 297

Query: 298 AGLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQ 357
             L +  +R +VGDRY+ME +  NG+ +GGE SGHI+     +TGDG+V+ALQVL  + +
Sbjct: 298 EALDIPFERAKVGDRYVMERLAANGWQLGGESSGHIVCGHVQTTGDGIVSALQVLAIMVR 357

Query: 358 YDKPVSTICHCFEEYPQFLRSVSVK----DTSILNSSSIVQAIADAESELRGIDRLIVRA 413
               ++ +   FE+ PQ L +V +       ++L +  +   +A  E+EL    R+++R 
Sbjct: 358 EGASLAALLQGFEKAPQALVNVRLTPETDKEALLGNEQVQHTVASVEAELGEEGRVLLRP 417

Query: 414 SGTESLIRIMAEG------DDLSRIKRIVDDL 439
           SGTE LIR+M EG      D L+R  RI DD+
Sbjct: 418 SGTEPLIRVMVEGRPHFDVDALAR--RIADDI 447


>gi|332288390|ref|YP_004419242.1| phosphoglucosamine mutase [Gallibacterium anatis UMN179]
 gi|330431286|gb|AEC16345.1| phosphoglucosamine mutase [Gallibacterium anatis UMN179]
          Length = 444

 Score =  397 bits (1019), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 207/445 (46%), Positives = 307/445 (68%), Gaps = 9/445 (2%)

Query: 2   KRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENS 61
           +R++FGTDG+RG+  T+PITP F +++G A G +    +  R+V+IGKDTR+SGYMLE++
Sbjct: 3   ERKYFGTDGVRGRVGTYPITPEFALKLGWAAGKVL-ATQGSRKVLIGKDTRISGYMLESA 61

Query: 62  LVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKV 121
           L AG  AAG+ A  +GP+P+PA+A LTR+ RA+ G++ISASHNPY DNGIK F   G K+
Sbjct: 62  LEAGLAAAGLSAAFVGPMPTPAIAYLTRTFRAEAGIVISASHNPYYDNGIKFFSAHGTKL 121

Query: 122 STDIEDRIETLLEDDLTSYLSCYDS--IGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRI 179
             DIE  IE LLE  +T    C +S  +G A R++    RYIE  K T P  ++L+GL+I
Sbjct: 122 PDDIELAIEELLEQPMT----CVESAELGKASRINDAAGRYIEFCKSTFPAHLSLEGLKI 177

Query: 180 VVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIG 239
           VVDCANGA+Y +AP V  ELGA V+ IG KP+G+NIN  CG+T+V +LQ  V + +AD+G
Sbjct: 178 VVDCANGATYHIAPNVMRELGATVIEIGTKPDGMNINERCGATDVRALQEVVVQSKADVG 237

Query: 240 IALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAG 299
           +A DGDGDR+++VD  G  V+GDQI+ +IARE +    L G G+V T+MSN+ LE  +  
Sbjct: 238 LAYDGDGDRIMMVDHLGNKVDGDQILFIIAREALRSGKLSG-GVVGTLMSNMSLELALKM 296

Query: 300 LGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYD 359
           LG+   R +VGDRY++E M+  G+ +GGE SGHII+S+  +TGDG+VA+L+VL  +  + 
Sbjct: 297 LGIPFVRAKVGDRYVLEQMQERGWKLGGENSGHIIISEKNTTGDGIVASLEVLAAMVNHG 356

Query: 360 KPVSTICHCFEEYPQFLRSVSVK-DTSILNSSSIVQAIADAESELRGIDRLIVRASGTES 418
             ++ +    + +PQ L +V  +  ++ L + ++ QA A+ E +L G  R+++R SGTE 
Sbjct: 357 LSLNELASGVQLFPQVLINVRFEAGSNPLENEAVKQAAAEVEQKLHGKGRVLLRKSGTEP 416

Query: 419 LIRIMAEGDDLSRIKRIVDDLAKVI 443
           +IR+M E +D    ++  + +A+++
Sbjct: 417 VIRVMVECEDQELAQQCAEKIAEIV 441


>gi|183600362|ref|ZP_02961855.1| hypothetical protein PROSTU_03925 [Providencia stuartii ATCC 25827]
 gi|188020153|gb|EDU58193.1| hypothetical protein PROSTU_03925 [Providencia stuartii ATCC 25827]
          Length = 445

 Score =  397 bits (1019), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 210/440 (47%), Positives = 296/440 (67%), Gaps = 9/440 (2%)

Query: 3   RRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSL 62
           R++FGTDGIRGK    PITP+F++++G A G +   +   R+++IGKDTR+SGYMLE+SL
Sbjct: 4   RKYFGTDGIRGKVGDSPITPDFVLKLGWAAGKVL-ARHGSRKIIIGKDTRISGYMLESSL 62

Query: 63  VAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVS 122
            AG  AAG+ A   GP+P+PAVA LTR+ RA+ G++ISASHNPY DNGIK F  DG K+ 
Sbjct: 63  EAGLAAAGLSASFTGPMPTPAVAYLTRTFRAEAGIVISASHNPYDDNGIKFFSIDGTKLP 122

Query: 123 TDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVVD 182
            ++E+ IE  +E  +T   S    +G A R+     RYIE  K T P + +L  L++V+D
Sbjct: 123 DEVEEAIEAEMEKPITCVESA--ELGRANRIVDAAGRYIEFCKGTFPSEQSLSSLKVVID 180

Query: 183 CANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIAL 242
           CANGA+Y +AP VF ELGA+V+ IG +PNGININ  CG+T+V  LQ +V   +AD+G+A 
Sbjct: 181 CANGATYHIAPNVFRELGAEVIAIGCEPNGININEKCGATDVRMLQERVLAEKADVGLAF 240

Query: 243 DGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLGL 302
           DGDGDR+I+VD +G  V+GDQI+ +IARE +    L+G G++ T+MSN+GLE  +  LG+
Sbjct: 241 DGDGDRLIMVDHEGNKVDGDQILYIIAREALRQGQLKG-GVIGTLMSNMGLEIALKQLGI 299

Query: 303 SLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKPV 362
             +R +VGDRY++E ++  G+ +G E SGHIIL D  +TGDG+VA LQVL  + +    +
Sbjct: 300 PFERAKVGDRYVLEKLQEKGWRMGAENSGHIILLDKTTTGDGIVAGLQVLSAMVRNQMSL 359

Query: 363 STICHCFEEYPQFLRSVSVKDT-SILNSSSIVQAIADAESELRGIDRLIVRASGTESLIR 421
             +C   +  PQ L +V    +   L S +++ A    E EL G  R+++R SGTE LIR
Sbjct: 360 HDLCSGMKLLPQVLVNVRFSGSHDPLQSEAVLAASEQVEKELAGKGRVLLRKSGTEPLIR 419

Query: 422 IMAEGDD----LSRIKRIVD 437
           +M EG++    L+   RI D
Sbjct: 420 VMVEGENEADVLAMANRIAD 439


>gi|90580527|ref|ZP_01236332.1| phosphoglucomutase/phosphomannomutase family protein MrsA [Vibrio
           angustum S14]
 gi|90438185|gb|EAS63371.1| phosphoglucomutase/phosphomannomutase family protein MrsA
           [Photobacterium angustum S14]
          Length = 445

 Score =  397 bits (1019), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 217/445 (48%), Positives = 301/445 (67%), Gaps = 9/445 (2%)

Query: 2   KRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENS 61
           +R+FFGTDGIRG     PITP+F+M++G A G +   +   ++V+IGKDTR+SGYMLE++
Sbjct: 3   ERKFFGTDGIRGLVGEAPITPDFVMKLGWAAGRVLS-QTGTKKVLIGKDTRISGYMLESA 61

Query: 62  LVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKV 121
           L AG  AAG+ A   GP+P+PAVA LTR+ RA+ G++ISASHNPY DNGIK F   G K+
Sbjct: 62  LEAGLAAAGLKAAFTGPMPTPAVAYLTRTFRAEAGIVISASHNPYYDNGIKFFSAQGTKL 121

Query: 122 STDIEDRIETLLEDDLTSYLSCYDS--IGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRI 179
             DIE  IE  +E  LT    C +S  +G A R+D    RYIE  K T P  ++L+G +I
Sbjct: 122 PDDIELAIEAEMEKPLT----CVESALLGKAYRIDDAAGRYIEFCKGTFPTHLSLEGFKI 177

Query: 180 VVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIG 239
           VVDCA+GA+Y +AP+VF ELGA+V+ IG +PNG+NIN   G+T+V +LQ KV E +AD G
Sbjct: 178 VVDCAHGATYHIAPKVFSELGAEVIAIGCEPNGVNINDKVGATDVAALQAKVLEEKADFG 237

Query: 240 IALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAG 299
           IALDGDGDRVI+VDE G  V+GDQI  +IAR+ +    L+G G+V T+M+N+G+E  +  
Sbjct: 238 IALDGDGDRVIMVDELGNKVDGDQIAYIIARDALRRGELKG-GVVGTLMTNMGMEVALKN 296

Query: 300 LGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYD 359
           LG+   R +VGDRY+ME ++ + + +G E SGH+IL D  +TGDG+VA LQV+  I    
Sbjct: 297 LGIPFVRAKVGDRYVMEELQKHDWLIGAENSGHVILLDKVTTGDGIVAGLQVMASIVASK 356

Query: 360 KPVSTICHCFEEYPQFLRSVSVKDTS-ILNSSSIVQAIADAESELRGIDRLIVRASGTES 418
             +  +C     +PQ L +V  K TS  L S +++ A    E +L    R+++R SGTE 
Sbjct: 357 MSLKELCDGMVMFPQVLENVRFKGTSDPLKSDAVITATKLVEEKLGDNGRVLLRKSGTEP 416

Query: 419 LIRIMAEGDDLSRIKRIVDDLAKVI 443
           LIR+M EG D + +++   D+AK +
Sbjct: 417 LIRVMVEGQDAADVQQYALDIAKAV 441


>gi|330447381|ref|ZP_08311030.1| phosphoglucosamine mutase [Photobacterium leiognathi subsp.
           mandapamensis svers.1.1.]
 gi|328491572|dbj|GAA05527.1| phosphoglucosamine mutase [Photobacterium leiognathi subsp.
           mandapamensis svers.1.1.]
          Length = 445

 Score =  397 bits (1019), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 215/445 (48%), Positives = 301/445 (67%), Gaps = 9/445 (2%)

Query: 2   KRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENS 61
           +R+FFGTDGIRG     PITP+F+M++G A G +   +   ++V+IGKDTR+SGYMLE++
Sbjct: 3   ERKFFGTDGIRGFVGESPITPDFVMKLGWAAGRVLS-QTGTKKVLIGKDTRISGYMLESA 61

Query: 62  LVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKV 121
           L AG  AAG+ A   GP+P+PAVA LTR+ RA+ G++ISASHNPY DNGIK F   G K+
Sbjct: 62  LEAGLAAAGLKAAFTGPMPTPAVAYLTRTFRAEAGIVISASHNPYYDNGIKFFSAQGTKL 121

Query: 122 STDIEDRIETLLEDDLTSYLSCYDS--IGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRI 179
             DIE  IE  +E  LT    C +S  +G A R+D    RYIE  K T P  ++L+G +I
Sbjct: 122 PDDIELAIEAEMEKPLT----CVESALLGKAYRIDDAAGRYIEFCKGTFPTHLSLEGFKI 177

Query: 180 VVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIG 239
           VVDCA+GA+Y +AP+VF ELGA+V+ IG +PNG+NIN   G+T+V +LQ KV E +AD G
Sbjct: 178 VVDCAHGATYHIAPKVFAELGAEVIAIGCEPNGVNINDKVGATDVAALQAKVLEEKADFG 237

Query: 240 IALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAG 299
           IALDGDGDRVI+VDE G  V+GDQI  +IAR+ +    L+G G+V T+M+N+G+E  +  
Sbjct: 238 IALDGDGDRVIMVDELGNKVDGDQIAYIIARDALRRGELKG-GVVGTLMTNMGMEVALKN 296

Query: 300 LGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYD 359
           LG+   R +VGDRY+ME ++ + + +G E SGH+IL D  +TGDG+VA LQV+  I    
Sbjct: 297 LGIPFVRAKVGDRYVMEELQKHDWLIGAENSGHVILLDKVTTGDGIVAGLQVMASIVASK 356

Query: 360 KPVSTICHCFEEYPQFLRSVSVK-DTSILNSSSIVQAIADAESELRGIDRLIVRASGTES 418
             +  +C     +PQ L +V  K ++  L S +++ A    E +L    R+++R SGTE 
Sbjct: 357 MSLKELCDGMTMFPQVLENVRFKGESDPLQSEAVISATKLVEEKLGDNGRVLLRKSGTEP 416

Query: 419 LIRIMAEGDDLSRIKRIVDDLAKVI 443
           LIR+M EG D + +++   D+AK +
Sbjct: 417 LIRVMVEGQDAAAVQQYALDIAKAV 441


>gi|269468929|gb|EEZ80513.1| phosphomannomutase [uncultured SUP05 cluster bacterium]
          Length = 442

 Score =  397 bits (1019), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 203/441 (46%), Positives = 295/441 (66%), Gaps = 4/441 (0%)

Query: 4   RFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSLV 63
           +FFGTDGIRG+    PIT +F +++G AVG +   K     V+IGKDTR+SGY+ E++L 
Sbjct: 3   QFFGTDGIRGRVGEEPITADFFLKLGWAVGSVL-AKDGSASVIIGKDTRVSGYLFESALE 61

Query: 64  AGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVST 123
           AGF +AG+D  +LGP+P+PAVA LT++  A  GV+ISASHN +QDNG+K F   G+K+S 
Sbjct: 62  AGFLSAGVDVGLLGPMPTPAVAYLTQAYGATAGVVISASHNHFQDNGVKFFSSQGFKLSD 121

Query: 124 DIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVVDC 183
           + +  IE  L + + S  S  D+IG A R +    RYIE  K T  R V L GL IV+DC
Sbjct: 122 ENQKEIEAKLSESMISVDS--DNIGKAHRHEQPLGRYIEFCKSTFDRSVDLSGLNIVIDC 179

Query: 184 ANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIALD 243
           ANGA+Y +A  VF ELGA++ +I ++P+G NINL+CG+T+   LQR V E + D+GIA D
Sbjct: 180 ANGATYHIAENVFSELGANITIINNQPDGFNINLNCGATDTKQLQRVVVEQKFDLGIAFD 239

Query: 244 GDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLGLS 303
           GDGDR+++VD  G +V+GD+++ +IA+ W   S L  N +V T M+N+G+   +  LG++
Sbjct: 240 GDGDRLMMVDTDGKLVDGDELVFIIAKAWKDQSRLVNNAVVGTKMTNLGMRHALKDLGIN 299

Query: 304 LKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKPVS 363
              T+VGDR++ME M+++G  +GGE SGHII  D  ++GDG+V+ALQVL  + +  K + 
Sbjct: 300 FIETDVGDRFVMEQMQSSGSILGGEGSGHIICLDKTTSGDGIVSALQVLEVLAKSHKSLG 359

Query: 364 TICHCFEEYPQFLRSVSVKDTSIL-NSSSIVQAIADAESELRGIDRLIVRASGTESLIRI 422
            +    E+YPQ L +V  K    L N + + QA  + E  L    R+++RASGTE LIR+
Sbjct: 360 ELKKEMEKYPQVLINVKTKSKVDLDNHADLKQAQLEVEESLGDEGRVLIRASGTEPLIRV 419

Query: 423 MAEGDDLSRIKRIVDDLAKVI 443
           M EG +L+ +++  D L K++
Sbjct: 420 MVEGKNLTLVQQSADKLVKIL 440


>gi|238021711|ref|ZP_04602137.1| hypothetical protein GCWU000324_01614 [Kingella oralis ATCC 51147]
 gi|237866325|gb|EEP67367.1| hypothetical protein GCWU000324_01614 [Kingella oralis ATCC 51147]
          Length = 442

 Score =  397 bits (1019), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 208/445 (46%), Positives = 298/445 (66%), Gaps = 7/445 (1%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVG-YLFRGKKKHR-RVVIGKDTRLSGYML 58
           M R++FGTDGIRG+   FPITP+F++++G A G  L +    H+  V+IGKDTR+SGYML
Sbjct: 1   MARKYFGTDGIRGEVGQFPITPDFVLKLGSAFGSALVKHDAGHKPTVIIGKDTRISGYML 60

Query: 59  ENSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDG 118
           E +LVAGFTAAG++    GP+P+PA+A LTR+LR D GVMISASHN Y DNGIK F   G
Sbjct: 61  ETALVAGFTAAGVNVVQTGPLPTPAIAYLTRALRLDGGVMISASHNVYSDNGIKFFAEGG 120

Query: 119 YKVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLR 178
            K+S D+E  +E  LE DL +  S    +G A+R++G  DRYIE  K T P  + L GL+
Sbjct: 121 VKLSDDMELAVEAELEKDLRTLPSS--QLGRARRIEGAADRYIEFCKSTFPSHLDLYGLK 178

Query: 179 IVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADI 238
           +VVD ANGA Y  AP+VF ELGA+V+ IGD+PNG NIN   G+T   +LQ  V +  A+ 
Sbjct: 179 LVVDTANGAGYHTAPKVFHELGAEVISIGDEPNGYNINNKVGATYTKTLQAAVLQNDANY 238

Query: 239 GIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIA 298
           GIALDGDGDR+++VD+ G + +GD+++ +IA+   +  L  G G+V TVMSN+G+E+ +A
Sbjct: 239 GIALDGDGDRLMMVDKNGVVYDGDKLIYVIAKARAAQGLAFG-GVVGTVMSNLGMEKALA 297

Query: 299 GLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQY 358
             G++  R +VGDRY++E +    + +GGE SGHI+  D  +TGDG ++ALQVL  +++ 
Sbjct: 298 ARGIAFARAKVGDRYVLEQLHERSWLIGGEASGHIVCLDKHNTGDGTISALQVLAALREL 357

Query: 359 DKPVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTES 418
            + + T    ++ YPQ + +V ++      S+S   A+  AE EL    R+++RASGTE 
Sbjct: 358 GQDLKTAVD-WQPYPQTMINVRIQKGQDWQSASQA-ALVQAEQELGDRGRIVLRASGTEP 415

Query: 419 LIRIMAEGDDLSRIKRIVDDLAKVI 443
           ++R+M E D     ++    +A+ I
Sbjct: 416 VVRVMVEADSAMIAEQCAQRIAQSI 440


>gi|291613531|ref|YP_003523688.1| phosphoglucosamine mutase [Sideroxydans lithotrophicus ES-1]
 gi|291583643|gb|ADE11301.1| phosphoglucosamine mutase [Sideroxydans lithotrophicus ES-1]
          Length = 451

 Score =  397 bits (1019), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 207/450 (46%), Positives = 297/450 (66%), Gaps = 11/450 (2%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRR-----VVIGKDTRLSG 55
           M R++FGTDG+RG+    PITP F+M +G A G +   K +H +     V+IGKDTR+SG
Sbjct: 1   MSRKYFGTDGVRGRVGVHPITPQFVMNLGYAAGKVL-AKAEHAQSDRPAVLIGKDTRISG 59

Query: 56  YMLENSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFG 115
           YMLE++L AG  AAG+D ++ GPIP+PAVA LTR+LR   GV+ISASHNP+ DNGIK F 
Sbjct: 60  YMLESALEAGLIAAGIDVYLAGPIPTPAVAYLTRALRLQAGVVISASHNPFDDNGIKFFS 119

Query: 116 PDGYKVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQ 175
             G K+  ++E  IE  L++ + +  S  + +G AKR+D    RYIE  K T P D+ L+
Sbjct: 120 GSGTKLPDEVELAIEAALDEPMQTNPS--EGLGKAKRIDDAVGRYIEFCKSTFPADMNLR 177

Query: 176 GLRIVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVR 235
           G++IVVD A+GA+Y +A  VF ELGADV+ IG +PNG NIN   G+T   +LQ+ V E +
Sbjct: 178 GMKIVVDSAHGATYHIARNVFHELGADVIAIGAEPNGKNINEGYGATKPQNLQKAVVEHK 237

Query: 236 ADIGIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLER 295
           A IGIALDGDGDR+I+VD  G + +GDQ++ +IA+   +   L G G+V T+M+N+  E 
Sbjct: 238 AHIGIALDGDGDRLIMVDAGGKLYDGDQLLYVIAKHRQALGTLHG-GVVGTLMTNLAFEH 296

Query: 296 FIAGLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYI 355
            +  LG+   R +VGDRY+ME ++   + +GGE SGHII  D  STGDG+V+ALQVL  +
Sbjct: 297 AMLKLGIPFARAKVGDRYVMEVLQEKKWQLGGENSGHIICLDKHSTGDGIVSALQVLCAL 356

Query: 356 KQYDKPVSTICHCFEEYPQFLRSVSVKDTS--ILNSSSIVQAIADAESELRGIDRLIVRA 413
           +   + ++        YPQ L +V VK  +  +L  + +   +A AE +L G  R+++R 
Sbjct: 357 RMKQQTLAQAASDLHMYPQILINVRVKGKAAELLELTPVKAEVAKAERDLNGKGRVLLRP 416

Query: 414 SGTESLIRIMAEGDDLSRIKRIVDDLAKVI 443
           SGTE L+R+M EG+D  ++K   + +A+ +
Sbjct: 417 SGTEPLLRVMVEGEDGGQVKLWAERIAEAV 446


>gi|317046737|ref|YP_004114385.1| phosphoglucosamine mutase [Pantoea sp. At-9b]
 gi|316948354|gb|ADU67829.1| phosphoglucosamine mutase [Pantoea sp. At-9b]
          Length = 444

 Score =  397 bits (1019), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 208/448 (46%), Positives = 305/448 (68%), Gaps = 9/448 (2%)

Query: 2   KRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENS 61
           +R++FGTDGIRGK    PITP+F++++G A G +   +   ++V+IGKDTR+SGYMLE++
Sbjct: 3   ERKYFGTDGIRGKVGEAPITPDFVLKLGWAAGKVL-ARHGSKKVLIGKDTRISGYMLESA 61

Query: 62  LVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKV 121
           L AG  AAG+ A   GP+P+PA+A LTR+ RA+ G++ISASHNP+ DNGIK F  +G K+
Sbjct: 62  LEAGLAAAGLSAAFTGPMPTPAIAYLTRTFRAEAGIVISASHNPFDDNGIKFFSAEGTKL 121

Query: 122 STDIEDRIETLLEDDLTSYLSCYDS--IGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRI 179
             ++E+ IE  +E  +T    C +S  +G A R+     RYIE  K T P +++L GL+I
Sbjct: 122 PDEVEEAIELEMEKPIT----CVESAELGRASRIVDAAGRYIEFCKGTFPSELSLNGLKI 177

Query: 180 VVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIG 239
           VVDCANGA+Y +AP V  ELGA V+ I  +P+G+NIN +CG+T++  LQ++V + +ADIG
Sbjct: 178 VVDCANGATYHIAPNVLRELGATVIAIATQPDGMNINKNCGATDLRMLQQRVLDEKADIG 237

Query: 240 IALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAG 299
           +A DGDGDR+++VD  GA V+GDQI+ +IARE +    LRG G+V T+MSN+GLE  +  
Sbjct: 238 LAYDGDGDRIMMVDHLGAKVDGDQILYIIAREGLRQGQLRG-GVVGTLMSNMGLELALKQ 296

Query: 300 LGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYD 359
           LG+   R +VGDRY++E M+  G+ +G E SGH+IL D  +TGDG+VA+LQVL  + Q  
Sbjct: 297 LGIPFVRAKVGDRYVLEKMQEKGWRLGAENSGHVILLDKTTTGDGIVASLQVLTAMVQNH 356

Query: 360 KPVSTICHCFEEYPQFLRSVSVKDTS-ILNSSSIVQAIADAESELRGIDRLIVRASGTES 418
             +  +C   +  PQ L +V    +S  L S ++  A A+ E  L G  R+++R SGTE 
Sbjct: 357 MSLHDLCSGMKMLPQVLVNVRFSGSSDPLQSDAVKAASAEVEKTLAGRGRVLLRKSGTEP 416

Query: 419 LIRIMAEGDDLSRIKRIVDDLAKVIPMI 446
           LIR+M EG+D +++  +   +A  +  +
Sbjct: 417 LIRVMVEGEDEAQVTALAHKIADAVKAV 444


>gi|15618874|ref|NP_225160.1| phosphoglucomutase [Chlamydophila pneumoniae CWL029]
 gi|15836500|ref|NP_301024.1| phosphoglucomutase [Chlamydophila pneumoniae J138]
 gi|16752065|ref|NP_445431.1| phosphoglucomutase/phosphomannomutase family protein [Chlamydophila
           pneumoniae AR39]
 gi|33242335|ref|NP_877276.1| phosphohexosemutase [Chlamydophila pneumoniae TW-183]
 gi|81789846|sp|Q9Z6U1|GLMM_CHLPN RecName: Full=Phosphoglucosamine mutase
 gi|4377292|gb|AAD19103.1| Phosphoglucomutase [Chlamydophila pneumoniae CWL029]
 gi|7189805|gb|AAF38680.1| phosphoglucomutase/phosphomannomutase family protein [Chlamydophila
           pneumoniae AR39]
 gi|8979341|dbj|BAA99175.1| phosphoglucomutase [Chlamydophila pneumoniae J138]
 gi|33236846|gb|AAP98933.1| phosphohexosemutase [Chlamydophila pneumoniae TW-183]
          Length = 458

 Score =  396 bits (1018), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 203/443 (45%), Positives = 298/443 (67%), Gaps = 2/443 (0%)

Query: 3   RRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFR-GKKKHRRVVIGKDTRLSGYMLENS 61
           R+ FGTDG+RG++N  P+T    + +G AV  + R G+    RVV+GKDTRLSGYM EN+
Sbjct: 6   RKLFGTDGVRGRANFEPMTVETTVLLGKAVARVLREGRSGKHRVVVGKDTRLSGYMFENA 65

Query: 62  LVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKV 121
           L+AG  + G++  +LGPIP+P VA +TR+ RAD G+MISASHNPY+DNGIK+F  +G+K+
Sbjct: 66  LIAGLNSMGIETLVLGPIPTPGVAFITRAYRADAGIMISASHNPYRDNGIKIFSLEGFKI 125

Query: 122 STDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVV 181
           S  +E RIET++ +     L    ++G  KRV     RY+E VK T P+  TL+GL+IV+
Sbjct: 126 SDVLEQRIETMVSEADFGPLPEDHAVGKNKRVIDAMGRYVEFVKATFPKGRTLKGLKIVL 185

Query: 182 DCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIA 241
           DCA+GASYKVAP VF EL A+V+  G +P GININ  CG+     +Q+ V E +A +GIA
Sbjct: 186 DCAHGASYKVAPSVFEELDAEVICYGCEPTGININEHCGALFPQVIQKAVIEHQAHLGIA 245

Query: 242 LDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLG 301
           LDGDGDR+I+VDEKG IV+GD I+++ A +    S L  N +V T+M+N G+ +++ GLG
Sbjct: 246 LDGDGDRIIMVDEKGHIVDGDMILSICAGDLKKRSALPHNRVVATIMTNFGVLKYLEGLG 305

Query: 302 LSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKP 361
           L +  + VGDR+++  M  +   +GGEQSGH+I  DY +TGDG+V+ALQVLR + + +  
Sbjct: 306 LQVFTSPVGDRHVLHAMLEHEVTLGGEQSGHMIFLDYNTTGDGIVSALQVLRIMIESESM 365

Query: 362 VSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQ-AIADAESELRGIDRLIVRASGTESLI 420
           +S +     + PQ L +V+V++   L +  +++  + D +  L    R+++R SGTE++ 
Sbjct: 366 LSDLTAPIVKSPQTLINVAVREKIPLETIPLIERTLRDVQDALGPSGRILLRYSGTENIC 425

Query: 421 RIMAEGDDLSRIKRIVDDLAKVI 443
           R+M EG    ++  +   LA VI
Sbjct: 426 RVMVEGHKKHQVDCLAKALADVI 448


>gi|62181803|ref|YP_218220.1| phosphoglucosamine mutase [Salmonella enterica subsp. enterica
           serovar Choleraesuis str. SC-B67]
 gi|224585089|ref|YP_002638888.1| phosphoglucosamine mutase [Salmonella enterica subsp. enterica
           serovar Paratyphi C strain RKS4594]
 gi|75480576|sp|Q57JH3|GLMM_SALCH RecName: Full=Phosphoglucosamine mutase
 gi|254798592|sp|C0PZ59|GLMM_SALPC RecName: Full=Phosphoglucosamine mutase
 gi|62129436|gb|AAX67139.1| phosphoglucosamine mutase [Salmonella enterica subsp. enterica
           serovar Choleraesuis str. SC-B67]
 gi|224469617|gb|ACN47447.1| PGM/PMM-family protein [Salmonella enterica subsp. enterica serovar
           Paratyphi C strain RKS4594]
 gi|322716289|gb|EFZ07860.1| phosphoglucosamine mutase [Salmonella enterica subsp. enterica
           serovar Choleraesuis str. A50]
          Length = 445

 Score =  396 bits (1018), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 211/448 (47%), Positives = 301/448 (67%), Gaps = 10/448 (2%)

Query: 3   RRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSL 62
           R++FGTDGIRG+    PITP+F++++G A G +   +   R+++IGKDTR+SGYMLE++L
Sbjct: 4   RKYFGTDGIRGRVGNAPITPDFVLKLGWAAGKVL-ARHGSRKIIIGKDTRISGYMLESAL 62

Query: 63  VAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVS 122
            AG  AAG+ A   GP+P+PAVA LTR+ RA+ G++ISASHNP+ DNGIK F  DG K+ 
Sbjct: 63  EAGLAAAGLSASFTGPMPTPAVAYLTRTFRAEAGIVISASHNPFYDNGIKFFSIDGTKLP 122

Query: 123 TDIEDRIETLLEDDLTSYLSCYDS--IGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
            D+E+ IE  +E ++T    C DS  +G A R+     RYIE  K T P +++L GL++V
Sbjct: 123 DDVEEAIEAEMEKEIT----CVDSAELGKASRIVDAAGRYIEFCKGTFPNELSLNGLKVV 178

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           VDCANGA+Y +AP V  ELGA V+ IG +PNG+NIN + G+T+V +LQ +V   +AD+GI
Sbjct: 179 VDCANGATYHIAPNVLRELGATVIAIGCEPNGVNINEEVGATDVRALQARVLAEKADLGI 238

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           ALDGDGDRVI+VD +G  V+GDQIM +IARE +    LRG G V T+MSN+GLE  +  L
Sbjct: 239 ALDGDGDRVIMVDHEGNKVDGDQIMYIIAREGLRQGQLRG-GAVGTLMSNMGLELALKQL 297

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           G+   R +VGDRY++E ++  G+ +G E SGH+IL D  +TGDG+VA LQVL  + +   
Sbjct: 298 GIPFSRAKVGDRYVLEKLQEKGWRIGAENSGHVILLDKTTTGDGIVAGLQVLAAMVRNHM 357

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTS--ILNSSSIVQAIADAESELRGIDRLIVRASGTES 418
            +  +C   + +PQ L +V     S   L + ++    AD E+ L    R+++R SGTE 
Sbjct: 358 SLHDLCSGMKMFPQILVNVRYTAGSGDPLENEAVKAVTADVEATLGNRGRVLLRKSGTEP 417

Query: 419 LIRIMAEGDDLSRIKRIVDDLAKVIPMI 446
           LIR+M EG+D +++      +A  +  +
Sbjct: 418 LIRVMVEGEDEAQVTAFAHRIADAVKAV 445


>gi|311695963|gb|ADP98836.1| phosphoglucosamine mutase [marine bacterium HP15]
          Length = 447

 Score =  396 bits (1018), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 211/443 (47%), Positives = 302/443 (68%), Gaps = 4/443 (0%)

Query: 2   KRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENS 61
           +R++FGTDGIRG    FPITP FM+++G A G  F+   +   V+IGKDTRLSGYM E++
Sbjct: 3   ERKYFGTDGIRGHVGEFPITPEFMLKLGWAAGQAFKRDGQRNSVLIGKDTRLSGYMFESA 62

Query: 62  LVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKV 121
           L AG  AAG+D  +LGP+P+PA+A LTR+ RA  G++ISASHNP+ DNGIK F   G K+
Sbjct: 63  LEAGLAAAGVDVKLLGPMPTPAIAYLTRTFRASAGIVISASHNPHHDNGIKFFSAAGTKL 122

Query: 122 STDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVV 181
              +E  IE  L+  +   +     +G A RVD    RY+E  K T+P + TL G+ IV+
Sbjct: 123 DDALEAEIERWLDKPIE--VCGPTELGKASRVDDAPGRYVEFCKSTVPNEFTLDGMNIVL 180

Query: 182 DCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIA 241
           DCA+GA+Y VAP+VF ELGA V VIG  P+G+NINL+ GST++ +L+  V E  AD+GIA
Sbjct: 181 DCAHGATYHVAPKVFRELGAKVSVIGGDPDGLNINLNVGSTHLQALKAAVIEKNADLGIA 240

Query: 242 LDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLG 301
            DGDGDRV++VD  G+ V+GD+++ +IA +  +   L+G G+V T+M+N+G+E  +  +G
Sbjct: 241 FDGDGDRVLMVDRDGSEVDGDELLYVIASQRFAEDRLKG-GVVGTLMTNLGVELALNEIG 299

Query: 302 LSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKP 361
           +  +R +VGDRY+ME +  N + +GGE SGH+++ D  STGDG+V+ALQVL  + +  K 
Sbjct: 300 IEFERAKVGDRYVMERLLANNWVLGGEGSGHMVIRDCTSTGDGIVSALQVLLSVWKSGKT 359

Query: 362 VSTICHCFEEYPQFLRSVSVKDT-SILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
           ++ +     + PQ + +V V       +   IV A+  AE+EL    R+++RASGTE LI
Sbjct: 360 LADLRKGMSKLPQKMINVRVAQRFDPFSRDDIVAAVRKAETELGSSGRILLRASGTEPLI 419

Query: 421 RIMAEGDDLSRIKRIVDDLAKVI 443
           R+MAEG D S I R+V++LAKV+
Sbjct: 420 RVMAEGQDASEILRVVEELAKVV 442


>gi|204928335|ref|ZP_03219535.1| phosphoglucosamine mutase [Salmonella enterica subsp. enterica
           serovar Javiana str. GA_MM04042433]
 gi|204322657|gb|EDZ07854.1| phosphoglucosamine mutase [Salmonella enterica subsp. enterica
           serovar Javiana str. GA_MM04042433]
 gi|322615297|gb|EFY12218.1| phosphoglucosamine mutase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 315996572]
 gi|322618344|gb|EFY15235.1| phosphoglucosamine mutase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 495297-1]
 gi|322622851|gb|EFY19695.1| phosphoglucosamine mutase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 495297-3]
 gi|322626827|gb|EFY23624.1| phosphoglucosamine mutase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 495297-4]
 gi|322631396|gb|EFY28156.1| phosphoglucosamine mutase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 515920-1]
 gi|322635337|gb|EFY32051.1| phosphoglucosamine mutase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 515920-2]
 gi|322643336|gb|EFY39900.1| phosphoglucosamine mutase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 531954]
 gi|322647092|gb|EFY43593.1| phosphoglucosamine mutase [Salmonella enterica subsp. enterica
           serovar Montevideo str. NC_MB110209-0054]
 gi|322648895|gb|EFY45340.1| phosphoglucosamine mutase [Salmonella enterica subsp. enterica
           serovar Montevideo str. OH_2009072675]
 gi|322655087|gb|EFY51398.1| phosphoglucosamine mutase [Salmonella enterica subsp. enterica
           serovar Montevideo str. CASC_09SCPH15965]
 gi|322657690|gb|EFY53958.1| phosphoglucosamine mutase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 19N]
 gi|322664186|gb|EFY60384.1| phosphoglucosamine mutase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 81038-01]
 gi|322667469|gb|EFY63631.1| phosphoglucosamine mutase [Salmonella enterica subsp. enterica
           serovar Montevideo str. MD_MDA09249507]
 gi|322674717|gb|EFY70809.1| phosphoglucosamine mutase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 414877]
 gi|322675650|gb|EFY71723.1| phosphoglucosamine mutase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 366867]
 gi|322682286|gb|EFY78309.1| phosphoglucosamine mutase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 413180]
 gi|322684889|gb|EFY80887.1| phosphoglucosamine mutase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 446600]
 gi|323191864|gb|EFZ77112.1| phosphoglucosamine mutase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 609458-1]
 gi|323199023|gb|EFZ84120.1| phosphoglucosamine mutase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 556150-1]
 gi|323204277|gb|EFZ89286.1| phosphoglucosamine mutase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 609460]
 gi|323207624|gb|EFZ92571.1| phosphoglucosamine mutase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 507440-20]
 gi|323211323|gb|EFZ96167.1| phosphoglucosamine mutase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 556152]
 gi|323214735|gb|EFZ99484.1| phosphoglucosamine mutase [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB101509-0077]
 gi|323221215|gb|EGA05641.1| phosphoglucosamine mutase [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB102109-0047]
 gi|323224044|gb|EGA08337.1| phosphoglucosamine mutase [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB110209-0055]
 gi|323230307|gb|EGA14426.1| phosphoglucosamine mutase [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB111609-0052]
 gi|323233283|gb|EGA17377.1| phosphoglucosamine mutase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 2009083312]
 gi|323239320|gb|EGA23370.1| phosphoglucosamine mutase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 2009085258]
 gi|323242429|gb|EGA26455.1| phosphoglucosamine mutase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 315731156]
 gi|323246939|gb|EGA30905.1| phosphoglucosamine mutase [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2009159199]
 gi|323254128|gb|EGA37948.1| phosphoglucosamine mutase [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008282]
 gi|323255245|gb|EGA39022.1| phosphoglucosamine mutase [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008283]
 gi|323262708|gb|EGA46264.1| phosphoglucosamine mutase [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008284]
 gi|323264018|gb|EGA47526.1| phosphoglucosamine mutase [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008285]
 gi|323269404|gb|EGA52859.1| phosphoglucosamine mutase [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008287]
          Length = 445

 Score =  396 bits (1018), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 211/448 (47%), Positives = 301/448 (67%), Gaps = 10/448 (2%)

Query: 3   RRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSL 62
           R++FGTDGIRG+    PITP+F++++G A G +   +   R+++IGKDTR+SGYMLE++L
Sbjct: 4   RKYFGTDGIRGRVGNAPITPDFVLKLGWAAGKVL-ARHGSRKIIIGKDTRISGYMLESAL 62

Query: 63  VAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVS 122
            AG  AAG+ A   GP+P+PAVA LTR+ RA+ G++ISASHNP+ DNGIK F  DG K+ 
Sbjct: 63  EAGLAAAGLSASFTGPMPTPAVAYLTRTFRAEAGIVISASHNPFYDNGIKFFSIDGTKLP 122

Query: 123 TDIEDRIETLLEDDLTSYLSCYDS--IGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
            D+E+ IE  +E ++T    C DS  +G A R+     RYIE  K T P +++L GL++V
Sbjct: 123 DDVEEAIEAEMEKEIT----CVDSAELGKASRIVDAAGRYIEFCKGTFPNELSLNGLKVV 178

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           VDCANGA+Y +AP V  ELGA V+ IG +PNG+NIN + G+T+V +LQ +V   +AD+GI
Sbjct: 179 VDCANGATYHIAPNVLRELGATVIAIGCEPNGVNINEEVGATDVRALQARVLAEKADLGI 238

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           ALDGDGDRVI+VD +G  V+GDQIM +IARE +    LRG G V T+MSN+GLE  +  L
Sbjct: 239 ALDGDGDRVIMVDHEGNKVDGDQIMYIIAREGLRQGQLRG-GAVGTLMSNMGLELALKQL 297

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           G+   R +VGDRY++E ++  G+ +G E SGH+IL D  +TGDG+VA LQVL  + +   
Sbjct: 298 GIPFARAKVGDRYVLEKLQEKGWRIGAENSGHVILLDKTTTGDGIVAGLQVLAAMVRNHM 357

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTS--ILNSSSIVQAIADAESELRGIDRLIVRASGTES 418
            +  +C   + +PQ L +V     S   L + ++    AD E+ L    R+++R SGTE 
Sbjct: 358 SLHDLCSGMKMFPQILVNVRYTAGSGDPLENEAVKTVTADVEATLGNRGRVLLRKSGTEP 417

Query: 419 LIRIMAEGDDLSRIKRIVDDLAKVIPMI 446
           LIR+M EG+D +++      +A  +  +
Sbjct: 418 LIRVMVEGEDEAQVTAFAHRIADAVKAV 445


>gi|52425022|ref|YP_088159.1| CpsG protein [Mannheimia succiniciproducens MBEL55E]
 gi|81609563|sp|Q65TY6|GLMM_MANSM RecName: Full=Phosphoglucosamine mutase
 gi|52307074|gb|AAU37574.1| CpsG protein [Mannheimia succiniciproducens MBEL55E]
          Length = 444

 Score =  396 bits (1018), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 206/445 (46%), Positives = 301/445 (67%), Gaps = 9/445 (2%)

Query: 2   KRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENS 61
           +R++FGTDG+RGK  TFPITP+F +++G A G +    +  R+V+IGKDTR+SGYMLE++
Sbjct: 3   ERKYFGTDGVRGKVGTFPITPDFALKLGWAAGKVL-ASQGSRQVLIGKDTRISGYMLESA 61

Query: 62  LVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKV 121
           L AG  AAG+ A  +GP+P+PAVA LTR+ RA+ G++ISASHNPY DNGIK F   G K+
Sbjct: 62  LEAGLAAAGLSAAFIGPMPTPAVAYLTRTFRAEAGIVISASHNPYYDNGIKFFSAQGTKL 121

Query: 122 STDIEDRIETLLEDDLTSYLSCYDS--IGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRI 179
             +IE+ IE +LE  +     C +S  +G A R+     RYIE  K T P +++L G +I
Sbjct: 122 PDEIEEAIEAMLEQPI----DCVESAELGRASRIKDAAGRYIEFCKGTFPTELSLSGYKI 177

Query: 180 VVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIG 239
           VVDCANGA+Y +AP V  ELGA+V+ IG  PNG+NIN  CG+T++ +L+ KV E +AD+G
Sbjct: 178 VVDCANGATYHIAPNVMRELGAEVIEIGTSPNGMNINEKCGATDIKALKAKVLETKADVG 237

Query: 240 IALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAG 299
           +A DGDGDR+++VD  G +V+GDQI+ +IARE +    L+G G+V T+MSN+ LE  +  
Sbjct: 238 LAYDGDGDRIMMVDHLGNVVDGDQILFIIAREDLRAGKLKG-GVVGTLMSNMSLEISLKT 296

Query: 300 LGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYD 359
           LG+   R  VGDRY++E M  N + +GGE SGHII++D  +TGDG++A+L VL  + Q+ 
Sbjct: 297 LGIPFIRANVGDRYVLEKMVENDWKLGGENSGHIIIADKNTTGDGIIASLAVLTAMAQHK 356

Query: 360 KPVSTICHCFEEYPQFLRSVSVK-DTSILNSSSIVQAIADAESELRGIDRLIVRASGTES 418
             ++ +    + +PQ L +V     T+ L S ++    A+ E  L G  R+++R SGTE 
Sbjct: 357 LSLNELASAVKLFPQVLINVRFSGGTNPLESDAVKAVAAEVEKRLAGKGRILLRKSGTEP 416

Query: 419 LIRIMAEGDDLSRIKRIVDDLAKVI 443
           LIR+M E  D    ++  +++ + +
Sbjct: 417 LIRVMVECSDAELARKSAEEIVEAV 441


>gi|237751773|ref|ZP_04582253.1| phosphoglucosamine mutase [Helicobacter bilis ATCC 43879]
 gi|229373139|gb|EEO23530.1| phosphoglucosamine mutase [Helicobacter bilis ATCC 43879]
          Length = 444

 Score =  396 bits (1018), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 205/432 (47%), Positives = 283/432 (65%), Gaps = 6/432 (1%)

Query: 4   RFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSLV 63
           + FGTDG+RGK+    IT    +R+GIA G  F+      R+++GKDTR SGYM+EN+LV
Sbjct: 2   KIFGTDGVRGKAGV-DITAMVALRLGIAAGLYFQRDSIGNRILVGKDTRRSGYMVENALV 60

Query: 64  AGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVST 123
           +G TA GMD   +GP+P+PA+A LT  +R D G+MISASHNPY DNGIK F   G+K+  
Sbjct: 61  SGLTAVGMDVIQVGPMPTPAIAFLTEDMRCDAGIMISASHNPYFDNGIKFFDKYGFKLDE 120

Query: 124 DIEDRIETLLED-DLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVVD 182
             E  IE+L    DL  +      IG +KR+D V  RYI H+K + P+ +TLQG+RIV+D
Sbjct: 121 TKEQEIESLYHSKDLERHYKIGTEIGASKRIDDVIGRYIVHIKNSFPKHLTLQGVRIVLD 180

Query: 183 CANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIAL 242
           CANGA+YKVAP VF ELGADV+V+ D PNG NIN +CG+ +   L  +V  +RADIG  L
Sbjct: 181 CANGAAYKVAPSVFEELGADVIVLSDSPNGSNINENCGAMHPNVLADEVKRLRADIGFGL 240

Query: 243 DGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLGL 302
           DGD DR+I++D +G +V+GD+++  +A       LL  NGIV T+MSNI LE F+    +
Sbjct: 241 DGDADRLIVIDNEGNLVDGDKLIGALALYQKKKKLLHNNGIVATLMSNIALETFLRVHDI 300

Query: 303 SLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKPV 362
            L+R  VGD+Y+++ M   GFN GGEQSGHII SD+  TGDGLV+ALQV   + + +K  
Sbjct: 301 KLERCNVGDKYVLQAMLKCGFNFGGEQSGHIIFSDFAKTGDGLVSALQVAALVLESNKTS 360

Query: 363 STICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGID-RLIVRASGTESLIR 421
               + F   PQ   ++ +K    L+S   +Q + +   E+     R +VR SGTE+ IR
Sbjct: 361 KDALNPFALAPQKQSNLQIKQKLPLDS---IQGLNEILKEIESHKIRHLVRYSGTENKIR 417

Query: 422 IMAEGDDLSRIK 433
           I+ EG+D ++++
Sbjct: 418 ILLEGNDEAKLE 429


>gi|16762056|ref|NP_457673.1| phosphoglucosamine mutase [Salmonella enterica subsp. enterica
           serovar Typhi str. CT18]
 gi|16766590|ref|NP_462205.1| phosphoglucosamine mutase [Salmonella enterica subsp. enterica
           serovar Typhimurium str. LT2]
 gi|29143545|ref|NP_806887.1| phosphoglucosamine mutase [Salmonella enterica subsp. enterica
           serovar Typhi str. Ty2]
 gi|161616300|ref|YP_001590265.1| phosphoglucosamine mutase [Salmonella enterica subsp. enterica
           serovar Paratyphi B str. SPB7]
 gi|167990143|ref|ZP_02571243.1| phosphoglucosamine mutase [Salmonella enterica subsp. enterica
           serovar 4,[5],12:i:- str. CVM23701]
 gi|168231901|ref|ZP_02656959.1| phosphoglucosamine mutase [Salmonella enterica subsp. enterica
           serovar Kentucky str. CDC 191]
 gi|168237992|ref|ZP_02663050.1| phosphoglucosamine mutase [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. SL480]
 gi|168243126|ref|ZP_02668058.1| phosphoglucosamine mutase [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL486]
 gi|168262697|ref|ZP_02684670.1| phosphoglucosamine mutase [Salmonella enterica subsp. enterica
           serovar Hadar str. RI_05P066]
 gi|168463485|ref|ZP_02697402.1| phosphoglucosamine mutase [Salmonella enterica subsp. enterica
           serovar Newport str. SL317]
 gi|168819640|ref|ZP_02831640.1| phosphoglucosamine mutase [Salmonella enterica subsp. enterica
           serovar Weltevreden str. HI_N05-537]
 gi|194444789|ref|YP_002042550.1| phosphoglucosamine mutase [Salmonella enterica subsp. enterica
           serovar Newport str. SL254]
 gi|194450018|ref|YP_002047321.1| phosphoglucosamine mutase [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL476]
 gi|194472727|ref|ZP_03078711.1| phosphoglucosamine mutase [Salmonella enterica subsp. enterica
           serovar Kentucky str. CVM29188]
 gi|194735714|ref|YP_002116241.1| phosphoglucosamine mutase [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. CVM19633]
 gi|197251794|ref|YP_002148218.1| phosphoglucosamine mutase [Salmonella enterica subsp. enterica
           serovar Agona str. SL483]
 gi|197261662|ref|ZP_03161736.1| phosphoglucosamine mutase [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA23]
 gi|198245673|ref|YP_002217265.1| phosphoglucosamine mutase [Salmonella enterica subsp. enterica
           serovar Dublin str. CT_02021853]
 gi|200388140|ref|ZP_03214752.1| phosphoglucosamine mutase [Salmonella enterica subsp. enterica
           serovar Virchow str. SL491]
 gi|205354195|ref|YP_002227996.1| phosphoglucosamine mutase [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 287/91]
 gi|207858542|ref|YP_002245193.1| phosphoglucosamine mutase [Salmonella enterica subsp. enterica
           serovar Enteritidis str. P125109]
 gi|213052986|ref|ZP_03345864.1| phosphoglucosamine mutase [Salmonella enterica subsp. enterica
           serovar Typhi str. E00-7866]
 gi|213425428|ref|ZP_03358178.1| phosphoglucosamine mutase [Salmonella enterica subsp. enterica
           serovar Typhi str. E02-1180]
 gi|213622800|ref|ZP_03375583.1| phosphoglucosamine mutase [Salmonella enterica subsp. enterica
           serovar Typhi str. E98-2068]
 gi|213645863|ref|ZP_03375916.1| phosphoglucosamine mutase [Salmonella enterica subsp. enterica
           serovar Typhi str. J185]
 gi|213865087|ref|ZP_03387206.1| phosphoglucosamine mutase [Salmonella enterica subsp. enterica
           serovar Typhi str. M223]
 gi|238910087|ref|ZP_04653924.1| phosphoglucosamine mutase [Salmonella enterica subsp. enterica
           serovar Tennessee str. CDC07-0191]
 gi|81416216|sp|Q7CPP9|GLMM_SALTY RecName: Full=Phosphoglucosamine mutase
 gi|81499439|sp|Q8XF81|GLMM_SALTI RecName: Full=Phosphoglucosamine mutase
 gi|189040794|sp|A9N740|GLMM_SALPB RecName: Full=Phosphoglucosamine mutase
 gi|226723912|sp|B5F6U4|GLMM_SALA4 RecName: Full=Phosphoglucosamine mutase
 gi|226723913|sp|B5FI19|GLMM_SALDC RecName: Full=Phosphoglucosamine mutase
 gi|226723914|sp|B5QZW4|GLMM_SALEP RecName: Full=Phosphoglucosamine mutase
 gi|226723915|sp|B5REP2|GLMM_SALG2 RecName: Full=Phosphoglucosamine mutase
 gi|226723916|sp|B4TJ12|GLMM_SALHS RecName: Full=Phosphoglucosamine mutase
 gi|226723917|sp|B4T705|GLMM_SALNS RecName: Full=Phosphoglucosamine mutase
 gi|226723919|sp|B4TWE3|GLMM_SALSV RecName: Full=Phosphoglucosamine mutase
 gi|25317815|pir||AE0902 PGM/PMM-family protein [imported] - Salmonella enterica subsp.
           enterica serovar Typhi (strain CT18)
 gi|16421852|gb|AAL22164.1| phosphoglucosamine mutase [Salmonella enterica subsp. enterica
           serovar Typhimurium str. LT2]
 gi|16504359|emb|CAD07811.1| PGM/PMM-family protein [Salmonella enterica subsp. enterica serovar
           Typhi]
 gi|29139179|gb|AAO70747.1| PGM/PMM-family protein [Salmonella enterica subsp. enterica serovar
           Typhi str. Ty2]
 gi|161365664|gb|ABX69432.1| hypothetical protein SPAB_04108 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|194403452|gb|ACF63674.1| phosphoglucosamine mutase [Salmonella enterica subsp. enterica
           serovar Newport str. SL254]
 gi|194408322|gb|ACF68541.1| phosphoglucosamine mutase [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL476]
 gi|194459091|gb|EDX47930.1| phosphoglucosamine mutase [Salmonella enterica subsp. enterica
           serovar Kentucky str. CVM29188]
 gi|194711216|gb|ACF90437.1| phosphoglucosamine mutase [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. CVM19633]
 gi|195633359|gb|EDX51773.1| phosphoglucosamine mutase [Salmonella enterica subsp. enterica
           serovar Newport str. SL317]
 gi|197215497|gb|ACH52894.1| phosphoglucosamine mutase [Salmonella enterica subsp. enterica
           serovar Agona str. SL483]
 gi|197239917|gb|EDY22537.1| phosphoglucosamine mutase [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA23]
 gi|197289095|gb|EDY28464.1| phosphoglucosamine mutase [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. SL480]
 gi|197940189|gb|ACH77522.1| phosphoglucosamine mutase [Salmonella enterica subsp. enterica
           serovar Dublin str. CT_02021853]
 gi|199605238|gb|EDZ03783.1| phosphoglucosamine mutase [Salmonella enterica subsp. enterica
           serovar Virchow str. SL491]
 gi|205273976|emb|CAR38982.1| PGM/PMM-family protein [Salmonella enterica subsp. enterica serovar
           Gallinarum str. 287/91]
 gi|205331079|gb|EDZ17843.1| phosphoglucosamine mutase [Salmonella enterica subsp. enterica
           serovar 4,[5],12:i:- str. CVM23701]
 gi|205333884|gb|EDZ20648.1| phosphoglucosamine mutase [Salmonella enterica subsp. enterica
           serovar Kentucky str. CDC 191]
 gi|205337804|gb|EDZ24568.1| phosphoglucosamine mutase [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL486]
 gi|205343376|gb|EDZ30140.1| phosphoglucosamine mutase [Salmonella enterica subsp. enterica
           serovar Weltevreden str. HI_N05-537]
 gi|205348399|gb|EDZ35030.1| phosphoglucosamine mutase [Salmonella enterica subsp. enterica
           serovar Hadar str. RI_05P066]
 gi|206710345|emb|CAR34703.1| PGM/PMM-family protein [Salmonella enterica subsp. enterica serovar
           Enteritidis str. P125109]
 gi|261248458|emb|CBG26295.1| PGM/PMM-family protein [Salmonella enterica subsp. enterica serovar
           Typhimurium str. D23580]
 gi|267995489|gb|ACY90374.1| phosphoglucosamine mutase [Salmonella enterica subsp. enterica
           serovar Typhimurium str. 14028S]
 gi|301159842|emb|CBW19361.1| PGM/PMM-family protein [Salmonella enterica subsp. enterica serovar
           Typhimurium str. SL1344]
 gi|312914318|dbj|BAJ38292.1| phosphoglucosamine mutase [Salmonella enterica subsp. enterica
           serovar Typhimurium str. T000240]
 gi|320087738|emb|CBY97502.1| probable phosphoglucomutase/phosphomannomutase [Salmonella enterica
           subsp. enterica serovar Weltevreden str. 2007-60-3289-1]
 gi|321225976|gb|EFX51030.1| Phosphoglucosamine mutase [Salmonella enterica subsp. enterica
           serovar Typhimurium str. TN061786]
 gi|323131652|gb|ADX19082.1| phosphoglucosamine mutase [Salmonella enterica subsp. enterica
           serovar Typhimurium str. 4/74]
 gi|326625043|gb|EGE31388.1| phosphoglucosamine mutase [Salmonella enterica subsp. enterica
           serovar Dublin str. 3246]
 gi|326629316|gb|EGE35659.1| phosphoglucosamine mutase [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 9]
 gi|332990150|gb|AEF09133.1| phosphoglucosamine mutase [Salmonella enterica subsp. enterica
           serovar Typhimurium str. UK-1]
          Length = 445

 Score =  396 bits (1018), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 211/448 (47%), Positives = 301/448 (67%), Gaps = 10/448 (2%)

Query: 3   RRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSL 62
           R++FGTDGIRG+    PITP+F++++G A G +   +   R+++IGKDTR+SGYMLE++L
Sbjct: 4   RKYFGTDGIRGRVGNAPITPDFVLKLGWAAGKVL-ARHGSRKIIIGKDTRISGYMLESAL 62

Query: 63  VAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVS 122
            AG  AAG+ A   GP+P+PAVA LTR+ RA+ G++ISASHNP+ DNGIK F  DG K+ 
Sbjct: 63  EAGLAAAGLSASFTGPMPTPAVAYLTRTFRAEAGIVISASHNPFYDNGIKFFSIDGTKLP 122

Query: 123 TDIEDRIETLLEDDLTSYLSCYDS--IGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
            D+E+ IE  +E ++T    C DS  +G A R+     RYIE  K T P +++L GL++V
Sbjct: 123 DDVEEAIEAEMEKEIT----CVDSAELGKASRIVDAAGRYIEFCKGTFPNELSLNGLKVV 178

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           VDCANGA+Y +AP V  ELGA V+ IG +PNG+NIN + G+T+V +LQ +V   +AD+GI
Sbjct: 179 VDCANGATYHIAPNVLRELGATVIAIGCEPNGVNINEEVGATDVRALQARVLAEKADLGI 238

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           ALDGDGDRVI+VD +G  V+GDQIM +IARE +    LRG G V T+MSN+GLE  +  L
Sbjct: 239 ALDGDGDRVIMVDHEGNKVDGDQIMYIIAREGLRQGQLRG-GAVGTLMSNMGLELALKQL 297

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           G+   R +VGDRY++E ++  G+ +G E SGH+IL D  +TGDG+VA LQVL  + +   
Sbjct: 298 GIPFARAKVGDRYVLEKLQEKGWRIGAENSGHVILLDKTTTGDGIVAGLQVLAAMVRNHM 357

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTS--ILNSSSIVQAIADAESELRGIDRLIVRASGTES 418
            +  +C   + +PQ L +V     S   L + ++    AD E+ L    R+++R SGTE 
Sbjct: 358 SLHDLCSGMKMFPQILVNVRYTAGSGDPLENEAVKAVTADVEATLGNRGRVLLRKSGTEP 417

Query: 419 LIRIMAEGDDLSRIKRIVDDLAKVIPMI 446
           LIR+M EG+D +++      +A  +  +
Sbjct: 418 LIRVMVEGEDEAQVTAFAHRIADAVKAV 445


>gi|89072571|ref|ZP_01159143.1| phosphoglucomutase/phosphomannomutase family protein MrsA
           [Photobacterium sp. SKA34]
 gi|89051675|gb|EAR57128.1| phosphoglucomutase/phosphomannomutase family protein MrsA
           [Photobacterium sp. SKA34]
          Length = 445

 Score =  396 bits (1017), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 216/445 (48%), Positives = 301/445 (67%), Gaps = 9/445 (2%)

Query: 2   KRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENS 61
           +R+FFGTDGIRG     PITP+F+M++G A G +   +   ++V+IGKDTR+SGYMLE++
Sbjct: 3   ERKFFGTDGIRGLVGEAPITPDFVMKLGWAAGRVLS-QTGTKKVLIGKDTRISGYMLESA 61

Query: 62  LVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKV 121
           L AG  AAG+ A   GP+P+PAVA LTR+ RA+ G++ISASHNPY DNGIK F   G K+
Sbjct: 62  LEAGLAAAGLKAAFTGPMPTPAVAYLTRTFRAEAGIVISASHNPYYDNGIKFFSAKGTKL 121

Query: 122 STDIEDRIETLLEDDLTSYLSCYDS--IGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRI 179
             DIE  IE  +E  LT    C +S  +G A R+D    RYIE  K T P  ++L+G +I
Sbjct: 122 PDDIELAIEAEMEKPLT----CVESALLGKAYRIDDAAGRYIEFCKGTFPTHLSLEGFKI 177

Query: 180 VVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIG 239
           +VDCA+GA+Y +AP+VF ELGA+V+ IG +PNG+NIN   G+T+V +LQ KV E +AD G
Sbjct: 178 IVDCAHGATYHIAPKVFSELGAEVIAIGCEPNGVNINDKVGATDVAALQAKVLEEKADFG 237

Query: 240 IALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAG 299
           IALDGDGDRVI+VDE G  V+GDQI  +IAR+ +    L+G G+V T+M+N+G+E  +  
Sbjct: 238 IALDGDGDRVIMVDELGNKVDGDQIAYIIARDALRRGELKG-GVVGTLMTNMGMEVALKN 296

Query: 300 LGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYD 359
           LG+   R +VGDRY+ME ++ + + +G E SGH+IL D  +TGDG+VA LQV+  I    
Sbjct: 297 LGIPFVRAKVGDRYVMEELQKHDWLIGAENSGHVILLDKVTTGDGIVAGLQVMASIVASK 356

Query: 360 KPVSTICHCFEEYPQFLRSVSVKDTS-ILNSSSIVQAIADAESELRGIDRLIVRASGTES 418
             +  +C     +PQ L +V  K TS  L S +++ A    E +L    R+++R SGTE 
Sbjct: 357 MSLKELCDGMVMFPQVLENVRFKGTSDPLKSDAVITATKLVEEKLGDNGRVLLRKSGTEP 416

Query: 419 LIRIMAEGDDLSRIKRIVDDLAKVI 443
           LIR+M EG D + +++   D+AK +
Sbjct: 417 LIRVMVEGQDAADVQQYALDIAKAV 441


>gi|170765848|ref|ZP_02900659.1| phosphoglucosamine mutase [Escherichia albertii TW07627]
 gi|170124994|gb|EDS93925.1| phosphoglucosamine mutase [Escherichia albertii TW07627]
          Length = 445

 Score =  396 bits (1017), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 211/448 (47%), Positives = 300/448 (66%), Gaps = 10/448 (2%)

Query: 3   RRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSL 62
           R++FGTDGIRG+    PITP+F++++G A G +   +   R+++IGKDTR+SGYMLE++L
Sbjct: 4   RKYFGTDGIRGRVGDAPITPDFVLKLGWAAGKVL-ARHGSRKIIIGKDTRISGYMLESAL 62

Query: 63  VAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVS 122
            AG  AAG+ A   GP+P+PAVA LTR+ RA+ G++ISASHNP+ DNGIK F  DG K+ 
Sbjct: 63  EAGLAAAGLSALFTGPMPTPAVAYLTRTFRAEAGIVISASHNPFYDNGIKFFSIDGTKLP 122

Query: 123 TDIEDRIETLLEDDLTSYLSCYDS--IGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
             +E+ IE  +E ++    SC DS  +G A R+     RYIE  K T P +++L  L+IV
Sbjct: 123 DAVEEAIEAEMEKEI----SCVDSAELGKASRIVDAAGRYIEFCKATFPNELSLSELKIV 178

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           VDCANGA+Y +AP V  ELGA+V+ IG +PNG+NIN + G+T+V +LQ +V   +AD+GI
Sbjct: 179 VDCANGATYHIAPNVLRELGANVIAIGCEPNGVNINAEVGATDVRALQARVLAEKADLGI 238

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           A DGDGDRVI+VD +G  V+GDQIM +IARE +    LRG G+V T+MSN+GLE  +  L
Sbjct: 239 AFDGDGDRVIMVDHEGNKVDGDQIMYIIAREGLRQGQLRG-GVVGTLMSNMGLELALKQL 297

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           G+   R +VGDRY++E M+  G+ +G E SGH+IL D  +TGDG+VAALQVL  + +   
Sbjct: 298 GIPFARAKVGDRYVLEKMQEKGWRIGAENSGHVILLDKTTTGDGIVAALQVLAAMARNHM 357

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTS--ILNSSSIVQAIADAESELRGIDRLIVRASGTES 418
            +  +C   + +PQ L +V     S   L   S+    A+ E+ L    R+++R SGTE 
Sbjct: 358 SLHDLCSGMKMFPQILVNVRYTAGSGDPLEHESVKAVTAEVEAALGSRGRVLLRKSGTEP 417

Query: 419 LIRIMAEGDDLSRIKRIVDDLAKVIPMI 446
           LIR+M EG+D +++      +A  +  +
Sbjct: 418 LIRVMVEGEDEAQVTEFAHRIADAVKAV 445


>gi|50119648|ref|YP_048815.1| phosphoglucosamine mutase [Pectobacterium atrosepticum SCRI1043]
 gi|81646181|sp|Q6D9B6|GLMM_ERWCT RecName: Full=Phosphoglucosamine mutase
 gi|49610174|emb|CAG73614.1| phosphoglucosamine mutase [Pectobacterium atrosepticum SCRI1043]
          Length = 445

 Score =  396 bits (1017), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 215/447 (48%), Positives = 298/447 (66%), Gaps = 13/447 (2%)

Query: 3   RRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSL 62
           R++FGTDGIRGK    PITP+F++++G A G +   +   R+++IGKDTR+SGYMLE++L
Sbjct: 4   RKYFGTDGIRGKVGDTPITPDFVLKLGWAAGKVL-ARHGSRKIIIGKDTRISGYMLESAL 62

Query: 63  VAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVS 122
            AG  AAG+ A   GP+P+PAVA LTR+ RA+ G++ISASHNPY DNGIK F  DG K+ 
Sbjct: 63  EAGLAAAGLSASFTGPMPTPAVAYLTRTFRAEAGIVISASHNPYYDNGIKFFSIDGTKLP 122

Query: 123 TDIEDRIETLLEDDLTSYLSCYDS--IGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
            D+E+ IE  +E  LT    C +S  +G A R+     RYIE  K T P +++L GL+IV
Sbjct: 123 DDVEEAIEAEMEKPLT----CVESSELGKASRIVDAAGRYIEFCKGTFPGELSLNGLKIV 178

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           VDCANGA+Y +AP V  ELGA V+ IG +P+G+NIN +CG+T+V  LQ +V   +AD+G+
Sbjct: 179 VDCANGATYHIAPSVLRELGAKVIAIGCEPDGMNINEECGATDVRQLQARVLAEKADVGL 238

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           A DGDGDR+I+VD  G  V+GDQI+ +IARE +    LRG G V T+MSN+GLE  +  L
Sbjct: 239 AFDGDGDRLIMVDHLGNKVDGDQILYIIAREGLRQGQLRG-GAVGTLMSNMGLEVALKQL 297

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           G+   R +VGDRY++E M+  G+ +G E SGH+IL D  +TGDG++A LQVL  I +   
Sbjct: 298 GIPFARAKVGDRYVLEMMQTKGWRIGAENSGHVILLDKTTTGDGVIAGLQVLTAIVKNHM 357

Query: 361 PVSTICHCFEEYPQFLRSVSVK-DTSILNSSSIVQAIADAESELRGIDRLIVRASGTESL 419
            +  +C   + +PQ L +V    +   L   S+ Q   D E EL G  R+++R SGTE L
Sbjct: 358 SLHDLCSGMKLFPQILVNVRFTGENDPLEDKSVQQITQDVEKELAGRGRVLLRKSGTEPL 417

Query: 420 IRIMAEGDD----LSRIKRIVDDLAKV 442
           IR+M EG+     +++  RI D +  V
Sbjct: 418 IRVMVEGEHEETVIAQANRIADAVKAV 444


>gi|304409915|ref|ZP_07391534.1| phosphoglucosamine mutase [Shewanella baltica OS183]
 gi|304351324|gb|EFM15723.1| phosphoglucosamine mutase [Shewanella baltica OS183]
          Length = 450

 Score =  396 bits (1017), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 206/434 (47%), Positives = 288/434 (66%), Gaps = 8/434 (1%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M R++FGTDG+RGK   FPITP+F M++G A G +       + V+IGKDTR SGYMLE+
Sbjct: 1   MSRKYFGTDGVRGKVGEFPITPDFAMKLGWAAGTVLASSGT-KEVLIGKDTRSSGYMLES 59

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           ++ AGF+AAG++  ++GP+P+PAVA L  +  AD GV+ISASHNP+ DNGIK F   G K
Sbjct: 60  AIEAGFSAAGVNVALIGPMPTPAVAYLASTFHADAGVVISASHNPFYDNGIKFFSNSGTK 119

Query: 121 VSTDIEDRIETLLEDDLT-SYLSCYDS--IGHAKRVDGVHDRYIEHVKRTLPRDVTLQGL 177
           ++   E  IE LLE  L  + + C  S  +G  +R+D    RYIE  K T P  ++L GL
Sbjct: 120 LNDAQELEIEALLEKALNQNAMQCVSSEKLGKVRRIDDAAGRYIEFCKGTFPNHLSLAGL 179

Query: 178 RIVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRAD 237
           +IV+D A+GA+Y +AP V+ ELGA+V+ I DKPNG+NIN  CG+T++ SLQ  V    AD
Sbjct: 180 KIVIDSAHGAAYHIAPNVYRELGAEVISINDKPNGVNINDHCGATHLDSLQTAVMVHEAD 239

Query: 238 IGIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFI 297
           +GIALDGD DRV+ VD  G +V+GD+I+ ++A    S   + G G+V T+MSN+GLE  +
Sbjct: 240 LGIALDGDADRVMFVDHNGHVVDGDEILFILAHAAHSKGEMTG-GVVGTLMSNLGLELAL 298

Query: 298 AGLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQ 357
             + +   R +VGDRY++E +K  G+ +GGE SGHI+   + STGDG+VA+LQVL+ + +
Sbjct: 299 KQMDIPFVRAKVGDRYVVEQLKATGWQLGGEGSGHILSLQHASTGDGIVASLQVLKAVLE 358

Query: 358 YDKPVSTICHCFEEYPQFL---RSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRAS 414
           + K +S I     + PQ L   R  +    SIL +SS+ QA+  AE  L    R+++R S
Sbjct: 359 FQKSLSEIKAGMTKLPQVLINVRLATADADSILATSSVQQAVIKAEGILGDQGRVLLRKS 418

Query: 415 GTESLIRIMAEGDD 428
           GTE LIR+M E  D
Sbjct: 419 GTEPLIRVMVESTD 432


>gi|238899014|ref|YP_002924696.1| phosphoglucosamine mutase [Candidatus Hamiltonella defensa 5AT
           (Acyrthosiphon pisum)]
 gi|259647723|sp|C4K7K5|GLMM_HAMD5 RecName: Full=Phosphoglucosamine mutase
 gi|229466774|gb|ACQ68548.1| phosphoglucosamine mutase [Candidatus Hamiltonella defensa 5AT
           (Acyrthosiphon pisum)]
          Length = 447

 Score =  396 bits (1017), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 210/445 (47%), Positives = 298/445 (66%), Gaps = 10/445 (2%)

Query: 3   RRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSL 62
           R++FGTDGIRGK    PITP+F +++G A G +   ++  R+++IGKDTR+SGYMLE++L
Sbjct: 4   RKYFGTDGIRGKVGDMPITPDFFLKLGWAAGKIL-ARQDSRKIIIGKDTRISGYMLESAL 62

Query: 63  VAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVS 122
            AG  AAG  A + GP+P+PA+A LTR+ RA+ G++ISASHNP+ DNGIK F  +G K+S
Sbjct: 63  EAGLAAAGFSALLTGPMPTPAIAYLTRTFRAEAGIVISASHNPFYDNGIKFFDINGSKLS 122

Query: 123 TDIEDRIETLLEDDLTSYLSCYDS--IGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
             +E+ IE  LE  LT    C +S  +G A+R+     RYIE  K T P +  L+  +IV
Sbjct: 123 DSLEEAIEAQLEKPLT----CVESAQLGKARRIVDAAGRYIEFCKGTFPSEFNLKNFKIV 178

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           VDC+NGA+Y +AP V  ELGA V+ I  +PNG+NIN +CG+TN+  LQ+ V   +AD+GI
Sbjct: 179 VDCSNGATYHIAPSVLKELGATVISIACEPNGLNINKECGATNIGMLQKSVLAEQADLGI 238

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           ALDGDGDR+I+VD  G  V+GDQI+ LIA+E      L+G G+V T+MSN+GLE  +  L
Sbjct: 239 ALDGDGDRLIMVDHLGNKVDGDQIVYLIAKEACRQQQLKG-GVVGTLMSNMGLELALQRL 297

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
            +   R +VGDRY++E M+ +G+ +G E SGHIIL D  +TGDG++AALQV + I Q   
Sbjct: 298 KIPFIRAKVGDRYVLEKMQKHGYRIGAENSGHIILLDKTTTGDGMIAALQVFKVIIQNQM 357

Query: 361 PVSTICHCFEEYPQFLRSVSVK-DTSILNSSSIVQAIADAESELRGIDRLIVRASGTESL 419
            +  +C   +  PQ L + S   + ++L S +I   +   ES L G  R+++R SGTE +
Sbjct: 358 TLHELCSEIKLLPQVLVNFSFSGNKNVLQSDAIASLVKKVESTLAGRGRILLRTSGTEPV 417

Query: 420 IRIMAEGDDLSR-IKRIVDDLAKVI 443
           IR+M E D     IK + +++A+ I
Sbjct: 418 IRVMIEADQEEHFIKTLAEEVAEKI 442


>gi|218893844|ref|YP_002442713.1| phosphoglucosamine mutase [Pseudomonas aeruginosa LESB58]
 gi|254238515|ref|ZP_04931838.1| phosphoglucosamine mutase [Pseudomonas aeruginosa C3719]
 gi|254244349|ref|ZP_04937671.1| phosphoglucosamine mutase [Pseudomonas aeruginosa 2192]
 gi|226723905|sp|B7V1G1|GLMM_PSEA8 RecName: Full=Phosphoglucosamine mutase
 gi|126170446|gb|EAZ55957.1| phosphoglucosamine mutase [Pseudomonas aeruginosa C3719]
 gi|126197727|gb|EAZ61790.1| phosphoglucosamine mutase [Pseudomonas aeruginosa 2192]
 gi|218774072|emb|CAW29888.1| phosphoglucosamine mutase [Pseudomonas aeruginosa LESB58]
          Length = 445

 Score =  395 bits (1016), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 201/444 (45%), Positives = 292/444 (65%), Gaps = 5/444 (1%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M R++FGTDGIRG+   FPITP+F++++G AVG  FR ++ + RV+IGKDTR SGYM E+
Sbjct: 1   MSRKYFGTDGIRGRVGEFPITPDFVLKLGWAVGMAFR-RQGNCRVLIGKDTRSSGYMFES 59

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +  AG +A+G D  +LGP+P+P +A LTR+  A+ GV+ISASHNP+ DNGIK F   G K
Sbjct: 60  AFEAGLSASGADTLLLGPMPTPGIAYLTRTFHAEAGVVISASHNPHDDNGIKFFSGQGTK 119

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +  D+E  IE LL+  +T   S    +G   R++    RYIE  K ++P      GL++V
Sbjct: 120 LPDDVELMIEELLDAPMTVVESA--RLGKVSRINDAAGRYIEFCKSSVPTSTDFNGLKVV 177

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           +DCANGA+YK+AP VF ELGA+V V+   PNG+NIN  CGST++  LQ  V E  AD+GI
Sbjct: 178 LDCANGATYKIAPSVFRELGAEVTVLAASPNGLNINDKCGSTHLDGLQAAVVEHHADLGI 237

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           A DGDGDRV++VD  GA+V+GD+++ LIAR+      L+G G+V T+MSN+GLE  +  L
Sbjct: 238 AFDGDGDRVMMVDHTGAVVDGDELLFLIARDLQESGRLQG-GVVGTLMSNLGLELALQEL 296

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
            +   R +VGDRY+M  +    + +GGE SGHI+     +TGD ++AALQVL  +K   +
Sbjct: 297 HIPFVRAKVGDRYVMAELLARNWMLGGENSGHIVCCQNTTTGDAIIAALQVLMALKHRGQ 356

Query: 361 PVSTICHCFEEYPQFLRSVSVK-DTSILNSSSIVQAIADAESELRGIDRLIVRASGTESL 419
            ++       + PQ L +V  K ++  L   S+ +A      ++ G  R+++R SGTE L
Sbjct: 357 TLAEARQGIRKCPQVLINVRFKGESDPLEHPSVKEASVRVTEQMGGRGRVLLRKSGTEPL 416

Query: 420 IRIMAEGDDLSRIKRIVDDLAKVI 443
           +R+M EGD+ + ++   + LAK++
Sbjct: 417 VRVMVEGDEEASVRAHAEQLAKIV 440


>gi|119504345|ref|ZP_01626425.1| Phosphoglucomutase protein MrsA [marine gamma proteobacterium
           HTCC2080]
 gi|119459853|gb|EAW40948.1| Phosphoglucomutase protein MrsA [marine gamma proteobacterium
           HTCC2080]
          Length = 446

 Score =  395 bits (1016), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 215/449 (47%), Positives = 294/449 (65%), Gaps = 12/449 (2%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHR-RVVIGKDTRLSGYMLE 59
           M +++FGTDGIRG+    PITP FM+R+G A G +F  +   +  V+IGKDTR+SGYM E
Sbjct: 1   MNKKYFGTDGIRGRVGETPITPEFMLRLGWACGRVFSERSSEKVSVIIGKDTRVSGYMFE 60

Query: 60  NSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGY 119
           ++L AG  AAG +  +LGP+P+PA+AM+TRS  A VG++ISASHNPY DNGIK F   G 
Sbjct: 61  SALEAGLVAAGANVKLLGPLPTPAIAMMTRSQNAAVGIVISASHNPYYDNGIKFFSGLGA 120

Query: 120 KVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRI 179
           K+S ++E  IE  L+  + +  S    +G A R+     RYIE  K TLP   TL+GL  
Sbjct: 121 KLSDELELAIEAALDIPMQTVDSA--QLGKATRLSDAAGRYIEFCKATLPGQYTLKGLNF 178

Query: 180 VVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIG 239
           V+DCA+GA+Y VAP VF ELGA+V VIG +P+G NIN   GST    L ++V E  A+ G
Sbjct: 179 VLDCAHGATYNVAPAVFRELGANVTVIGAEPDGFNINQGVGSTATELLSQQVVETGANFG 238

Query: 240 IALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGN---GIVTTVMSNIGLERF 296
           IA DGDGDRV+ VD  G++V+GD ++ ++A     H L  G    G+V T MSN+GLE  
Sbjct: 239 IAFDGDGDRVLFVDADGSLVDGDALLYVLAM----HRLAVGQSDPGVVGTQMSNMGLEIA 294

Query: 297 IAGLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIK 356
           +   G+ L RT+VGDRY+ E M   G+ +GGE SGH+I  D  +TGDG+VAALQVL+ I 
Sbjct: 295 LGEQGVQLARTKVGDRYVRERMAAEGWQLGGESSGHLICGDVTTTGDGIVAALQVLKAIV 354

Query: 357 QYDKPVSTICHCFEEYPQFLRSVSVKDTSI-LNSSSIVQAIA-DAESELRGIDRLIVRAS 414
              + +S +    +  PQ + +V + +TS+ L   + V AI  + ES L+G  RL++R S
Sbjct: 355 ASGRSLSDLLSGMKCLPQVMINVPLPETSLDLTGDNPVSAICREVESALKGRGRLLLRPS 414

Query: 415 GTESLIRIMAEGDDLSRIKRIVDDLAKVI 443
           GTE +IR+M EGDD   IK++ + +A VI
Sbjct: 415 GTEPVIRVMVEGDDAVEIKQLAEQVAGVI 443


>gi|153001404|ref|YP_001367085.1| phosphoglucosamine mutase [Shewanella baltica OS185]
 gi|205830870|sp|A6WQD3|GLMM2_SHEB8 RecName: Full=Phosphoglucosamine mutase 2
 gi|151366022|gb|ABS09022.1| phosphoglucosamine mutase [Shewanella baltica OS185]
          Length = 450

 Score =  395 bits (1016), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 206/434 (47%), Positives = 289/434 (66%), Gaps = 8/434 (1%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M R++FGTDG+RGK   FPITP+F M++G A G +       + V+IGKDTR SGYMLE+
Sbjct: 1   MSRKYFGTDGVRGKVGEFPITPDFAMKLGWAAGTVL-ASTGTKEVLIGKDTRSSGYMLES 59

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           ++ AGF+AAG++  ++GP+P+PAVA L  + RAD GV+ISASHNP+ DNGIK F   G K
Sbjct: 60  AMEAGFSAAGVNVALIGPMPTPAVAYLASTFRADAGVVISASHNPFYDNGIKFFSNSGTK 119

Query: 121 VSTDIEDRIETLLEDDLT-SYLSCYDS--IGHAKRVDGVHDRYIEHVKRTLPRDVTLQGL 177
           ++   E  IE LLE  L  + + C  S  +G  +R+D    RYIE  K T P  ++L GL
Sbjct: 120 LNDAQELEIEALLEKALNQNAMQCVASEKLGKVRRIDDAAGRYIEFCKGTFPNHLSLAGL 179

Query: 178 RIVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRAD 237
           +IV+D A+GA+Y +AP V+ ELGA+V+ I DKPNG+NIN  CG+T++ SLQ  V    AD
Sbjct: 180 KIVIDSAHGAAYHIAPNVYRELGAEVISINDKPNGVNINDHCGATHLDSLQTAVMVHEAD 239

Query: 238 IGIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFI 297
           +GIALDGD DRV+ VD  G +V+GD+I+ ++A+   S   + G G+V T+MSN+GLE  +
Sbjct: 240 LGIALDGDADRVMFVDHNGHVVDGDEILFILAQAAHSKGEMTG-GVVGTLMSNLGLELAL 298

Query: 298 AGLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQ 357
             + +   R +VGDRY++E +K  G+ +GGE SGHI+   + STGDG+VA+LQVL+ + +
Sbjct: 299 KQMDIPFVRAKVGDRYVVEQLKRTGWQLGGEGSGHILSLQHASTGDGIVASLQVLKAVLE 358

Query: 358 YDKPVSTICHCFEEYPQFL---RSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRAS 414
             K +S I     + PQ L   R  +    SIL ++S+ QA+  AE  L    R+++R S
Sbjct: 359 SQKSLSEIKAGMTKLPQVLINVRLATADADSILATTSVKQAVIKAEEFLGDQGRVLLRKS 418

Query: 415 GTESLIRIMAEGDD 428
           GTE LIR+M E  D
Sbjct: 419 GTEPLIRVMVESTD 432


>gi|254283721|ref|ZP_04958689.1| phosphoglucosamine mutase [gamma proteobacterium NOR51-B]
 gi|219679924|gb|EED36273.1| phosphoglucosamine mutase [gamma proteobacterium NOR51-B]
          Length = 446

 Score =  395 bits (1016), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 216/448 (48%), Positives = 296/448 (66%), Gaps = 11/448 (2%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHR-RVVIGKDTRLSGYMLE 59
           MK+++FGTDGIRG+  T PI+P+FM+++G A G +F  + + +  V+IGKDTR+SGYM E
Sbjct: 1   MKKKYFGTDGIRGRVGTAPISPDFMLQLGWACGRVFADQWQGKPTVIIGKDTRVSGYMFE 60

Query: 60  NSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGY 119
           ++L AG  AAG D  +LGP+P+PAVA+LTRS  A  G++ISASHNP+ DNGIK F   G 
Sbjct: 61  SALEAGLVAAGADVRLLGPMPTPAVALLTRSQNAAAGIVISASHNPFYDNGIKFFCDKGA 120

Query: 120 KVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRI 179
           K+S + E  IE  LE  L +  S    +G A RV     RYIE  K TLP DV+L+GL+I
Sbjct: 121 KLSDETELAIEAALEMPLETVDS--RKLGKASRVVDAAGRYIEFCKSTLPEDVSLRGLKI 178

Query: 180 VVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIG 239
           V+DCANGA+Y +AP VF ELGA++ VIG  P+G NIN + GST   +L   V E  AD+G
Sbjct: 179 VLDCANGATYHIAPAVFAELGAEITVIGASPDGYNINHEFGSTAPDALIAAVIEAGADLG 238

Query: 240 IALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRG---NGIVTTVMSNIGLERF 296
           IA DGDGDRV+ VD  G++V+GD+++ ++A    +H ++ G   +G+V T+MSN+GLE  
Sbjct: 239 IAFDGDGDRVLFVDADGSVVDGDELLYVLA----THRVMTGRSDSGVVGTLMSNMGLELA 294

Query: 297 IAGLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIK 356
           +   GL L R  VGDRY+ E M   G+++GGE SGHII SD  +TGDG+V+ALQVL  I 
Sbjct: 295 LQEHGLKLARANVGDRYVREIMNAQGWHLGGESSGHIICSDVTTTGDGIVSALQVLAAIV 354

Query: 357 QYDKPVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQ-AIADAESELRGIDRLIVRASG 415
             +  +  +     + PQ L +V V + + L     VQ A A AE  L G  R+++R SG
Sbjct: 355 MTEMSLGELRGGMCKMPQVLVNVPVTNGAQLRDHPQVQAATAAAEKSLEGRGRVLLRPSG 414

Query: 416 TESLIRIMAEGDDLSRIKRIVDDLAKVI 443
           TE +IR+M EG+D   I ++   +A  I
Sbjct: 415 TEPVIRVMVEGEDQDTIHQLAHSMADTI 442


>gi|308048829|ref|YP_003912395.1| phosphoglucosamine mutase [Ferrimonas balearica DSM 9799]
 gi|307631019|gb|ADN75321.1| phosphoglucosamine mutase [Ferrimonas balearica DSM 9799]
          Length = 446

 Score =  395 bits (1016), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 197/451 (43%), Positives = 299/451 (66%), Gaps = 9/451 (1%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M R++FGTDG+RG    +PITP+F +++G A G +   +   R V+IGKDTR+SGY+LE+
Sbjct: 1   MSRKYFGTDGVRGLVGQYPITPDFALKLGYAAGQVMAAEGT-REVIIGKDTRISGYLLES 59

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           ++ +G  AAG++  + GP+P+PA+A L ++ RAD GV+ISASHNPY DNGIK F  +G K
Sbjct: 60  AMESGLIAAGVNVALTGPLPTPAIAYLAQTFRADAGVVISASHNPYHDNGIKFFSNNGTK 119

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDS--IGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLR 178
           ++    D  E  +E  L   + C DS  +G  +R+     RYIE  K T     +L+GL 
Sbjct: 120 LT----DANELAIEAALDQPMGCVDSANLGKVRRIHDAAGRYIEFCKSTFDHGASLEGLN 175

Query: 179 IVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADI 238
           IV+DCA+GA+Y +AP VF ELGA++ VIGDKPNG NIN  CG+T++ +L  KV  + AD+
Sbjct: 176 IVLDCAHGATYHIAPAVFRELGAEITVIGDKPNGTNINDHCGATHLDALVDKVLTIGADM 235

Query: 239 GIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIA 298
           GIA DGDGDRV++VD  GA+V+GD+I+ +IAR W +   + G G+V T+M+N+GLE  + 
Sbjct: 236 GIAFDGDGDRVMMVDHTGAVVDGDEILYIIARHWQATGQMEG-GVVGTLMANLGLELALK 294

Query: 299 GLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQY 358
            L +   R++VGDRY++E +   G+ +GGE SGHI+   + STGDG++AALQVL  ++  
Sbjct: 295 ALDIPFARSKVGDRYVVEMLNEKGWMLGGENSGHILSLKHHSTGDGIIAALQVLNALRYL 354

Query: 359 DKPVSTICHCFEEYPQFLRSVSVK-DTSILNSSSIVQAIADAESELRGIDRLIVRASGTE 417
           D+ ++       + PQ L +V    +++ L   +++  +A  E+E+    R+++R SGTE
Sbjct: 355 DQSLADARSGMTKLPQVLINVRFSGNSAPLEHETVLAEVAAVEAEMGDKGRVLLRKSGTE 414

Query: 418 SLIRIMAEGDDLSRIKRIVDDLAKVIPMIDS 448
            LIR+M EGD+   ++ +   +A  +  +D+
Sbjct: 415 PLIRVMVEGDNSLDVRGLAQRIADAVQAVDA 445


>gi|330443815|ref|YP_004376801.1| phosphoglucosamine mutase [Chlamydophila pecorum E58]
 gi|328806925|gb|AEB41098.1| phosphoglucosamine mutase [Chlamydophila pecorum E58]
          Length = 458

 Score =  395 bits (1016), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 204/445 (45%), Positives = 300/445 (67%), Gaps = 2/445 (0%)

Query: 3   RRFFGTDGIRGKSNTFPITPNFMMRIGIAV-GYLFRGKKKHRRVVIGKDTRLSGYMLENS 61
           ++ FGTDG+RG++N  P+T   ++ +G AV G L   +    RVVIGKDTRLSGYM E++
Sbjct: 6   KQLFGTDGVRGRANFEPMTIETIVLLGKAVAGVLLEERPGKHRVVIGKDTRLSGYMFESA 65

Query: 62  LVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKV 121
           L+AG T+ G++  +LGPIP+P VA +TR+ RAD G+MISASHNPY DNGIK+F  +G+K+
Sbjct: 66  LIAGLTSMGVETLVLGPIPTPGVAFITRAYRADAGIMISASHNPYWDNGIKIFSSEGFKI 125

Query: 122 STDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVV 181
           S  +E RIE ++ +     L    ++G  KRV     RYIE  K T P+  TL+GL+IV+
Sbjct: 126 SDAVETRIEAMVREFTFGNLPEDHAVGKNKRVVDAMGRYIEFAKATFPKGKTLKGLKIVL 185

Query: 182 DCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIA 241
           DCA+GA+YKVAP VF EL A+V+  G +P G+NIN +CG+     +Q+ V E +A +GIA
Sbjct: 186 DCAHGAAYKVAPSVFEELDAEVLCYGCEPTGVNINENCGALFPSVIQKAVIEHQAHLGIA 245

Query: 242 LDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLG 301
           LDGDGDR+I+VDEKG IV+GD I+++ A +    S LR N +V TVM+N G+ +++    
Sbjct: 246 LDGDGDRIIMVDEKGHIVDGDMILSICAHDLKRKSQLRRNRVVATVMTNFGVLKYLESQD 305

Query: 302 LSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKP 361
           + +  + VGDR++++ M  N  ++GGEQSGH+I  DY +TGDG+V+ALQVLR + + +  
Sbjct: 306 IDVLISPVGDRHVLQSMLENEASLGGEQSGHMIFLDYNTTGDGIVSALQVLRIMIESEST 365

Query: 362 VSTICHCFEEYPQFLRSVSVKDTSIL-NSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
           +S +     + PQ L +VSV++   L N  SI +A+ D +S L    R+++R SGTE++ 
Sbjct: 366 LSDLTSAIVKSPQALINVSVREKLPLDNFPSIQEALRDIQSTLGSSGRILLRYSGTENIC 425

Query: 421 RIMAEGDDLSRIKRIVDDLAKVIPM 445
           R+M EG    ++  +   LA +I +
Sbjct: 426 RVMVEGLKKHQVDCLAKTLADIITL 450


>gi|15599943|ref|NP_253437.1| phosphoglucosamine mutase [Pseudomonas aeruginosa PAO1]
 gi|116052896|ref|YP_793213.1| phosphoglucosamine mutase [Pseudomonas aeruginosa UCBPP-PA14]
 gi|296391576|ref|ZP_06881051.1| phosphoglucosamine mutase [Pseudomonas aeruginosa PAb1]
 gi|313109730|ref|ZP_07795670.1| phosphoglucosamine mutase [Pseudomonas aeruginosa 39016]
 gi|81622061|sp|Q9HV50|GLMM_PSEAE RecName: Full=Phosphoglucosamine mutase
 gi|122257093|sp|Q02FS3|GLMM_PSEAB RecName: Full=Phosphoglucosamine mutase
 gi|9951011|gb|AAG08135.1|AE004888_10 phosphoglucosamine mutase [Pseudomonas aeruginosa PAO1]
 gi|115588117|gb|ABJ14132.1| phosphoglucosamine mutase [Pseudomonas aeruginosa UCBPP-PA14]
 gi|310882172|gb|EFQ40766.1| phosphoglucosamine mutase [Pseudomonas aeruginosa 39016]
          Length = 445

 Score =  395 bits (1015), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 201/444 (45%), Positives = 291/444 (65%), Gaps = 5/444 (1%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M R++FGTDGIRG+   FPITP+F++++G AVG  FR ++ + RV+IGKDTR SGYM E+
Sbjct: 1   MSRKYFGTDGIRGRVGEFPITPDFVLKLGWAVGMAFR-RQGNCRVLIGKDTRSSGYMFES 59

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +  AG +A+G D  +LGP+P+P +A LTR+  A+ GV+ISASHNP+ DNGIK F   G K
Sbjct: 60  AFEAGLSASGADTLLLGPMPTPGIAYLTRTFHAEAGVVISASHNPHDDNGIKFFSGQGTK 119

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +  D+E  IE LL+  +T   S    +G   R++    RYIE  K ++P      GL++V
Sbjct: 120 LPDDVELMIEELLDAPMTVVESA--RLGKVSRINDAAGRYIEFCKSSVPTSTDFNGLKVV 177

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           +DCANGA+YK+AP VF ELGA+V V+   PNG+NIN  CGST++  LQ  V E  AD+GI
Sbjct: 178 LDCANGATYKIAPSVFRELGAEVTVLAASPNGLNINDKCGSTHLDGLQAAVVEHHADLGI 237

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           A DGDGDRV++VD  GA+V+GD+++ LIAR+      L+G G+V T+MSN+GLE  +  L
Sbjct: 238 AFDGDGDRVMMVDHTGAVVDGDELLFLIARDLQESGRLQG-GVVGTLMSNLGLELALQEL 296

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
            +   R +VGDRY+M  +    + +GGE SGHI+     +TGD ++AALQVL  +K   +
Sbjct: 297 HIPFVRAKVGDRYVMAELLARNWMLGGENSGHIVCCQNTTTGDAIIAALQVLMALKHRGQ 356

Query: 361 PVSTICHCFEEYPQFLRSVSVK-DTSILNSSSIVQAIADAESELRGIDRLIVRASGTESL 419
            ++       + PQ L +V  K +   L   S+ +A      ++ G  R+++R SGTE L
Sbjct: 357 TLAEARQGIRKCPQVLINVRFKGENDPLEHPSVKEASVRVTEQMGGRGRVLLRKSGTEPL 416

Query: 420 IRIMAEGDDLSRIKRIVDDLAKVI 443
           +R+M EGD+ + ++   + LAK++
Sbjct: 417 VRVMVEGDEEASVRAHAEQLAKIV 440


>gi|90416127|ref|ZP_01224059.1| phosphoglucosamine mutase [marine gamma proteobacterium HTCC2207]
 gi|90331852|gb|EAS47066.1| phosphoglucosamine mutase [marine gamma proteobacterium HTCC2207]
          Length = 451

 Score =  395 bits (1015), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 201/446 (45%), Positives = 301/446 (67%), Gaps = 7/446 (1%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVG-YLFRGKKKHRRVVIGKDTRLSGYMLE 59
           M R++FGTDGIRG+    PIT +F +++G A G  L R     +RV+IGKDTR+SGYM E
Sbjct: 1   MTRKYFGTDGIRGRVGEAPITADFFLKLGWAAGTVLTRNAVGKKRVLIGKDTRVSGYMFE 60

Query: 60  NSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGY 119
           ++L AG  AAG+D  +LGP+P+PA+A LTR+ RA  G++ISASHN  +DNGIK FG DGY
Sbjct: 61  SALEAGLIAAGVDVDMLGPMPTPAIAYLTRTFRAAAGIVISASHNAVEDNGIKFFGADGY 120

Query: 120 KVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRI 179
           K+  +IE  IE LL+  L +  S  + +G A+R+     RY+E  K +LP    L+G+++
Sbjct: 121 KLPDEIELEIEALLDQPLVTNGS--NDLGKARRIGDAAGRYVEFCKGSLPSGFNLRGMKV 178

Query: 180 VVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIG 239
           V+DCA+GA+Y V P+VF ELGA    +G++PNG NIN  CGST+ + L   V + +AD+G
Sbjct: 179 VLDCAHGATYDVGPKVFKELGATTTTMGNQPNGFNINDQCGSTHTVGLSAAVLDQQADLG 238

Query: 240 IALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRG-NGIVTTVMSNIGLERFIA 298
           IA DGDGDRV+ +D+KG +V+GD+++ +IA+    H    G NG+  T MSN+GLE  +A
Sbjct: 239 IAFDGDGDRVLFIDDKGDLVDGDELLFIIAQH--RHEFQGGCNGVAGTQMSNLGLELALA 296

Query: 299 GLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQY 358
            + +   RT+VGDRY++E MK + + +GGE SGH++ SD  +TGDG+V+ALQVLR +   
Sbjct: 297 DMNIPFVRTKVGDRYVVEAMKEHNWMLGGEGSGHVLCSDLNTTGDGIVSALQVLRAVVDS 356

Query: 359 DKPVSTICHCFEEYPQFLRSVSV-KDTSILNSSSIVQAIADAESELRGIDRLIVRASGTE 417
            K +  + +   + P  + +V + +   +    +I +A+A+AE +L G  R+++R SGTE
Sbjct: 357 GKSLRELKNGMSKLPMLMINVRLTQKIDLSGDEAINRAVAEAEEKLAGRGRVLLRTSGTE 416

Query: 418 SLIRIMAEGDDLSRIKRIVDDLAKVI 443
            LIR+M EG+D + ++     +A+++
Sbjct: 417 PLIRVMVEGEDSALVESSAAAIAEIV 442


>gi|259907038|ref|YP_002647394.1| phosphoglucosamine mutase [Erwinia pyrifoliae Ep1/96]
 gi|224962660|emb|CAX54115.1| Phosphoglucosamine mutase [Erwinia pyrifoliae Ep1/96]
 gi|283476834|emb|CAY72672.1| Phosphoglucosamine mutase [Erwinia pyrifoliae DSM 12163]
          Length = 444

 Score =  395 bits (1015), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 207/446 (46%), Positives = 300/446 (67%), Gaps = 5/446 (1%)

Query: 2   KRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENS 61
           +R++FGTDGIRGK    PITP+F++++G A G +   +   ++V+IGKDTR+SGYMLE++
Sbjct: 3   ERKYFGTDGIRGKVGESPITPDFVLKLGFAAGKVL-ARHGSKQVIIGKDTRISGYMLESA 61

Query: 62  LVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKV 121
           L AG  AAG+ A   GP+P+PAVA LTR+ RA+ G++ISASHNP+ DNGIK F  +G K+
Sbjct: 62  LEAGLAAAGLSAAFTGPMPTPAVAYLTRTFRAEAGIVISASHNPFDDNGIKFFSTEGTKL 121

Query: 122 STDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVV 181
             ++E  IE  +E  +T   S   ++G A R+     RYIE  K T P  ++L GL+IVV
Sbjct: 122 PDEVEAAIEAEMEKPITCVESA--ALGRASRIVDAAGRYIEFCKGTFPSQLSLNGLKIVV 179

Query: 182 DCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIA 241
           DCANGA+Y +AP V  ELGA V+ IGD+P+G+NIN  CG+T++  LQ +V   +AD+G+A
Sbjct: 180 DCANGATYHIAPNVLRELGATVIAIGDQPDGMNINKGCGATDLQLLQTRVLAEKADVGLA 239

Query: 242 LDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLG 301
            DGDGDR+++VD  G  V+GDQI+ LIARE +    LRG G+V T+MSNIGLE  +  LG
Sbjct: 240 YDGDGDRIMMVDHMGHKVDGDQILYLIAREGLRQGELRG-GVVGTLMSNIGLELALKQLG 298

Query: 302 LSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKP 361
           +   R +VGDRY++E +K  G+ +G E SGH+IL D  +TGDG+VA LQVL  + +    
Sbjct: 299 IPFARAKVGDRYVLEKLKEKGWRLGAENSGHVILLDKTTTGDGIVAGLQVLTAMVRNHMS 358

Query: 362 VSTICHCFEEYPQFLRSVSVKDTS-ILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
           +  +C   +  PQ L +V     +  L  + +    A+AE+EL+G  R+++R SGTE LI
Sbjct: 359 LHDLCSGMKLLPQILVNVRFNGVNDPLEDAQVKSVTAEAETELKGRGRVLLRKSGTEPLI 418

Query: 421 RIMAEGDDLSRIKRIVDDLAKVIPMI 446
           R+M EG++ +++  +   +A  +  +
Sbjct: 419 RVMVEGENEAQVSALAHRIADAVKAV 444


>gi|158705923|sp|A4VPP5|GLMM_PSEU5 RecName: Full=Phosphoglucosamine mutase
 gi|327482030|gb|AEA85340.1| Phosphoglucosamine mutase [Pseudomonas stutzeri DSM 4166]
          Length = 445

 Score =  395 bits (1015), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 203/444 (45%), Positives = 300/444 (67%), Gaps = 5/444 (1%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M R++FGTDGIRG     PITP+FM+++G A G  FR K+   R++IGKDTR+SGYM E+
Sbjct: 1   MTRKYFGTDGIRGHVGQAPITPDFMLKLGWAAGMAFR-KQGKCRILIGKDTRISGYMFES 59

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +L AG +AAG D  +LGP+P+PAVA LTR+  A+ G++ISASHNP+ DNGIK F   G K
Sbjct: 60  ALQAGLSAAGADVLLLGPMPTPAVAYLTRTFHAEAGIVISASHNPHHDNGIKFFSGRGTK 119

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +  ++E  IE L++  +T   S    +G A R++    RYIE  K ++P      GL++V
Sbjct: 120 LPDEVELMIEELIDTPMTVVESA--QLGKASRINDAAGRYIEFCKSSVPTSTDFSGLKLV 177

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           +DCA+GA+YKVAP VF ELGA+VVVIG +P+G+NIN D GST+V  LQ+ V E  AD+GI
Sbjct: 178 IDCAHGATYKVAPSVFRELGAEVVVIGAQPDGLNINADVGSTHVGQLQKAVVEHGADLGI 237

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           A DGDGDRV++VD  GA+V+GD+++ +IA +      L G G+V T+MSN+GLE  +   
Sbjct: 238 AFDGDGDRVMMVDHTGAVVDGDELLYIIATDLQERERLTG-GVVGTLMSNLGLELALKAR 296

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
            +   R +VGDRY++  M + G+ +GGE SGHI+ + + +TGD ++AALQV+  +++  +
Sbjct: 297 EIPFCRAKVGDRYVIAEMLDKGWVLGGENSGHIVCAQHTTTGDAIIAALQVVLALRRRGQ 356

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESE-LRGIDRLIVRASGTESL 419
            ++     + + PQ L +V         +   V+A  D+ +E + G  R+++R SGTE L
Sbjct: 357 TLAQERLAWHKCPQVLINVRFSGDRDPIAHPSVKAACDSVTERMGGRGRVLLRKSGTEPL 416

Query: 420 IRIMAEGDDLSRIKRIVDDLAKVI 443
           +R+M EGDD  +++ + ++LAKV+
Sbjct: 417 VRVMVEGDDEIQVRGMAEELAKVV 440


>gi|238918420|ref|YP_002931934.1| phosphoglucosamine mutase [Edwardsiella ictaluri 93-146]
 gi|259647719|sp|C5BFB3|GLMM_EDWI9 RecName: Full=Phosphoglucosamine mutase
 gi|238867988|gb|ACR67699.1| phosphoglucosamine mutase, putative [Edwardsiella ictaluri 93-146]
          Length = 445

 Score =  395 bits (1015), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 205/445 (46%), Positives = 299/445 (67%), Gaps = 9/445 (2%)

Query: 2   KRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENS 61
           +R++FGTDGIRGK  + PITP+F++++G A G +   +   R+++IGKDTR+SGYMLE++
Sbjct: 3   ERKYFGTDGIRGKVGSSPITPDFVLKLGWAAGKVL-ARHGSRKIIIGKDTRISGYMLESA 61

Query: 62  LVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKV 121
           L AG  AAG+ A   GP+P+PAVA LTR+ RA+ G++ISASHNPY DNGIK F  DG   
Sbjct: 62  LEAGLAAAGLSAAFTGPMPTPAVAYLTRTFRAEAGIVISASHNPYYDNGIKFFSIDG--- 118

Query: 122 STDIEDRIETLLEDDLTSYLSCYDS--IGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRI 179
            T + D +E  +E +L   L+C +S  +G A R+     RYIE  K T P  ++L GL+I
Sbjct: 119 -TKLPDEVEAAIEAELDKPLTCVESAELGKASRIVDAAGRYIEFCKSTFPNALSLSGLKI 177

Query: 180 VVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIG 239
           V DCANGA+Y +AP V  ELGA+V+ IG  P+G+NIN +CG+T+V +LQ +V    AD+G
Sbjct: 178 VADCANGATYHIAPNVLRELGAEVITIGTSPDGMNINKECGATDVRALQARVVAENADLG 237

Query: 240 IALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAG 299
           +A DGDGDR+I+VD +G  V+GDQI+ ++ARE +    L G G+V T+MSN+GLE  +  
Sbjct: 238 MAFDGDGDRLIMVDHRGDKVDGDQILYIVAREALRQGKLHG-GVVGTLMSNMGLELALKQ 296

Query: 300 LGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYD 359
           LG+   R +VGDRY++E M+  G+ +G E SGH+I+ D  +TGDG+VA LQVL  + +  
Sbjct: 297 LGIPFARAKVGDRYVLETMQEKGWRMGAENSGHVIILDQTTTGDGIVAGLQVLAAMARNH 356

Query: 360 KPVSTICHCFEEYPQFLRSVSVK-DTSILNSSSIVQAIADAESELRGIDRLIVRASGTES 418
             ++ +C      PQ L +V        L  +++  + A+ E +L G  R+++R SGTE 
Sbjct: 357 MSLTDLCSGMTLLPQVLVNVRFAGQCDPLQDTAVQHSCAEVERQLAGRGRVLLRKSGTEP 416

Query: 419 LIRIMAEGDDLSRIKRIVDDLAKVI 443
           LIR+M EG+DL ++  + + +A  +
Sbjct: 417 LIRVMVEGEDLQQVTDLANTIADAV 441


>gi|293393157|ref|ZP_06637472.1| phosphoglucosamine mutase [Serratia odorifera DSM 4582]
 gi|291424303|gb|EFE97517.1| phosphoglucosamine mutase [Serratia odorifera DSM 4582]
          Length = 445

 Score =  395 bits (1015), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 210/445 (47%), Positives = 301/445 (67%), Gaps = 9/445 (2%)

Query: 2   KRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENS 61
           +R++FGTDGIRGK    PITP+F++++G A G +   +   R+++IGKDTR+SGYMLE++
Sbjct: 3   ERKYFGTDGIRGKVGDSPITPDFVLKLGWAAGKVL-ARHGSRKIIIGKDTRISGYMLESA 61

Query: 62  LVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKV 121
           L AG  AAG+ A   GP+P+PA+A LTR+ RA+ G++ISASHNPY DNGIK F  DG K+
Sbjct: 62  LEAGLAAAGLSASFTGPMPTPAIAYLTRTFRAEAGIVISASHNPYYDNGIKFFSIDGAKL 121

Query: 122 STDIEDRIETLLEDDLTSYLSCYDS--IGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRI 179
              +E+ IE  +E  LT    C +S  +G A R+     RYIE  K T P +++L+GL+I
Sbjct: 122 PDHVEEAIEAEMEKPLT----CVESAELGKASRIIDAAGRYIEFCKGTFPSELSLKGLKI 177

Query: 180 VVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIG 239
           VVDCANGA+Y +AP V  ELGA+V+ IG +P+G+NIN  CG+T+V  LQ +V   +A +G
Sbjct: 178 VVDCANGATYHIAPSVLRELGANVIAIGCEPDGMNINEQCGATDVRQLQERVLAEKAHVG 237

Query: 240 IALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAG 299
           +A DGDGDRV++VD  G  V+GDQI+ +IARE +    LRG G V T+MSN+GLE  +  
Sbjct: 238 LAFDGDGDRVMMVDHLGNKVDGDQILYIIAREGLRQGQLRG-GAVGTLMSNMGLELALKQ 296

Query: 300 LGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYD 359
           LG+   R +VGDRY++E ++  G+ +G E SGH+IL D  +TGDG+VA LQVL  I + +
Sbjct: 297 LGIPFARAKVGDRYVLEKLQELGWRIGAENSGHVILLDKTTTGDGIVAGLQVLTAIVRNN 356

Query: 360 KPVSTICHCFEEYPQFLRSVSVK-DTSILNSSSIVQAIADAESELRGIDRLIVRASGTES 418
             +  +C   +  PQ L +V    + + L S S+ Q     E+EL G  R+++R SGTE 
Sbjct: 357 MSLHDLCSGMKLLPQILVNVRFTGEHNPLESESVRQVTEAVEAELAGRGRVLLRKSGTEP 416

Query: 419 LIRIMAEGDDLSRIKRIVDDLAKVI 443
           LIR+M EG+D  ++  + + +A+ +
Sbjct: 417 LIRVMVEGEDEQQVTELANRIAEAV 441


>gi|307302379|ref|ZP_07582137.1| phosphoglucosamine mutase [Shewanella baltica BA175]
 gi|306914417|gb|EFN44838.1| phosphoglucosamine mutase [Shewanella baltica BA175]
          Length = 450

 Score =  395 bits (1015), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 207/434 (47%), Positives = 287/434 (66%), Gaps = 8/434 (1%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M R++FGTDG+RGK   FPITP+F M++G A G +       + V+IGKDTR SGYMLE+
Sbjct: 1   MSRKYFGTDGVRGKVGEFPITPDFAMKLGWAAGTVL-ASSGTKEVLIGKDTRSSGYMLES 59

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           ++ AGF+AAG++  ++GP+P+PAVA L  + RAD GV+ISASHNP+ DNGIK F   G K
Sbjct: 60  AMEAGFSAAGVNVALIGPMPTPAVAYLASTFRADAGVVISASHNPFYDNGIKFFSNSGTK 119

Query: 121 VSTDIEDRIETLLEDDLT-SYLSCYDS--IGHAKRVDGVHDRYIEHVKRTLPRDVTLQGL 177
           ++   E  IE LLE  L  + + C  S  +G  +R+D    RYIE  K T P  ++L G 
Sbjct: 120 LNDAQELEIEALLEKALNQNAMQCVASEKLGKVRRIDDAAGRYIEFCKGTFPNHLSLTGF 179

Query: 178 RIVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRAD 237
           +IVVD A+GA+Y +AP V+ ELGA+V+ I DKPNG+NIN  CG+T++ SLQ  V    AD
Sbjct: 180 KIVVDSAHGAAYHIAPNVYRELGAEVISINDKPNGVNINDHCGATHLDSLQTAVMVHEAD 239

Query: 238 IGIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFI 297
           +GIALDGD DRV+ VD  G +V+GD+I+ ++A+   S   + G G+V T+MSN+GLE  +
Sbjct: 240 LGIALDGDADRVMFVDHNGHVVDGDEILFILAQAAHSKGEMTG-GVVGTLMSNLGLELAL 298

Query: 298 AGLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQ 357
             + +   R +VGDRY++E +K  G+ +GGE SGHI+   + STGDG+VA+LQVL+ + +
Sbjct: 299 KQMDIPFVRAKVGDRYVVEQLKATGWQLGGEGSGHILSLQHASTGDGIVASLQVLKAVLE 358

Query: 358 YDKPVSTICHCFEEYPQFL---RSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRAS 414
             K +S I     + PQ L   R  +    SIL  SS+ QA+  AE  L    R+++R S
Sbjct: 359 SQKSLSEIKAGMTKLPQVLINVRLATADADSILAKSSVQQAVIKAEGILGDQGRVLLRKS 418

Query: 415 GTESLIRIMAEGDD 428
           GTE LIR+M E  D
Sbjct: 419 GTEPLIRVMVESTD 432


>gi|197287226|ref|YP_002153098.1| phosphoglucosamine mutase [Proteus mirabilis HI4320]
 gi|227357079|ref|ZP_03841449.1| phosphoglucosamine mutase [Proteus mirabilis ATCC 29906]
 gi|226723904|sp|B4F2B5|GLMM_PROMH RecName: Full=Phosphoglucosamine mutase
 gi|194684713|emb|CAR46691.1| phosphoglucosamine mutase [Proteus mirabilis HI4320]
 gi|227162771|gb|EEI47734.1| phosphoglucosamine mutase [Proteus mirabilis ATCC 29906]
          Length = 445

 Score =  395 bits (1014), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 210/446 (47%), Positives = 300/446 (67%), Gaps = 5/446 (1%)

Query: 2   KRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENS 61
           +R++FGTDGIRGK    PITP+F++++G A G +   +   R+++IGKDTR+SGYMLE++
Sbjct: 3   ERKYFGTDGIRGKVGDSPITPDFVLKLGWAAGKVL-ARHGSRKIIIGKDTRISGYMLESA 61

Query: 62  LVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKV 121
           L AG  AAG+ A   GP+P+PAVA LTR+ RA+ G++ISASHNPY DNGIK F  DG K+
Sbjct: 62  LEAGLAAAGLSASFTGPMPTPAVAYLTRTFRAEAGIVISASHNPYYDNGIKFFSIDGTKL 121

Query: 122 STDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVV 181
             ++E+ IE  +E  +T   S    +G A R+     RYIE  K T P +  L GL++VV
Sbjct: 122 PDEVEEAIEAEMEKPITCVESA--ELGRANRIVDAAGRYIEFCKGTFPNENNLNGLKVVV 179

Query: 182 DCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIA 241
           DCA+GA+Y +AP VF ELGA+V+ IG +P GININ +CG+T+V  LQ++V E  AD+G+A
Sbjct: 180 DCAHGATYHIAPNVFRELGAEVITIGCEPTGININDECGATDVRMLQKRVLEEGADVGLA 239

Query: 242 LDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLG 301
            DGDGDR+I+VD KG  V+GDQI+ +IARE +    LRG G V T+MSN+GLE  +  LG
Sbjct: 240 FDGDGDRIIMVDHKGLKVDGDQILYIIAREALRQGQLRG-GAVGTLMSNMGLEIALKQLG 298

Query: 302 LSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKP 361
           +   R +VGDRY++E ++  G+ +G E SGHIIL D  +TGDG+VA LQVL  + +    
Sbjct: 299 IPFVRAKVGDRYVLEKLQEKGWRLGAENSGHIILLDKTTTGDGIVAGLQVLSAMVRNHMS 358

Query: 362 VSTICHCFEEYPQFLRSVSVK-DTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
           +  +C   +  PQ L +V    +   L S+ + Q   + E+EL G  R+++R SGTE LI
Sbjct: 359 LHDLCSGMKLLPQILVNVRFTGNHDPLQSTEVQQVAKEVEAELGGKGRVLLRKSGTEPLI 418

Query: 421 RIMAEGDDLSRIKRIVDDLAKVIPMI 446
           R+M EG++  ++  + + +A  +  +
Sbjct: 419 RVMVEGENEEQVTAMANRIADAVKHV 444


>gi|56415223|ref|YP_152298.1| phosphoglucosamine mutase [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. ATCC 9150]
 gi|197364153|ref|YP_002143790.1| phosphoglucosamine mutase [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. AKU_12601]
 gi|81361511|sp|Q5PLC4|GLMM_SALPA RecName: Full=Phosphoglucosamine mutase
 gi|226723918|sp|B5BGK0|GLMM_SALPK RecName: Full=Phosphoglucosamine mutase
 gi|56129480|gb|AAV78986.1| PGM/PMM-family protein [Salmonella enterica subsp. enterica serovar
           Paratyphi A str. ATCC 9150]
 gi|197095630|emb|CAR61198.1| PGM/PMM-family protein [Salmonella enterica subsp. enterica serovar
           Paratyphi A str. AKU_12601]
          Length = 445

 Score =  395 bits (1014), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 211/448 (47%), Positives = 301/448 (67%), Gaps = 10/448 (2%)

Query: 3   RRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSL 62
           R++FGTDGIRG+    PITP+F++++G A G +   +   R+++IGKDTR+SGYMLE++L
Sbjct: 4   RKYFGTDGIRGRVGNAPITPDFVLKLGWAAGKVL-ARHGSRKIIIGKDTRISGYMLESAL 62

Query: 63  VAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVS 122
            AG  AAG+ A   GP+P+PAVA LTR+ RA+ G++ISASHNP+ DNGIK F  DG K+ 
Sbjct: 63  EAGLAAAGLSASFTGPMPTPAVAYLTRTFRAEAGIVISASHNPFYDNGIKFFSIDGTKLP 122

Query: 123 TDIEDRIETLLEDDLTSYLSCYDS--IGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
            D+E+ IE  +E ++T    C DS  +G A R+     RYIE  K T P +++L GL++V
Sbjct: 123 DDVEEAIEAEMEKEIT----CVDSAELGKASRIVDAAGRYIEFCKGTFPNELSLNGLKVV 178

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           VDCANGA+Y +AP V  ELGA V+ IG +PNG+NIN + G+T+V +LQ +V   +AD+GI
Sbjct: 179 VDCANGATYHIAPNVLRELGATVIAIGCEPNGVNINEEVGATDVRALQARVLVEKADLGI 238

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           ALDGDGDRVI+VD +G  V+GDQIM +IARE +    LRG G V T+MSN+GLE  +  L
Sbjct: 239 ALDGDGDRVIMVDHEGNKVDGDQIMYIIAREGLRQGQLRG-GAVGTLMSNMGLELALKQL 297

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           G+   R +VGDRY++E ++  G+ +G E SGH+IL D  +TGDG+VA LQVL  + +   
Sbjct: 298 GIPFARAKVGDRYVLEKLQEKGWRIGAENSGHVILLDKTTTGDGIVAGLQVLAAMVRNHM 357

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTS--ILNSSSIVQAIADAESELRGIDRLIVRASGTES 418
            +  +C   + +PQ L +V     S   L + ++    AD E+ L    R+++R SGTE 
Sbjct: 358 SLHDLCSGMKMFPQILVNVRYTAGSGDPLENDAVKAVTADVEATLGNRGRVLLRKSGTEP 417

Query: 419 LIRIMAEGDDLSRIKRIVDDLAKVIPMI 446
           LIR+M EG+D +++      +A  +  +
Sbjct: 418 LIRVMVEGEDEAQVTAFAHRIADAVKAV 445


>gi|312963087|ref|ZP_07777572.1| Phosphoglucosamine mutase [Pseudomonas fluorescens WH6]
 gi|311282598|gb|EFQ61194.1| Phosphoglucosamine mutase [Pseudomonas fluorescens WH6]
          Length = 445

 Score =  395 bits (1014), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 198/444 (44%), Positives = 295/444 (66%), Gaps = 5/444 (1%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M +++FGTDGIRG+   +PITP+FM+++G A G  FR     R +++GKDTR+SGYM E+
Sbjct: 1   MTKKYFGTDGIRGRVGEYPITPDFMLKLGWAAGMAFRSMGACR-ILVGKDTRISGYMFES 59

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +L AG +AAG D  +LGP+P+PA+A LTR+  A+ G++ISASHNP+ DNGIK F   G K
Sbjct: 60  ALEAGLSAAGADVMLLGPMPTPAIAYLTRTFHAEAGIVISASHNPHDDNGIKFFSGQGTK 119

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +  +IE  IE LL+  +T   S    +G   R++    RYIE  K ++P   +  GL++V
Sbjct: 120 LPDEIELMIEELLDAPMTVVES--SKLGKVSRINDASGRYIEFCKSSVPSSTSFAGLKLV 177

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           VDCA+GA+YKVAP VF ELGA V V+  +PNG+NIN +CGST++  LQ  V    AD+GI
Sbjct: 178 VDCAHGATYKVAPSVFKELGAQVTVLSAQPNGLNINENCGSTHMEQLQAAVLAEHADLGI 237

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           A DGDGDRV++VD  GAIV+GD ++ +IAR+    + L+G G+V T+MSN+GLE  +A L
Sbjct: 238 AFDGDGDRVLMVDHTGAIVDGDDLLFIIARDMHERNKLQG-GVVGTLMSNLGLELALADL 296

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           G+   R  VGDRY++  +    + VGGE SGH++   + +TGD ++AALQVL  +++ ++
Sbjct: 297 GIPFVRANVGDRYVITELLERNWLVGGENSGHVVCFQHTTTGDAIIAALQVLMALRRRNE 356

Query: 361 PVSTICHCFEEYPQFLRSVSV-KDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESL 419
            ++       + PQ L +V      + ++  ++ +A       + G  R+++R SGTE L
Sbjct: 357 SLAQARQALRKCPQVLLNVRFGGGENPIDHPAVKEACERVTLAMAGRGRVLLRKSGTEPL 416

Query: 420 IRIMAEGDDLSRIKRIVDDLAKVI 443
           +R+M EGDD  +++   +DLAK++
Sbjct: 417 VRVMVEGDDEMQVRGHAEDLAKLV 440


>gi|292486832|ref|YP_003529702.1| phosphoglucosamine mutase [Erwinia amylovora CFBP1430]
 gi|292900770|ref|YP_003540139.1| phosphoglucosamine mutase [Erwinia amylovora ATCC 49946]
 gi|291200618|emb|CBJ47750.1| phosphoglucosamine mutase [Erwinia amylovora ATCC 49946]
 gi|291552249|emb|CBA19286.1| Phosphoglucosamine mutase [Erwinia amylovora CFBP1430]
 gi|312170900|emb|CBX79159.1| Phosphoglucosamine mutase [Erwinia amylovora ATCC BAA-2158]
          Length = 444

 Score =  394 bits (1013), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 206/446 (46%), Positives = 300/446 (67%), Gaps = 5/446 (1%)

Query: 2   KRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENS 61
           +R++FGTDGIRGK    PITP+F++++G A G +   +   ++V+IGKDTR+SGYMLE++
Sbjct: 3   ERKYFGTDGIRGKVGESPITPDFVLKLGFAAGKVL-ARHGSKQVIIGKDTRISGYMLESA 61

Query: 62  LVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKV 121
           L AG  AAG+ A   GP+P+PAVA LTR+ RA+ G++ISASHNP+ DNGIK F  +G K+
Sbjct: 62  LEAGLAAAGLSAAFTGPMPTPAVAYLTRTFRAEAGIVISASHNPFDDNGIKFFSTEGTKL 121

Query: 122 STDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVV 181
             ++E  IE  +E  +T   S   ++G A R+     RYIE  K T P  ++L GL+IVV
Sbjct: 122 PDEVEAAIEAEMEKPITCVESA--ALGRASRIVDAAGRYIEFCKGTFPSQLSLNGLKIVV 179

Query: 182 DCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIA 241
           DCANGA+Y +AP V  ELGA V+ IGD+P+G+NIN  CG+T++  LQ+ V   +AD+G+A
Sbjct: 180 DCANGATYHIAPNVLRELGATVIAIGDQPDGMNINKGCGATDLQLLQKHVLAEKADVGLA 239

Query: 242 LDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLG 301
            DGDGDR+++VD  G  V+GDQI+ LIARE +    LRG G+V T+MSN+GLE  +  LG
Sbjct: 240 YDGDGDRIMMVDHMGHKVDGDQILYLIAREGLRQGELRG-GVVGTLMSNMGLELALKQLG 298

Query: 302 LSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKP 361
           +   R +VGDRY++E +K  G+ +G E SGH+IL D  +TGDG+VA LQVL  + +    
Sbjct: 299 IPFARAKVGDRYVLEKLKEKGWRLGAENSGHVILLDKTTTGDGIVAGLQVLTAMVRNHMS 358

Query: 362 VSTICHCFEEYPQFLRSVSVKDTS-ILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
           +  +C   +  PQ L +V     +  L  + +    A+AE+EL+G  R+++R SGTE LI
Sbjct: 359 LHDLCSGMKLLPQILVNVRFSGANDPLEDAKVKAVTAEAETELKGRGRVLLRKSGTEPLI 418

Query: 421 RIMAEGDDLSRIKRIVDDLAKVIPMI 446
           R+M EG++ +++  +   +A  +  +
Sbjct: 419 RVMVEGENEAQVSALAHRIADAVKAV 444


>gi|145630771|ref|ZP_01786549.1| MrsA [Haemophilus influenzae R3021]
 gi|144983653|gb|EDJ91113.1| MrsA [Haemophilus influenzae R3021]
          Length = 445

 Score =  394 bits (1013), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 207/448 (46%), Positives = 300/448 (66%), Gaps = 9/448 (2%)

Query: 3   RRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSL 62
           R++FGTDG+RGK   +PITP+F +++G A G +    +  + V+IGKDTR+SGYMLE++L
Sbjct: 4   RKYFGTDGVRGKVGAYPITPDFALKLGWAAGKVL-ASQGSKMVLIGKDTRISGYMLESAL 62

Query: 63  VAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVS 122
            AG  AAG+ A   GP+P+PA+A LTR+ RA+ G++ISASHNPY DNGIK F   G K+ 
Sbjct: 63  EAGLAAAGLSAAFTGPMPTPAIAYLTRTFRAEAGIVISASHNPYYDNGIKFFSAKGTKLP 122

Query: 123 TDIEDRIETLLEDDLTSYLSCYDS--IGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
            +IE+ IE +LE  +     C +S  +G A R++    RYIE  K T P  + L+G +IV
Sbjct: 123 DEIEEAIEAMLEQPM----DCVESAELGKASRINDAAGRYIEFCKGTFPAHLGLEGYKIV 178

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           VDCANGA+Y +AP VF ELGA+V+ IG  PNG+NIN  CG+T+V +LQ KV E++AD+G+
Sbjct: 179 VDCANGATYHIAPNVFRELGAEVIEIGTGPNGLNINEKCGATDVTALQAKVVEMKADVGL 238

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           A DGDGDR+++VD  G  V+GDQI+ +IARE +    L+G G+V T+MSN+ LE  +  L
Sbjct: 239 AYDGDGDRIMMVDHLGNKVDGDQILFIIAREALRSGQLKG-GVVGTLMSNMSLEIALKML 297

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           G+   R  VGDRY++E M  N + +GGE SGHII++D  +TGDG+VA+L VL  + Q+  
Sbjct: 298 GVPFLRANVGDRYVLEKMVENDWTLGGENSGHIIIADKNTTGDGIVASLAVLAAMAQHKL 357

Query: 361 PVSTICHCFEEYPQFLRSVSVK-DTSILNSSSIVQAIADAESELRGIDRLIVRASGTESL 419
            ++ +    + +PQ L +V      + L S ++    A+ E  L G  R+++R SGTE L
Sbjct: 358 SLNELASAVKLFPQVLINVRFTGGENPLESDAVKSVAAEVEKRLEGKGRILLRKSGTEPL 417

Query: 420 IRIMAEGDDLSRIKRIVDDLAKVIPMID 447
           IR+M E  D    ++  +++A+ +  I+
Sbjct: 418 IRVMVECQDAELAQQCAEEIAEAVKKIN 445


>gi|309973143|gb|ADO96344.1| Phosphoglucosamine mutase [Haemophilus influenzae R2846]
          Length = 445

 Score =  394 bits (1013), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 207/448 (46%), Positives = 300/448 (66%), Gaps = 9/448 (2%)

Query: 3   RRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSL 62
           R++FGTDG+RGK  ++PITP+F +++G A G +    +  + V+IGKDTR+SGYMLE++L
Sbjct: 4   RKYFGTDGVRGKVGSYPITPDFALKLGWAAGKVL-ASQGSKMVLIGKDTRISGYMLESAL 62

Query: 63  VAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVS 122
            AG  AAG+ A   GP+P+PA+A LTR+ RA+ G++ISASHNPY DNGIK F   G K+ 
Sbjct: 63  EAGLAAAGLSAAFTGPMPTPAIAYLTRTFRAEAGIVISASHNPYYDNGIKFFSAKGTKLP 122

Query: 123 TDIEDRIETLLEDDLTSYLSCYDS--IGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
            +IE+ IE +LE  +     C +S  +G A R++    RYIE  K T P  + L+G +IV
Sbjct: 123 DEIEEAIEAMLEQPM----DCVESAELGKASRINDAAGRYIEFCKGTFPAHLGLEGYKIV 178

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           VDCANGA+Y +AP VF ELGA+V+ IG  PNG+NIN  CG+T+V +LQ KV E +AD+G+
Sbjct: 179 VDCANGATYHIAPNVFRELGAEVIEIGTDPNGLNINEKCGATDVTALQAKVVETKADVGL 238

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           A DGDGDR+++VD  G  V+GDQI+ +IARE +    L+G G+V T+MSN+ LE  +  L
Sbjct: 239 AYDGDGDRIMMVDHLGNKVDGDQILFIIAREALRSGQLKG-GVVGTLMSNMSLEIALKML 297

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           G+   R  VGDRY++E M  N + +GGE SGHII++D  +TGDG+VA+L VL  + Q+  
Sbjct: 298 GVPFLRANVGDRYVLEKMVENDWTLGGENSGHIIIADKNTTGDGIVASLAVLAAMAQHKL 357

Query: 361 PVSTICHCFEEYPQFLRSVSVK-DTSILNSSSIVQAIADAESELRGIDRLIVRASGTESL 419
            ++ +    + +PQ L +V      + L S ++    A+ E  L G  R+++R SGTE L
Sbjct: 358 SLNELASAVKLFPQVLINVRFAGGENPLESDAVKSVAAEVEKRLEGKGRILLRKSGTEPL 417

Query: 420 IRIMAEGDDLSRIKRIVDDLAKVIPMID 447
           IR+M E  D    ++  +++A+ +  I+
Sbjct: 418 IRVMVECQDAELAQQCAEEIAEAVKKIN 445


>gi|258543910|ref|ZP_05704144.1| phosphoglucosamine mutase [Cardiobacterium hominis ATCC 15826]
 gi|258520849|gb|EEV89708.1| phosphoglucosamine mutase [Cardiobacterium hominis ATCC 15826]
          Length = 448

 Score =  394 bits (1013), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 209/448 (46%), Positives = 292/448 (65%), Gaps = 16/448 (3%)

Query: 3   RRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYL-----FRGKKKHRRVVIGKDTRLSGYM 57
           R++FGTDG+RGK    P+TP+F+M +G A+G +     F G K    V+IGKDTR+SGYM
Sbjct: 6   RKYFGTDGVRGKVGVAPMTPDFVMHLGWAIGKMLSDSGFAGDK----VIIGKDTRISGYM 61

Query: 58  LENSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPD 117
           LEN++ AG +AAGMDA +LG +P+P +A  TR+  A  G+++SASHN Y DNGIK+F   
Sbjct: 62  LENAIAAGLSAAGMDAHLLGVMPTPGIAYFTRTFHAAAGIVVSASHNVYSDNGIKVFARG 121

Query: 118 GYKVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGL 177
           G K+    E  IE  LE  +    S    +G   R+     RYIE  K  +   +  + L
Sbjct: 122 GIKLPDAAEQEIERYLELPMKVVESA--QLGKLYRIPEARGRYIEFCKNAVMLGLPFERL 179

Query: 178 RIVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRAD 237
           +IVVDCANGA+Y +APEVF ELGA V+V+  +PNG NIN   GST   SLQR+V + +AD
Sbjct: 180 KIVVDCANGATYPIAPEVFRELGAQVIVMNAEPNGCNINAGAGSTAPESLQRRVRDEQAD 239

Query: 238 IGIALDGDGDRVIIVDEKGAIVNGDQIMALIA--REWMSHSLLRGNGIVTTVMSNIGLER 295
            GIA DGDGDRV++VD  G + +GD I+ +IA  R +    L   N IV T M+N+GLER
Sbjct: 240 AGIAFDGDGDRVVMVDRNGRLRDGDAILYIIAKYRAFKGEQL---NNIVGTKMTNLGLER 296

Query: 296 FIAGLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYI 355
            +  +G+ L RT+VGDRY++E M+     VGGE SGHII  D  STGDG++AALQVL  +
Sbjct: 297 ALNNMGIVLHRTDVGDRYVLECMQEINARVGGENSGHIICLDRNSTGDGIIAALQVLAAM 356

Query: 356 KQYDKPVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASG 415
            + ++P+  +    +   Q +++V V D +++N +++ QA+ +A  +L    R+++R SG
Sbjct: 357 LEMEQPLHQLVADLQMAVQVMKNVEVADKTVVNKTAVQQALQEATQKLGDAGRILLRPSG 416

Query: 416 TESLIRIMAEGDDLSRIKRIVDDLAKVI 443
           TE  IR+MAEG D +R+  IVD+LA VI
Sbjct: 417 TEPKIRVMAEGHDEARLHAIVDELAAVI 444


>gi|75377913|sp|Q70GH6|GLMM_NEISU RecName: Full=Phosphoglucosamine mutase
 gi|34481903|emb|CAE46488.1| phosphoglucomutase/phosphomannomutase family protein [Neisseria
           subflava]
          Length = 445

 Score =  394 bits (1013), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 201/445 (45%), Positives = 296/445 (66%), Gaps = 6/445 (1%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRR--VVIGKDTRLSGYML 58
           M +++FGTDG+RG+   FPITP+F++++G A G +       ++  V+IGKDTR+SGYML
Sbjct: 1   MAKKYFGTDGVRGEVGQFPITPDFVLKLGYAAGQVLVQHDGGQKPTVLIGKDTRISGYML 60

Query: 59  ENSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDG 118
           E +LVAGFTAAG++    GP+P+P VA LTR+LR   GVMISASHN Y DNGIK F   G
Sbjct: 61  EAALVAGFTAAGVNVIQTGPLPTPGVAYLTRALRLSAGVMISASHNVYSDNGIKFFAEGG 120

Query: 119 YKVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLR 178
            K+S +IE  IE  +++++ +  S    +G A+R++G  DRYIE  K T P  + L+GL+
Sbjct: 121 VKLSDEIELEIEAKIDEEMKTQPSA--RLGRARRINGADDRYIEFCKSTFPSHLDLRGLK 178

Query: 179 IVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADI 238
           +VVD A+GA Y VAP+VF ELGA VV IGD+PNG NIN  CG+T+  +LQ  V +  AD 
Sbjct: 179 LVVDTAHGAGYDVAPKVFHELGAQVVSIGDEPNGYNINEKCGATHPKALQAAVLQNEADY 238

Query: 239 GIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIA 298
           GIALDGDGDR+++VD  G + +GD ++ +IA+      +  G G+V TVM+N+ +E  + 
Sbjct: 239 GIALDGDGDRLMMVDRNGKVYDGDSLIYVIAKARAREGINIG-GVVGTVMTNMAMEIALK 297

Query: 299 GLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQY 358
             G+   R +VGDRY++E +   G+ +GGE SGHI+  D  +TGDG+++ALQVL  ++  
Sbjct: 298 EQGVDFCRAKVGDRYVLEQLNQRGWLIGGEASGHILCMDKHNTGDGIISALQVLAALQML 357

Query: 359 DKPVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTES 418
           ++ ++TIC  ++ YPQ + +V ++       +S    +A+ E EL G  R+++RASGTE 
Sbjct: 358 NQDLATICADWQPYPQTMINVRIQKGQKWQEAS-KDVLAEVEKELEGKGRVVLRASGTEP 416

Query: 419 LIRIMAEGDDLSRIKRIVDDLAKVI 443
           ++R+M E       K+  + +A  I
Sbjct: 417 VVRVMVEARQADWAKKGAERIAAAI 441


>gi|330981085|gb|EGH79188.1| phosphoglucosamine mutase [Pseudomonas syringae pv. aptata str. DSM
           50252]
          Length = 447

 Score =  394 bits (1012), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 195/443 (44%), Positives = 296/443 (66%), Gaps = 6/443 (1%)

Query: 3   RRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSL 62
           R++FGTDGIRG+   FPITP FM+++G A G  FR K    R+++GKDTR+SGYM E++L
Sbjct: 4   RKYFGTDGIRGRVGQFPITPEFMLKLGWAAGMAFR-KMGACRILVGKDTRISGYMFESAL 62

Query: 63  VAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVS 122
            AG +AAG D  +LGP+P+PA+A LTR+  A+ G++ISASHNP+ DNGIK F   G K+ 
Sbjct: 63  EAGLSAAGADVLLLGPMPTPAIAYLTRTFHAEAGIVISASHNPHYDNGIKFFSGQGTKLP 122

Query: 123 TDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVVD 182
            +IE  IE LL+  +T   S  +++G   R++    RYIE  K ++P      GL++V+D
Sbjct: 123 DEIEMMIEELLDAPMTVAES--ENLGKVSRINDAAGRYIEFCKSSVPTSTDFAGLKVVID 180

Query: 183 CANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIAL 242
           CA+GA+YKVAP VF ELGA VVV+  +P+G+NIN DCGST++ +LQ  V    AD+GI  
Sbjct: 181 CAHGATYKVAPNVFRELGAQVVVLSAQPDGLNINKDCGSTHMEALQAAVLAEHADMGIGF 240

Query: 243 DGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLGL 302
           DGDGDRV++VD  G IV+GD+++ +IAR+      L+G G+V T+MSN+GLE  +A  G+
Sbjct: 241 DGDGDRVLMVDHTGTIVDGDELLYIIARDLHERGRLQG-GVVGTLMSNLGLELALAEQGI 299

Query: 303 SLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKPV 362
              R  VGDRY++  +    + +GGE SGHI+   + +TGD ++A+LQV+  +++    +
Sbjct: 300 PFVRANVGDRYVIAELLERNWQIGGENSGHIVCFQHATTGDAIIASLQVILALRRSGVSL 359

Query: 363 STICHCFEEYPQFLRSVSVKDTSI--LNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
           +       + PQ L +V    + +  ++  S+ +A A    ++ G  R+++R SGTE L+
Sbjct: 360 AEARLKLRKCPQILINVRFAGSGVDPVSHPSVQEACARVTEQMAGRGRVLLRKSGTEPLV 419

Query: 421 RIMAEGDDLSRIKRIVDDLAKVI 443
           R+M EG+D ++++   ++LAK++
Sbjct: 420 RVMVEGEDETQVRAYAEELAKLV 442


>gi|145636176|ref|ZP_01791846.1| MrsA [Haemophilus influenzae PittHH]
 gi|229844058|ref|ZP_04464199.1| MrsA [Haemophilus influenzae 6P18H1]
 gi|145270698|gb|EDK10631.1| MrsA [Haemophilus influenzae PittHH]
 gi|229813052|gb|EEP48740.1| MrsA [Haemophilus influenzae 6P18H1]
          Length = 445

 Score =  394 bits (1012), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 207/448 (46%), Positives = 299/448 (66%), Gaps = 9/448 (2%)

Query: 3   RRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSL 62
           R++FGTDG+RGK   +PITP+F +++G A G +    +  + V+IGKDTR+SGYMLE++L
Sbjct: 4   RKYFGTDGVRGKVGAYPITPDFALKLGWAAGKVL-ASQGSKMVLIGKDTRISGYMLESAL 62

Query: 63  VAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVS 122
            AG  AAG+ A   GP+P+PA+A LTR+ RA+ G++ISASHNPY DNGIK F   G K+ 
Sbjct: 63  EAGLAAAGLSAAFTGPMPTPAIAYLTRTFRAEAGIVISASHNPYYDNGIKFFSAKGTKLP 122

Query: 123 TDIEDRIETLLEDDLTSYLSCYDS--IGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
            +IE+ IE +LE  +     C +S  +G A R++    RYIE  K T P  + L+G +IV
Sbjct: 123 DEIEEAIEAMLEQPM----DCVESAELGKASRINDAAGRYIEFCKGTFPAHLGLEGYKIV 178

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           VDCANGA+Y +AP VF ELGA+V+ IG  PNG+NIN  CG+T+V +LQ KV E +AD+G+
Sbjct: 179 VDCANGATYHIAPNVFRELGAEVIEIGTDPNGLNINEKCGATDVTALQAKVVETKADVGL 238

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           A DGDGDR+++VD  G  V+GDQI+ +IARE +    L+G G+V T+MSN+ LE  +  L
Sbjct: 239 AYDGDGDRIMMVDHLGNKVDGDQILFIIAREALRSGQLKG-GVVGTLMSNMSLEIALKML 297

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           G+   R  VGDRY++E M  N + +GGE SGHII++D  +TGDG+VA+L VL  + Q+  
Sbjct: 298 GVPFLRANVGDRYVLEKMVENDWTLGGENSGHIIIADKNTTGDGIVASLAVLAAMAQHKL 357

Query: 361 PVSTICHCFEEYPQFLRSVSVK-DTSILNSSSIVQAIADAESELRGIDRLIVRASGTESL 419
            ++ +    + +PQ L +V      + L S ++    A+ E  L G  R+++R SGTE L
Sbjct: 358 SLNELASAVKLFPQVLINVRFAGGENPLESDAVKSVAAEVEKRLEGKGRILLRKSGTEPL 417

Query: 420 IRIMAEGDDLSRIKRIVDDLAKVIPMID 447
           IR+M E  D    ++  +++A+ +  I+
Sbjct: 418 IRVMVECQDAELAQQCAEEIAEAVKKIN 445


>gi|301170254|emb|CBW29858.1| phosphoglucosamine mutase [Haemophilus influenzae 10810]
          Length = 445

 Score =  394 bits (1012), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 207/450 (46%), Positives = 301/450 (66%), Gaps = 9/450 (2%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           + R++FGTDG+RGK   +PITP+F +++G A G +    +  + V+IGKDTR+SGYMLE+
Sbjct: 2   VNRKYFGTDGVRGKVGAYPITPDFALKLGWAAGKVL-ASQGSKMVLIGKDTRISGYMLES 60

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +L AG  AAG+ A   GP+P+PA+A LTR+ RA+ G++ISASHNPY DNGIK F   G K
Sbjct: 61  ALEAGLAAAGLSAAFTGPMPTPAIAYLTRTFRAEAGIVISASHNPYYDNGIKFFSAKGTK 120

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDS--IGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLR 178
           +  +IE+ IE +LE  +     C +S  +G A R++    RYIE  K T P  + L+G +
Sbjct: 121 LPDEIEEAIEAMLEQPM----DCVESAELGKASRINDATGRYIEFCKGTFPAHLGLEGYK 176

Query: 179 IVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADI 238
           IVVDCANGA+Y +AP VF ELGA+V+ IG  PNG+NIN  CG+T+V +LQ KV E++AD+
Sbjct: 177 IVVDCANGATYHIAPNVFRELGAEVIEIGTDPNGLNINEKCGATDVTALQAKVVEMKADV 236

Query: 239 GIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIA 298
           G+A DGDGDR+++VD  G  V+GDQI+ +IARE +    L+G G+V T+MSN+ LE  + 
Sbjct: 237 GLAYDGDGDRIMMVDHLGNKVDGDQILFIIAREALRSGQLKG-GVVGTLMSNMSLEIALK 295

Query: 299 GLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQY 358
            LG+   R  VGDRY++E M  N + +GGE SGHII++D  +TGDG+VA+L VL  + Q+
Sbjct: 296 MLGVPFLRANVGDRYVLEKMVENDWTLGGENSGHIIIADKNTTGDGIVASLAVLAAMAQH 355

Query: 359 DKPVSTICHCFEEYPQFLRSVSVK-DTSILNSSSIVQAIADAESELRGIDRLIVRASGTE 417
              ++ +    + +PQ L +V      + L S ++    A+ E  L G  R+++R SGTE
Sbjct: 356 KLSLNELASAVKLFPQVLINVRFAGGENPLESDAVKSVAAEVEKRLEGKGRILLRKSGTE 415

Query: 418 SLIRIMAEGDDLSRIKRIVDDLAKVIPMID 447
            LIR+M E  D    ++  +++A+ +  I+
Sbjct: 416 PLIRVMVECQDAELAQQCAEEIAEAVKKIN 445


>gi|281356870|ref|ZP_06243360.1| phosphoglucosamine mutase [Victivallis vadensis ATCC BAA-548]
 gi|281316428|gb|EFB00452.1| phosphoglucosamine mutase [Victivallis vadensis ATCC BAA-548]
          Length = 450

 Score =  394 bits (1012), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 203/444 (45%), Positives = 294/444 (66%), Gaps = 5/444 (1%)

Query: 3   RRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFR--GKKKHRRVVIGKDTRLSGYMLEN 60
           ++ FGTDGIRGK+N +PITP   + +G A   +    G    +RVV+GKDTR+SGYMLEN
Sbjct: 2   KKLFGTDGIRGKANVYPITPELALLVGKATALVLGAGGNDGRKRVVLGKDTRISGYMLEN 61

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +L AG T  GMD   +GP+P+PAVA LT+S+ A  G+MI+ASHNP  DNGIK+F  DG+K
Sbjct: 62  ALTAGLTGMGMDVLSVGPMPTPAVAHLTKSMGAACGIMITASHNPACDNGIKIFAADGFK 121

Query: 121 VSTDIEDRIET-LLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRI 179
           +  D+E  IE  +L+ +L       D IG A R+D    RYIE  K ++ R+++L+GL+I
Sbjct: 122 LPDDVELEIEKHILDPELRERHVPCDRIGKAYRIDDARGRYIEFAKSSI-RNLSLRGLKI 180

Query: 180 VVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIG 239
           V+DCANG +Y +AP +F ELGA+V+    +P+G+NIN DCG+T+  ++ + V E +AD G
Sbjct: 181 VLDCANGGAYSIAPLIFRELGAEVIETAVRPDGLNINDDCGATHPENISKLVLEHKADCG 240

Query: 240 IALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAG 299
           IALDGD DRVI  D  G  VNGD+I+ +IA +      L  + +V T MSN+GL R +  
Sbjct: 241 IALDGDADRVIFCDSDGVEVNGDRIIGMIALDLKKRGRLAADTVVVTGMSNLGLHRAMKE 300

Query: 300 LGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYD 359
            G+S++ T+VGDRY++E M+  GFNVGGEQSGHII  DY +TGDG+++AL VL+ +++  
Sbjct: 301 NGISVEVTDVGDRYVIERMREKGFNVGGEQSGHIIFMDYATTGDGIISALHVLQLMERTG 360

Query: 360 KPVSTICHCFEEYPQFLRSVSVKDTSILNS-SSIVQAIADAESELRGIDRLIVRASGTES 418
           KP++ +      +PQ +RS  +     L+    +  AIA+ ++ L    R IVR SGTE+
Sbjct: 361 KPLAELAGFMSVFPQEIRSFPIGRKVPLDQLEKLPAAIAECKAALGDSGRTIVRYSGTEN 420

Query: 419 LIRIMAEGDDLSRIKRIVDDLAKV 442
            +RI+ E ++ + +   ++ L  V
Sbjct: 421 KMRILVEAENPADVPAWIEKLCAV 444


>gi|310766250|gb|ADP11200.1| phosphoglucosamine mutase [Erwinia sp. Ejp617]
          Length = 444

 Score =  394 bits (1012), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 206/446 (46%), Positives = 300/446 (67%), Gaps = 5/446 (1%)

Query: 2   KRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENS 61
           +R++FGTDGIRGK    PITP+F++++G A G +   +   ++V+IGKDTR+SGYMLE++
Sbjct: 3   ERKYFGTDGIRGKVGESPITPDFVLKLGFAAGKVL-ARHGSKQVIIGKDTRISGYMLESA 61

Query: 62  LVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKV 121
           L AG  AAG+ A   GP+P+PAVA LTR+ RA+ G++ISASHNP+ DNGIK F  +G K+
Sbjct: 62  LEAGLAAAGLSAAFTGPMPTPAVAYLTRTFRAEAGIVISASHNPFDDNGIKFFSTEGTKL 121

Query: 122 STDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVV 181
             ++E  IE  +E  +T   S   ++G A R+     RYIE  K T P  ++L GL+IVV
Sbjct: 122 PDEVEAAIEAEMEKPITCVESA--ALGRASRIVDAAGRYIEFCKGTFPSQLSLNGLKIVV 179

Query: 182 DCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIA 241
           DCANGA+Y +AP V  ELGA V+ IGD+P+G+NIN  CG+T++  LQ +V   +AD+G+A
Sbjct: 180 DCANGATYHIAPNVLRELGATVIAIGDQPDGMNINKGCGATDLQLLQTRVLAEKADVGLA 239

Query: 242 LDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLG 301
            DGDGDR+++VD  G  V+GDQI+ LIARE +    LRG G+V T+MSN+GLE  +  LG
Sbjct: 240 YDGDGDRIMMVDHMGHKVDGDQILYLIAREGLRQGELRG-GVVGTLMSNMGLELALKQLG 298

Query: 302 LSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKP 361
           +   R +VGDRY++E +K  G+ +G E SGH+IL D  +TGDG+VA LQVL  + +    
Sbjct: 299 IPFARAKVGDRYVLEKLKEKGWRLGAENSGHVILLDKTTTGDGIVAGLQVLTAMVRNHMS 358

Query: 362 VSTICHCFEEYPQFLRSVSVKDTS-ILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
           +  +C   +  PQ L +V     +  L  + +    A+AE+EL+G  R+++R SGTE LI
Sbjct: 359 LHDLCSGMKLLPQILVNVRFNGVNDPLEDAQVKSVTAEAETELKGRGRVLLRKSGTEPLI 418

Query: 421 RIMAEGDDLSRIKRIVDDLAKVIPMI 446
           R+M EG++ +++  +   +A  +  +
Sbjct: 419 RVMVEGENEAQVSALAHRIADAVKAV 444


>gi|261820123|ref|YP_003258229.1| phosphoglucosamine mutase [Pectobacterium wasabiae WPP163]
 gi|261604136|gb|ACX86622.1| phosphoglucosamine mutase [Pectobacterium wasabiae WPP163]
          Length = 445

 Score =  394 bits (1012), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 210/445 (47%), Positives = 296/445 (66%), Gaps = 5/445 (1%)

Query: 3   RRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSL 62
           R++FGTDGIRGK    PITP+F++++G A G +   +   R+++IGKDTR+SGYMLE++L
Sbjct: 4   RKYFGTDGIRGKVGDTPITPDFVLKLGWAAGKVL-ARHGSRKIIIGKDTRISGYMLESAL 62

Query: 63  VAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVS 122
            AG  AAG+ A   GP+P+PAVA LTR+ RA+ G++ISASHNPY DNGIK F  DG K+ 
Sbjct: 63  EAGLAAAGLSASFTGPMPTPAVAYLTRTFRAEAGIVISASHNPYYDNGIKFFSIDGTKLP 122

Query: 123 TDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVVD 182
            ++E+ IE  LE  LT   S    +G A R+     RYIE  K T P +++L GL+IVVD
Sbjct: 123 DEVEEAIEAELEKPLTCVESA--ELGKASRIVDAAGRYIEFCKGTFPSELSLNGLKIVVD 180

Query: 183 CANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIAL 242
           CANGA+Y +AP V  ELGA V+ IG +P+G+NIN +CG+T+V  LQ +V   +AD+G+A 
Sbjct: 181 CANGATYHIAPSVLRELGAKVIAIGCEPDGMNINEECGATDVRQLQARVLAEKADVGLAF 240

Query: 243 DGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLGL 302
           DGDGDR+I+VD  G  V+GDQI+ +IARE +    LRG G V T+MSN+GLE  +  LG+
Sbjct: 241 DGDGDRLIMVDHLGNKVDGDQILYIIAREGLRQGQLRG-GAVGTLMSNMGLEVALKQLGI 299

Query: 303 SLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKPV 362
              R +VGDRY++E M+  G+ +G E SGH+IL D  +TGDG++A LQVL  I +    +
Sbjct: 300 PFARAKVGDRYVLEMMQAKGWRIGAENSGHVILLDKTTTGDGVIAGLQVLTAIVKNHMSL 359

Query: 363 STICHCFEEYPQFLRSVSVK-DTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLIR 421
             +C   + +PQ L +V    +   L  +++ Q   D E EL G  R+++R SGTE LIR
Sbjct: 360 HDLCSGMKLFPQILVNVRFTGENDPLEDNNVQQITLDVEKELAGRGRVLLRKSGTEPLIR 419

Query: 422 IMAEGDDLSRIKRIVDDLAKVIPMI 446
           +M EG+    +  + + +A  +  +
Sbjct: 420 VMVEGEHEETVIALANRIADAVKAV 444


>gi|89898031|ref|YP_515141.1| phosphoglucomutase/phosphomannomutase [Chlamydophila felis Fe/C-56]
 gi|123483726|sp|Q255P2|GLMM_CHLFF RecName: Full=Phosphoglucosamine mutase
 gi|89331403|dbj|BAE80996.1| phosphoglucomutase/phosphomannomutase [Chlamydophila felis Fe/C-56]
          Length = 458

 Score =  394 bits (1012), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 213/449 (47%), Positives = 299/449 (66%), Gaps = 7/449 (1%)

Query: 3   RRFFGTDGIRGKSNTFPITPNFMMRIGIAV-GYLFRGKKKHRRVVIGKDTRLSGYMLENS 61
           +  FGTDG+RG++N  P+T    + +G AV G L   K    RVV+GKDTRLSGYM EN+
Sbjct: 6   KPLFGTDGVRGRANHEPMTVEMSVLLGKAVAGVLQECKPGRHRVVVGKDTRLSGYMFENA 65

Query: 62  LVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKV 121
           L+AG T+ G++  +LGPIP+P VA +TR+ RAD G+MISASHNPY DNGIK+F  +G+K+
Sbjct: 66  LIAGLTSMGIETLVLGPIPTPGVAFITRAYRADAGIMISASHNPYWDNGIKIFSSEGFKI 125

Query: 122 STDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVV 181
           S  IE RIE ++       L    ++G  KRV     RYIE  K T PR  TL GL+IV+
Sbjct: 126 SDVIERRIEQMVAFKEFGNLPEDYAVGKNKRVVDAMGRYIEFAKATFPRGRTLNGLKIVL 185

Query: 182 DCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIA 241
           DCA+GA+YKVAP VF EL A+V+  G +P G NIN +CG+     +Q+ V E +AD+GIA
Sbjct: 186 DCAHGAAYKVAPSVFEELDAEVICYGCEPTGSNINDNCGALFPSVIQKAVIEHKADVGIA 245

Query: 242 LDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLG 301
           LDGDGDR+I+V+EKG IV+GD I+++ A +     +L GN IV TVM+N G+ +++  +G
Sbjct: 246 LDGDGDRIIMVNEKGHIVDGDMILSICANDLKKKGILHGNRIVATVMTNFGVLKYLENVG 305

Query: 302 LSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKP 361
           +    + VGDR++++ M     N+GGEQSGH+I  DY +TGDG+V+ALQVLR + + +  
Sbjct: 306 IDTLISPVGDRHVLQNMLEYEANLGGEQSGHMIFLDYNTTGDGIVSALQVLRIMIESEST 365

Query: 362 VSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQ-AIADAESELRGIDRLIVRASGTESLI 420
           +S +     + PQ L +V+VK+   L++  +VQ A+ D  S L    R+++R SGTE++ 
Sbjct: 366 LSDLTSPIVKSPQALINVAVKEKIPLDTLPLVQEALRDVRSSLGDSGRVLLRYSGTENIC 425

Query: 421 RIMAEGDDLSRIKRIVDDLAKVIP-MIDS 448
           R+M EG      K  VD LAK I  ++DS
Sbjct: 426 RVMVEGLK----KHQVDSLAKTIADIVDS 450


>gi|66047412|ref|YP_237253.1| phosphoglucosamine mutase [Pseudomonas syringae pv. syringae B728a]
 gi|3024441|sp|P95575|GLMM_PSEU2 RecName: Full=Phosphoglucosamine mutase
 gi|1835600|gb|AAC45130.1| MrsA [Pseudomonas syringae pv. syringae]
 gi|63258119|gb|AAY39215.1| Phosphoglucosamine mutase [Pseudomonas syringae pv. syringae B728a]
          Length = 447

 Score =  394 bits (1012), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 195/443 (44%), Positives = 296/443 (66%), Gaps = 6/443 (1%)

Query: 3   RRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSL 62
           R++FGTDGIRG+   FPITP FM+++G A G  FR K    R+++GKDTR+SGYM E++L
Sbjct: 4   RKYFGTDGIRGRVGQFPITPEFMLKLGWAAGMAFR-KMGACRILVGKDTRISGYMFESAL 62

Query: 63  VAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVS 122
            AG +AAG D  +LGP+P+PA+A LTR+  A+ G++ISASHNP+ DNGIK F   G K+ 
Sbjct: 63  EAGLSAAGADVLLLGPMPTPAIAYLTRTFHAEAGIVISASHNPHYDNGIKFFSGQGTKLP 122

Query: 123 TDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVVD 182
            +IE  IE LL+  +T   S  +++G   R++    RYIE  K ++P      GL++V+D
Sbjct: 123 DEIEMMIEELLDAPMTVAES--ENLGKVSRINDAAGRYIEFCKSSVPTSTDFAGLKVVID 180

Query: 183 CANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIAL 242
           CA+GA+YKVAP VF ELGA VVV+  +P+G+NIN DCGST++ +LQ  V    AD+GI  
Sbjct: 181 CAHGATYKVAPNVFRELGAQVVVLSAQPDGLNINKDCGSTHMEALQAAVLAEHADMGIGF 240

Query: 243 DGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLGL 302
           DGDGDRV++VD  G IV+GD+++ +IAR+      L+G G+V T+MSN+GLE  +A  G+
Sbjct: 241 DGDGDRVLMVDHTGTIVDGDELLYIIARDLHERGRLQG-GVVGTLMSNLGLELALAEQGI 299

Query: 303 SLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKPV 362
              R  VGDRY++  +    + +GGE SGHI+   + +TGD ++A+LQV+  +++    +
Sbjct: 300 PFVRANVGDRYVIAELLERNWQIGGENSGHIVCFQHATTGDAIIASLQVILALRRSGVSL 359

Query: 363 STICHCFEEYPQFLRSVSVKDTSI--LNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
           +       + PQ L +V    + +  ++  S+ +A A    ++ G  R+++R SGTE L+
Sbjct: 360 AEARLKLRKCPQILINVRFAGSGVDPVSHPSVKEACARVTEQMAGRGRVLLRKSGTEPLV 419

Query: 421 RIMAEGDDLSRIKRIVDDLAKVI 443
           R+M EG+D ++++   ++LAK++
Sbjct: 420 RVMVEGEDETQVRAYAEELAKLV 442


>gi|213966652|ref|ZP_03394803.1| phosphoglucosamine mutase [Pseudomonas syringae pv. tomato T1]
 gi|301383162|ref|ZP_07231580.1| phosphoglucosamine mutase [Pseudomonas syringae pv. tomato Max13]
 gi|302063403|ref|ZP_07254944.1| phosphoglucosamine mutase [Pseudomonas syringae pv. tomato K40]
 gi|213928502|gb|EEB62046.1| phosphoglucosamine mutase [Pseudomonas syringae pv. tomato T1]
          Length = 447

 Score =  394 bits (1012), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 196/448 (43%), Positives = 298/448 (66%), Gaps = 6/448 (1%)

Query: 3   RRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSL 62
           R++FGTDGIRG+   FPITP FM+++G A G  FR K    R+++GKDTR+SGYM E++L
Sbjct: 4   RKYFGTDGIRGRVGQFPITPEFMLKLGWAAGMAFR-KMGACRILVGKDTRISGYMFESAL 62

Query: 63  VAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVS 122
            AG +AAG D  +LGP+P+PA+A LTR+  A+ G++ISASHNP+ DNGIK F   G K+ 
Sbjct: 63  EAGLSAAGADVLLLGPMPTPAIAYLTRTFHAEAGIVISASHNPHYDNGIKFFSGQGTKLP 122

Query: 123 TDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVVD 182
            +IE  IE LL+  +T   S  +++G   R++    RYIE  K ++P      GL++V+D
Sbjct: 123 DEIEMMIEELLDAPMTVAES--ENLGKVSRINDAAGRYIEFCKSSVPTSTDFAGLKVVID 180

Query: 183 CANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIAL 242
           CA+GA+YKVAP VF ELGA VVV+  +P+G+NIN DCGST++ +LQ  V    AD+GI  
Sbjct: 181 CAHGATYKVAPNVFRELGAQVVVLSAQPDGLNINKDCGSTHMEALQAAVVAEHADMGIGF 240

Query: 243 DGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLGL 302
           DGDGDRV++VD  G IV+GD+++ +IAR+      L+G G+V T+MSN+GLE  +A   +
Sbjct: 241 DGDGDRVLMVDHTGTIVDGDELLYIIARDLHERGRLQG-GVVGTLMSNLGLELALAEQNI 299

Query: 303 SLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKPV 362
              R  VGDRY++  +    + +GGE SGHI+   + +TGD ++A+LQV+  +++    +
Sbjct: 300 PFVRANVGDRYVIAELLERNWQIGGENSGHIVCFQHATTGDAIIASLQVILALRRSGISL 359

Query: 363 STICHCFEEYPQFLRSVSVKDTSI--LNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
           +       + PQ L +V  + +S+  +   S+ +A A    ++ G  R+++R SGTE L+
Sbjct: 360 AEARLKLRKCPQILINVRFEGSSVDPVTHPSVQEACARVTEQMAGRGRVLLRKSGTEPLV 419

Query: 421 RIMAEGDDLSRIKRIVDDLAKVIPMIDS 448
           R+M EG+D ++++   ++LAK++  + S
Sbjct: 420 RVMVEGEDEAQVRAYAEELAKLVAEVCS 447


>gi|325982673|ref|YP_004295075.1| phosphoglucosamine mutase [Nitrosomonas sp. AL212]
 gi|325532192|gb|ADZ26913.1| phosphoglucosamine mutase [Nitrosomonas sp. AL212]
          Length = 452

 Score =  394 bits (1012), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 203/452 (44%), Positives = 297/452 (65%), Gaps = 14/452 (3%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVG--------YLFRGKKKHRRVVIGKDTR 52
           M +++FGTDGIRG+   FPITP+F+M +G + G        +L  GK+    V+IGKDTR
Sbjct: 1   MAKKYFGTDGIRGRVGQFPITPDFIMHLGYSAGKVLAAADWHLMEGKRP--TVLIGKDTR 58

Query: 53  LSGYMLENSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIK 112
           +SGYMLE++L AG  AAG+D  + GP+P+PAVA L R+LR   G++ISASHN ++DNG+K
Sbjct: 59  VSGYMLESALEAGLCAAGVDVLLSGPMPTPAVAYLIRALRLQAGIVISASHNLFEDNGVK 118

Query: 113 LFGPDGYKVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDV 172
            F   G K+  ++E +IE  L   + +  S    +G  +R+D    RYIE  K T P  +
Sbjct: 119 FFSAVGCKLPDEMEHKIEAELNTPIVTKPSA--QLGKVQRIDDAAGRYIEFCKSTFPYHL 176

Query: 173 TLQGLRIVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVH 232
            L+GLRIV+DCA+GA+Y +A  V  ELGADVV IG +PNG+NINL+CG+T+  +LQ+ V 
Sbjct: 177 DLRGLRIVIDCAHGAAYHIAGHVMHELGADVVTIGVQPNGLNINLECGATHGTTLQKAVK 236

Query: 233 EVRADIGIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIG 292
           +  AD+GIALDGDGDRV++VD++G   NGDQ++ +IA+      +L G G+V T+M+N+ 
Sbjct: 237 QHHADLGIALDGDGDRVMMVDKQGRSYNGDQLIYIIAKHRKQRKILTG-GVVGTLMTNLA 295

Query: 293 LERFIAGLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVL 352
           +E     L +   RT VGDRY++  ++  G+++GGE SGHII  D  +TGDG+++ALQVL
Sbjct: 296 IENQFNKLRIPFLRTNVGDRYVLALLQEQGWHLGGENSGHIICMDKHTTGDGIISALQVL 355

Query: 353 RYIKQYDKPVSTICHCFEEYPQFLRSVSV-KDTSILNSSSIVQAIADAESELRGIDRLIV 411
             ++  DK ++        YPQ L +V + K  +   + +I     +AE++L G  RL++
Sbjct: 356 YALRDADKTLAEFMRGVSLYPQRLINVKIPKPFNFTGNKAINTVRKEAEADLNGNGRLLI 415

Query: 412 RASGTESLIRIMAEGDDLSRIKRIVDDLAKVI 443
           RASGTE LIR+M E     ++    + +AKV+
Sbjct: 416 RASGTEPLIRVMVESQSKQKVNYWTERIAKVV 447


>gi|227328606|ref|ZP_03832630.1| phosphoglucosamine mutase [Pectobacterium carotovorum subsp.
           carotovorum WPP14]
          Length = 445

 Score =  394 bits (1011), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 210/442 (47%), Positives = 294/442 (66%), Gaps = 5/442 (1%)

Query: 3   RRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSL 62
           R++FGTDG+RGK    PITP+F++++G A G +   +   R+++IGKDTR+SGYMLE++L
Sbjct: 4   RKYFGTDGVRGKVGDTPITPDFVLKLGWAAGKVL-ARHGSRKIIIGKDTRISGYMLESAL 62

Query: 63  VAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVS 122
            AG  AAG+ A   GP+P+PAVA LTR+ RA+ G++ISASHNPY DNGIK F  DG K+ 
Sbjct: 63  EAGLAAAGLSASFTGPMPTPAVAYLTRTFRAEAGIVISASHNPYYDNGIKFFSIDGTKLP 122

Query: 123 TDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVVD 182
            D+E+ IE  LE  LT   S    +G A R+     RYIE  K T P +++L GL+IVVD
Sbjct: 123 DDVEEAIEAELEKPLTCVESA--ELGKASRIVDAAGRYIEFCKGTFPSELSLNGLKIVVD 180

Query: 183 CANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIAL 242
           CANGA+Y +AP V  ELGA V+ IG +P+G+NIN +CG+T+V  LQ +V   +AD+G+A 
Sbjct: 181 CANGATYHIAPSVLRELGAKVIAIGCEPDGMNINEECGATDVRQLQARVLAEKADVGLAF 240

Query: 243 DGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLGL 302
           DGDGDR+I+VD  G  V+GDQI+ +IARE +    LRG G V T+MSN+GLE  +  LG+
Sbjct: 241 DGDGDRLIMVDHLGNKVDGDQILYIIAREGLRQGQLRG-GAVGTLMSNMGLEVALKQLGI 299

Query: 303 SLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKPV 362
              R +VGDRY++E M+  G+ +G E SGH+IL D  +TGDG++A LQVL  I +    +
Sbjct: 300 PFARAKVGDRYVLEMMQAKGWRIGAENSGHVILLDKTTTGDGVIAGLQVLTAIVKNHMSL 359

Query: 363 STICHCFEEYPQFLRSVSVK-DTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLIR 421
             +C   + +PQ L +V    +   L   ++ Q   D E EL G  R+++R SGTE LIR
Sbjct: 360 HDLCSGMKLFPQILVNVRFTGEHDPLEDKNVQQITQDVEKELAGRGRVLLRKSGTEPLIR 419

Query: 422 IMAEGDDLSRIKRIVDDLAKVI 443
           +M EG+    +  + + +A  +
Sbjct: 420 VMVEGEHEETVIALANRIADAV 441


>gi|330895311|gb|EGH27649.1| phosphoglucosamine mutase [Pseudomonas syringae pv. japonica str.
           M301072PT]
          Length = 447

 Score =  394 bits (1011), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 195/443 (44%), Positives = 295/443 (66%), Gaps = 6/443 (1%)

Query: 3   RRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSL 62
           R++FGTDGIRG+   FPITP FM+++G A G  FR K    R+++GKDTR+SGYM E++L
Sbjct: 4   RKYFGTDGIRGRVGQFPITPEFMLKLGWAAGMAFR-KMGACRILVGKDTRISGYMFESAL 62

Query: 63  VAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVS 122
            AG +AAG D  +LGP+P+PA+A LTR+  A+ G+ ISASHNP+ DNGIK F   G K+ 
Sbjct: 63  EAGLSAAGADVLLLGPMPTPAIAYLTRTFHAEAGIFISASHNPHYDNGIKFFSGQGTKLP 122

Query: 123 TDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVVD 182
            +IE  IE LL+  +T   S  +++G   R++    RYIE  K ++P      GL++V+D
Sbjct: 123 DEIEMMIEELLDAPMTVAES--ENLGKVSRINDAAGRYIEFCKSSVPTSTDFAGLKVVID 180

Query: 183 CANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIAL 242
           CA+GA+YKVAP VF ELGA VVV+  +P+G+NIN DCGST++ +LQ  V    AD+GI  
Sbjct: 181 CAHGATYKVAPNVFRELGAQVVVLSAQPDGLNINKDCGSTHMEALQAAVLAEHADMGIGF 240

Query: 243 DGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLGL 302
           DGDGDRV++VD  G IV+GD+++ +IAR+      L+G G+V T+MSN+GLE  +A  G+
Sbjct: 241 DGDGDRVLMVDHTGTIVDGDELLYIIARDLHERGRLQG-GVVGTLMSNLGLELALAEQGI 299

Query: 303 SLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKPV 362
              R  VGDRY++  +    + +GGE SGHI+   + +TGD ++A+LQV+  +++    +
Sbjct: 300 PFVRANVGDRYVIAELLERNWQIGGENSGHIVCFQHATTGDAIIASLQVILALRRSGVSL 359

Query: 363 STICHCFEEYPQFLRSVSVKDTSI--LNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
           +       + PQ L +V    + +  ++  S+ +A A    ++ G  R+++R SGTE L+
Sbjct: 360 AEARLKLRKCPQILINVRFAGSGVDPVSHPSVQEACARVTEQMAGRGRVLLRKSGTEPLV 419

Query: 421 RIMAEGDDLSRIKRIVDDLAKVI 443
           R+M EG+D ++++   ++LAK++
Sbjct: 420 RVMVEGEDETQVRAYAEELAKLV 442


>gi|319427017|gb|ADV55091.1| phosphoglucosamine mutase [Shewanella putrefaciens 200]
          Length = 450

 Score =  394 bits (1011), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 208/434 (47%), Positives = 289/434 (66%), Gaps = 8/434 (1%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M R++FGTDG+RGK  TFPITP+F M++G A G +       + V+IGKDTR SGYMLE+
Sbjct: 1   MSRKYFGTDGVRGKVGTFPITPDFAMKLGWAAGTVL-ASTGTKEVLIGKDTRSSGYMLES 59

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           ++ AGF+AAG++  ++GP+P+PAVA L  + RAD GV+ISASHNPY DNGIK F   G K
Sbjct: 60  AMEAGFSAAGVNVALIGPMPTPAVAYLASTFRADAGVVISASHNPYYDNGIKFFSNTGTK 119

Query: 121 VSTDIEDRIETLLEDDLT-SYLSCYDS--IGHAKRVDGVHDRYIEHVKRTLPRDVTLQGL 177
           ++   E  IE LLE  L  + + C  S  +G  +R+D    RYIE  K T P  ++L GL
Sbjct: 120 LNDAQEIEIEALLEQALEHNAMQCVASEKLGKVRRIDDAAGRYIEFCKGTFPNHLSLAGL 179

Query: 178 RIVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRAD 237
           +IVVD A+GA+Y +AP V+ ELGA+V+ I DKPNG+NIN  CG+T++ SLQ  V    AD
Sbjct: 180 KIVVDSAHGAAYHIAPNVYRELGAEVISINDKPNGMNINDHCGATHLDSLQSAVMIHEAD 239

Query: 238 IGIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFI 297
           +GIALDGD DRV+ VD  G +V+GD+I+ ++A+       ++G G+V T+MSN+GLE  +
Sbjct: 240 LGIALDGDADRVMFVDHNGHVVDGDEILFILAQAAHQKGEMQG-GVVGTLMSNLGLELAL 298

Query: 298 AGLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQ 357
             + +   R +VGDRY++E +K  G+ +GGE SGHI+   + STGDG+VA+LQVL+ I +
Sbjct: 299 KQMDIPFVRAKVGDRYVVEQLKQTGWQLGGEGSGHILSLKHASTGDGIVASLQVLKAILE 358

Query: 358 YDKPVSTICHCFEEYPQFLRSVSVKD---TSILNSSSIVQAIADAESELRGIDRLIVRAS 414
             K ++ I     + PQ L +V +      SIL   S+ QA+  AE  L    R+++R S
Sbjct: 359 SGKRLADIKAGMSKLPQVLINVRLSSGSADSILALESVKQAVVKAEGILGDQGRVLLRKS 418

Query: 415 GTESLIRIMAEGDD 428
           GTE LIR+M E  D
Sbjct: 419 GTEPLIRVMVESTD 432


>gi|301156343|emb|CBW15814.1| phosphoglucosamine mutase [Haemophilus parainfluenzae T3T1]
          Length = 444

 Score =  394 bits (1011), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 209/444 (47%), Positives = 297/444 (66%), Gaps = 9/444 (2%)

Query: 3   RRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSL 62
           R++FGTDG+RGK  T+PITP+F +++G A G +    +  R V+IGKDTR+SGYMLE++L
Sbjct: 4   RKYFGTDGVRGKVGTYPITPDFALKLGWAAGKVL-ASQGSRTVLIGKDTRISGYMLESAL 62

Query: 63  VAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVS 122
            AG  AAG+ A   GP+P+PAVA LTR+ R + G++ISASHNPY DNGIK F   G K+ 
Sbjct: 63  EAGLAAAGLTAAFTGPMPTPAVAYLTRTFRLEAGIVISASHNPYYDNGIKFFSSQGTKLP 122

Query: 123 TDIEDRIETLLEDDLTSYLSCYDS--IGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
            DIE+ IE +L+  +     C +S  +G A R+     RYIE  K T P  + L G +IV
Sbjct: 123 DDIEEAIEAMLDQPM----DCVESADLGKASRISDAAGRYIEFCKSTFPAHLGLDGYKIV 178

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           VDCANGA+Y +AP V  ELGA+V+ IG  PNGININ  CG+T+V +LQ KV E +AD+G+
Sbjct: 179 VDCANGATYHIAPNVLRELGAEVIEIGATPNGININEKCGATDVKALQEKVLETKADVGL 238

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           A DGDGDR+++VD  G  V+GDQI+ +IARE +    L+G G+V T+MSN+ LE  +  L
Sbjct: 239 AYDGDGDRIMMVDHLGNKVDGDQILFIIAREALRSGQLKG-GVVGTLMSNMSLEIALKML 297

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           G+   R  VGDRY++E M  +G+ +GGE SGHII++D  +TGDG++A+L VL  + Q+  
Sbjct: 298 GVPFVRANVGDRYVLEKMVEHGWTLGGENSGHIIIADKNTTGDGIIASLAVLSAMVQHRL 357

Query: 361 PVSTICHCFEEYPQFLRSVSVK-DTSILNSSSIVQAIADAESELRGIDRLIVRASGTESL 419
            ++ +    + +PQ L +V      + L S ++    AD E  L G  R+++R SGTE L
Sbjct: 358 SLNELASAVKLFPQVLINVRFAGGANPLESEAVKAVAADVEKRLEGKGRILLRKSGTEPL 417

Query: 420 IRIMAEGDDLSRIKRIVDDLAKVI 443
           IR+M E +D +  K+  +++A+ +
Sbjct: 418 IRVMVECEDGALAKQCAEEIAEAV 441


>gi|309378222|emb|CBX23136.1| unnamed protein product [Neisseria lactamica Y92-1009]
          Length = 444

 Score =  394 bits (1011), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 198/428 (46%), Positives = 292/428 (68%), Gaps = 8/428 (1%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRR--VVIGKDTRLSGYML 58
           M +++FGTDG+RG+   FPITP+F++++G A G +       ++  V+IGKDTR+SGYML
Sbjct: 1   MAKKYFGTDGVRGEVGQFPITPDFVLKLGYAAGQVLVQHDTDQKPTVLIGKDTRISGYML 60

Query: 59  ENSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDG 118
           E +LVAGFTAAG++    GP+P+P VA LTR+LR   GVMISASHN Y DNGIK F   G
Sbjct: 61  EAALVAGFTAAGVNVIQTGPLPTPGVAYLTRALRLSAGVMISASHNAYSDNGIKFFAEGG 120

Query: 119 YKVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLR 178
            K+S ++E  IE  +++++ +  S    +G A+R++G  DRYIE  K T P    L+GL+
Sbjct: 121 VKLSDEVELEIEAKIDEEMKTQPSA--RLGRARRINGADDRYIEFCKSTFPTHSDLRGLK 178

Query: 179 IVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADI 238
           +VVD ANGA+Y VAP+VF ELGA VV IG++PNG NIN  CG+T+  +LQ  V +  AD 
Sbjct: 179 LVVDAANGAAYSVAPKVFHELGAQVVSIGNEPNGYNINEKCGATHTKTLQAAVLQNEADY 238

Query: 239 GIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIA 298
           GIALDGDGDR+++VD+ G + +GD ++ +IA+      +  G G+V TVM+N+ +E  + 
Sbjct: 239 GIALDGDGDRLMMVDKNGQVYDGDSLIYVIAKARAGEGVNIG-GVVGTVMTNMAMENALK 297

Query: 299 GLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQY 358
             G+   R +VGDRY++E +   G+ VGGE SGHI+  D  +TGDG+++ALQVL  ++  
Sbjct: 298 EQGVDFCRAKVGDRYVLEQLNRRGWLVGGEASGHILCMDKHNTGDGIISALQVLAALQTL 357

Query: 359 DKPVSTICHCFEEYPQFLRSVSV-KDTSILNSSSIVQAIADAESELRGIDRLIVRASGTE 417
           ++ ++ +C  ++ YPQ + +V + K  +   +S  V  +A+ E EL G  R+++RASGTE
Sbjct: 358 NQDLAAVCADWQPYPQTMINVRIGKGQNWQEASKTV--LAEVEKELEGKGRVVLRASGTE 415

Query: 418 SLIRIMAE 425
            ++R+M E
Sbjct: 416 PVVRVMVE 423


>gi|226722705|sp|B4RXA8|GLMM_ALTMD RecName: Full=Phosphoglucosamine mutase
          Length = 447

 Score =  394 bits (1011), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 198/444 (44%), Positives = 302/444 (68%), Gaps = 6/444 (1%)

Query: 2   KRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENS 61
           +R++FGTDGIRGK     I P F+ ++G A G +  G+  ++ V+IGKDTR+SGYMLE+S
Sbjct: 3   QRKYFGTDGIRGKVGESNINPEFVTKLGWAAGKVLAGRGTNK-VLIGKDTRISGYMLESS 61

Query: 62  LVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKV 121
           L AG +AAG++  +LGP+P+PA+A LT++ R++ G++ISASHNP+ DNGIK F   G+K+
Sbjct: 62  LEAGLSAAGINIGLLGPMPTPAIAYLTKTFRSEAGIVISASHNPFYDNGIKFFSAQGFKL 121

Query: 122 STDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVV 181
             DIE  IE +LE  +T   S  D +G A R++    RYIE  K T P +++L GL+IVV
Sbjct: 122 DDDIELAIEAMLEQPMTCVAS--DKLGKATRINDAAGRYIEFCKGTFPSELSLTGLKIVV 179

Query: 182 DCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIA 241
           DCA+GA+Y +AP V  ELGA V+ +G  P+G+NIN   G+T++ ++  KV E  AD+G A
Sbjct: 180 DCAHGATYHIAPNVLRELGATVIELGTTPDGLNINDGVGATSMKAIVEKVKESGADLGFA 239

Query: 242 LDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLG 301
           LDGDGDR+++VD  G +++GDQI+ +IAR+ + +  ++G G+V T+MSN+GLE  ++ LG
Sbjct: 240 LDGDGDRIMMVDHLGNVLDGDQIVYIIARDALKNGKMQG-GVVGTLMSNLGLENALSKLG 298

Query: 302 LSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKP 361
           +   R+ VGDRY+ME ++  G+++GGE SGH++  +  STGDG+VA LQVL  + +    
Sbjct: 299 VPFARSNVGDRYVMELLQQKGWSIGGENSGHVLNLNMSSTGDGIVAGLQVLAAMLRSHMD 358

Query: 362 VSTICHCFEEYPQFLRSV--SVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESL 419
           +  +   F+ YPQ L +V  + +D   L  + +  A  +AE  L    R+++R SGTE L
Sbjct: 359 LHDLASGFDMYPQTLVNVRYTNQDIDYLAHADVQNAKQEAELALGKTGRVLLRKSGTEPL 418

Query: 420 IRIMAEGDDLSRIKRIVDDLAKVI 443
           IR+M E +D ++  +  + +A+ +
Sbjct: 419 IRVMVESNDEAQSHKWAEHIAETV 442


>gi|237798558|ref|ZP_04587019.1| phosphoglucosamine mutase [Pseudomonas syringae pv. oryzae str.
           1_6]
 gi|331021411|gb|EGI01468.1| phosphoglucosamine mutase [Pseudomonas syringae pv. oryzae str.
           1_6]
          Length = 447

 Score =  394 bits (1011), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 196/443 (44%), Positives = 296/443 (66%), Gaps = 6/443 (1%)

Query: 3   RRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSL 62
           R++FGTDGIRG+   FPITP FM+++G A G  FR K    R+++GKDTR+SGYM E++L
Sbjct: 4   RKYFGTDGIRGRVGQFPITPEFMLKLGWAAGMAFR-KMGTCRILVGKDTRISGYMFESAL 62

Query: 63  VAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVS 122
            AG +AAG D  +LGP+P+PA+A LTR+  A+ G++ISASHNP+ DNGIK F   G K+ 
Sbjct: 63  EAGLSAAGADVLLLGPMPTPAIAYLTRTFHAEAGIVISASHNPHYDNGIKFFSGQGTKLP 122

Query: 123 TDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVVD 182
            +IE  IE LL+  +T   S  +++G   R++    RYIE  K ++P      GL+IV+D
Sbjct: 123 DEIEMMIEELLDAPMTVAES--ENLGKVSRINDAAGRYIEFCKSSVPTSTDFAGLKIVID 180

Query: 183 CANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIAL 242
           CA+GA+YKVAP VF ELGA VVV+  +P+G+NIN DCGST++ +LQ  V    AD+GI  
Sbjct: 181 CAHGATYKVAPNVFRELGAQVVVLSAQPDGLNINKDCGSTHMEALQAAVVAEHADMGIGF 240

Query: 243 DGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLGL 302
           DGDGDRV++VD  G IV+GD+++ +IAR+      L+G G+V T+MSN+GLE  +A   +
Sbjct: 241 DGDGDRVLMVDHTGTIVDGDELLYIIARDLHERGRLQG-GVVGTLMSNLGLELALAEQNI 299

Query: 303 SLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKPV 362
              R  VGDRY++  +    + +GGE SGHI+   + +TGD ++A+LQV+  +++    +
Sbjct: 300 PFVRANVGDRYVIAELLERNWQIGGENSGHIVCFQHATTGDAIIASLQVILALRRSGISL 359

Query: 363 STICHCFEEYPQFLRSVSVKDTSI--LNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
           +       + PQ L +V  + +S+  +   S+ +A A    ++ G  R+++R SGTE L+
Sbjct: 360 AEARLKLRKCPQILINVRFEGSSVDPVTHPSVQEACARVTEQMAGRGRVLLRKSGTEPLV 419

Query: 421 RIMAEGDDLSRIKRIVDDLAKVI 443
           R+M EG+D ++++   ++LAK++
Sbjct: 420 RVMVEGEDEAQVRAYAEELAKLV 442


>gi|304386830|ref|ZP_07369094.1| phosphoglucosamine mutase [Neisseria meningitidis ATCC 13091]
 gi|304339084|gb|EFM05174.1| phosphoglucosamine mutase [Neisseria meningitidis ATCC 13091]
          Length = 444

 Score =  394 bits (1011), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 197/427 (46%), Positives = 289/427 (67%), Gaps = 6/427 (1%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRR--VVIGKDTRLSGYML 58
           M +++FGTDG+RG+   FPITP+F++++G A G +       ++  V+IGKDTR+SGYML
Sbjct: 1   MAKKYFGTDGVRGEVGQFPITPDFVLKLGYAAGQVLVQHDTDQKPTVLIGKDTRISGYML 60

Query: 59  ENSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDG 118
           E +LVAGFTAAG++    GP+P+P VA LTR+LR   GVMISASHN Y DNGIK F   G
Sbjct: 61  EAALVAGFTAAGVNVVQTGPLPTPGVAYLTRALRLSAGVMISASHNAYSDNGIKFFAEGG 120

Query: 119 YKVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLR 178
            K+S ++E  IE  ++ ++ +  S    +G A+R++G  DRYIE  K T P    L+GL+
Sbjct: 121 VKLSDEVELEIEAKIDGEMKTQPSA--RLGRARRINGADDRYIEFCKSTFPTHSDLRGLK 178

Query: 179 IVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADI 238
           +VVD ANGA+Y VAP+VF ELGA VV IGD+PNG NIN  CG+T   +LQ  V +  AD 
Sbjct: 179 LVVDAANGAAYSVAPKVFHELGAQVVSIGDEPNGYNINEKCGATYTKTLQAAVLQHEADY 238

Query: 239 GIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIA 298
           GIALDGDGDR+++VD+ G + +GD ++ +IA+      +  G G+V TVM+N+ +E  + 
Sbjct: 239 GIALDGDGDRLMMVDKNGKVYDGDSLIYVIAKARAREGINIG-GVVGTVMTNMAMEIALK 297

Query: 299 GLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQY 358
             G+   R +VGDRY++E +   G+ +GGE SGHI+  D  +TGDG+++ALQVL  ++  
Sbjct: 298 EQGVDFCRAKVGDRYVLEQLNQRGWLIGGEASGHILCMDKHNTGDGIISALQVLAALQTL 357

Query: 359 DKPVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTES 418
           ++ ++T+C  ++ YPQ + +V ++       +S    +A+ E EL G  R+++RASGTE 
Sbjct: 358 NQDLATVCADWQPYPQTMINVRIQKGQKWQEAS-KDVLAEVEKELEGKGRVVLRASGTEP 416

Query: 419 LIRIMAE 425
           ++R+M E
Sbjct: 417 VVRVMVE 423


>gi|294139394|ref|YP_003555372.1| phosphoglucosamine mutase [Shewanella violacea DSS12]
 gi|293325863|dbj|BAJ00594.1| phosphoglucosamine mutase [Shewanella violacea DSS12]
          Length = 452

 Score =  394 bits (1011), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 199/441 (45%), Positives = 303/441 (68%), Gaps = 10/441 (2%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M +++FGTDGIRGK   FPITP+F +++G AVG +  G    + V+IGKDTR SGYMLE+
Sbjct: 1   MNQKYFGTDGIRGKVGNFPITPDFALKLGWAVGKVLAGNGT-QEVLIGKDTRSSGYMLES 59

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           ++ AG +AAG++  ++GP+P+PA+A LT + RA+ GV+ISASHNP+ DNGIK F  +G K
Sbjct: 60  AIEAGLSAAGVNVALVGPMPTPAIAYLTSTFRANAGVVISASHNPFYDNGIKFFSKNGTK 119

Query: 121 VSTDIEDRIETLLEDDLT-SYLSCYDS--IGHAKRVDGVHDRYIEHVKRTLPRDVTLQGL 177
           ++   E  IE LL+  L  + + C +S  +G  +R+D    RYIE  K + P  ++L+GL
Sbjct: 120 LTCAQEQEIEDLLDKALNHNAMQCVESSKLGKVRRIDDAAGRYIEFCKGSFPTKLSLKGL 179

Query: 178 RIVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRAD 237
           ++V+DCANGA+Y+VAP V+ ELGA+V+ I  +PNGININ +CG+T++ SLQ+ V E +AD
Sbjct: 180 KLVIDCANGAAYQVAPAVYRELGAEVIAIHVEPNGININHECGATHMHSLQQAVLEHKAD 239

Query: 238 IGIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFI 297
           IGIALDGD DRV++VD  GA+V+GD+I+ ++AR   ++  L+  G+V T+MSN+GLE  +
Sbjct: 240 IGIALDGDADRVMLVDHCGAVVDGDEILYILARAQQANGTLK-TGVVGTLMSNLGLELAL 298

Query: 298 AGLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQ 357
             + +   R  VGD++++E +  +G+ +GGE SGHI+  ++ +TGDG++A+L+VL+ + +
Sbjct: 299 QAINIPFVRANVGDKFVVEQLLKHGWQLGGENSGHILALNHTTTGDGIIASLKVLKAMLE 358

Query: 358 YDKPVSTICHCFEEYPQFLRSVSVKDTS---ILNSSSIVQAIADAESELRGIDRLIVRAS 414
               ++ +     + PQ L +V V D     +L S  +  A+ + E  L    R+++R S
Sbjct: 359 SGSRLAQLKLGMTKLPQVLINVRVSDKQADDVLLSDIVKNAVNETERSLGTNGRVLLRKS 418

Query: 415 GTESLIRIMAEGDD--LSRIK 433
           GTE LIR+M E  D  L+R K
Sbjct: 419 GTEPLIRVMVEAKDPLLTRAK 439


>gi|188493459|ref|ZP_03000729.1| phosphoglucosamine mutase [Escherichia coli 53638]
 gi|188488658|gb|EDU63761.1| phosphoglucosamine mutase [Escherichia coli 53638]
          Length = 445

 Score =  394 bits (1011), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 210/448 (46%), Positives = 299/448 (66%), Gaps = 10/448 (2%)

Query: 3   RRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSL 62
           R++FGTDGIRG+    PITP+F++++G A G +   +   R+++IGKDTR+SGYMLE++L
Sbjct: 4   RKYFGTDGIRGRVGDAPITPDFVLKLGWAAGKVL-ARHGSRKIIIGKDTRISGYMLESAL 62

Query: 63  VAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVS 122
            AG  AAG+ A   GP+P+PAVA LTR+ RA+ G++ISASHNP+ DNGIK F  DG K+ 
Sbjct: 63  EAGLAAAGLSALFTGPMPTPAVAYLTRTFRAEAGIVISASHNPFYDNGIKFFSIDGTKLP 122

Query: 123 TDIEDRIETLLEDDLTSYLSCYDS--IGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
             +E+ IE  +E ++    SC DS  +G A R+     RYIE  K T P +++L  L+IV
Sbjct: 123 DAVEEAIEAEMEKEI----SCVDSAELGKASRIVDAAGRYIEFCKATFPNELSLSELKIV 178

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           VDCANGA+Y +AP V  ELGA+V+ IG +PNG+NIN + G+T+V +LQ +V   +AD+GI
Sbjct: 179 VDCANGATYHIAPNVLRELGANVIAIGCEPNGVNINAEVGATDVRALQARVLAEKADLGI 238

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           A DGDGDRVI+VD +G  V+GDQIM +IARE +    LRG G V T+MSN+GLE  +  L
Sbjct: 239 AFDGDGDRVIMVDHEGNKVDGDQIMYIIAREGLRQGQLRG-GAVGTLMSNMGLELALKQL 297

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           G+   R +VGDRY++E M+  G+ +G E SGH+IL D  +TGDG+VA LQVL  + +   
Sbjct: 298 GIPFARAKVGDRYVLEKMQEKGWRIGAENSGHVILLDKTTTGDGIVAGLQVLAAMARNHM 357

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTS--ILNSSSIVQAIADAESELRGIDRLIVRASGTES 418
            +  +C   + +PQ L +V     S   L   S+    A+ E+ L    R+++R SGTE 
Sbjct: 358 SLHDLCSGMKMFPQILVNVRYTAGSGDPLEHESVKAVTAEVEAALGNRGRVLLRKSGTEP 417

Query: 419 LIRIMAEGDDLSRIKRIVDDLAKVIPMI 446
           LIR+M EG+D +++ +    +A  +  +
Sbjct: 418 LIRVMVEGEDEAQVTKFAHRIADAVKAV 445


>gi|28871629|ref|NP_794248.1| phosphoglucosamine mutase [Pseudomonas syringae pv. tomato str.
           DC3000]
 gi|81729681|sp|Q87WQ0|GLMM_PSESM RecName: Full=Phosphoglucosamine mutase
 gi|28854881|gb|AAO57943.1| phosphoglucosamine mutase [Pseudomonas syringae pv. tomato str.
           DC3000]
 gi|331016643|gb|EGH96699.1| phosphoglucosamine mutase [Pseudomonas syringae pv. lachrymans str.
           M302278PT]
          Length = 447

 Score =  394 bits (1011), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 195/443 (44%), Positives = 296/443 (66%), Gaps = 6/443 (1%)

Query: 3   RRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSL 62
           R++FGTDGIRG+   FPITP FM+++G A G  FR K    R+++GKDTR+SGYM E++L
Sbjct: 4   RKYFGTDGIRGRVGQFPITPEFMLKLGWAAGMAFR-KMGACRILVGKDTRISGYMFESAL 62

Query: 63  VAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVS 122
            AG +AAG D  +LGP+P+PA+A LTR+  A+ G++ISASHNP+ DNGIK F   G K+ 
Sbjct: 63  EAGLSAAGADVLLLGPMPTPAIAYLTRTFHAEAGIVISASHNPHYDNGIKFFSGQGTKLP 122

Query: 123 TDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVVD 182
            +IE  IE LL+  +T   S  +++G   R++    RYIE  K ++P      GL++V+D
Sbjct: 123 DEIEMMIEELLDAPMTVAES--ENLGKVSRINDAAGRYIEFCKSSVPTSTDFAGLKVVID 180

Query: 183 CANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIAL 242
           CA+GA+YKVAP VF ELGA VVV+  +P+G+NIN DCGST++ +LQ  V    AD+GI  
Sbjct: 181 CAHGATYKVAPNVFRELGAQVVVLSAQPDGLNINKDCGSTHMEALQAAVVAEHADMGIGF 240

Query: 243 DGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLGL 302
           DGDGDRV++VD  G IV+GD+++ +IAR+      L+G G+V T+MSN+GLE  +A   +
Sbjct: 241 DGDGDRVLMVDHTGTIVDGDELLYIIARDLHERGRLQG-GVVGTLMSNLGLELALAEQNI 299

Query: 303 SLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKPV 362
              R  VGDRY++  +    + +GGE SGHI+   + +TGD ++A+LQV+  +++    +
Sbjct: 300 PFVRANVGDRYVIAELLERNWQIGGENSGHIVCFQHATTGDAIIASLQVILALRRSGISL 359

Query: 363 STICHCFEEYPQFLRSVSVKDTSI--LNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
           +       + PQ L +V  + +S+  +   S+ +A A    ++ G  R+++R SGTE L+
Sbjct: 360 AEARLKLRKCPQILINVRFEGSSVDPVTHPSVQEACARVTEQMAGRGRVLLRKSGTEPLV 419

Query: 421 RIMAEGDDLSRIKRIVDDLAKVI 443
           R+M EG+D ++++   ++LAK++
Sbjct: 420 RVMVEGEDEAQVRAYAEELAKLV 442


>gi|221134250|ref|ZP_03560555.1| phosphoglucosamine mutase [Glaciecola sp. HTCC2999]
          Length = 448

 Score =  394 bits (1011), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 199/446 (44%), Positives = 301/446 (67%), Gaps = 10/446 (2%)

Query: 2   KRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENS 61
           +R++FGTDGIRGK  +  I P F+ ++G A G +  GK  ++ V+IGKDTR+SGYMLE++
Sbjct: 3   ERKYFGTDGIRGKVGSSVINPEFVTKLGWAAGKVLAGKGTNK-VLIGKDTRISGYMLESA 61

Query: 62  LVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKV 121
           L +G  AAG++  +LGP+P+PA+A LT++ R++ G++ISASHNPY DNGIK F  +GYK+
Sbjct: 62  LESGLAAAGLNVGLLGPMPTPAIAYLTKTFRSEAGIVISASHNPYYDNGIKFFSANGYKL 121

Query: 122 STDIEDRIETLLEDDLTSYLSCYDS--IGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRI 179
             ++E  IE ++++ +T    C DS  +G A R+D    RYIE  K + P D++L GL+I
Sbjct: 122 DDEVEAAIEAMMDEPMT----CVDSSALGKAMRIDDAAGRYIEFCKGSFPSDLSLTGLKI 177

Query: 180 VVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIG 239
           VVDCA+GA+Y +AP V  ELGA+V+ IG KPNG NIN   G+T++ +    V E +AD+G
Sbjct: 178 VVDCAHGATYHIAPSVLSELGAEVIEIGTKPNGTNINHKVGATSMRACVEAVKEHQADLG 237

Query: 240 IALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAG 299
            ALDGDGDR+++VD +G +V+GDQI+ +IAR+ +    L G G+V T MSN+GLE  +  
Sbjct: 238 FALDGDGDRIMLVDHEGNVVDGDQIIFIIARDALKSGRLSG-GVVGTQMSNLGLEVALDN 296

Query: 300 LGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYD 359
           LG+   R++VGDRY+ME +K   +++GGE SGH++     STGDG+VA LQVL  + + +
Sbjct: 297 LGIPFARSKVGDRYVMELLKEKNWSIGGENSGHVLNLGTISTGDGIVAGLQVLTAMLRSE 356

Query: 360 KPVSTICHCFEEYPQFLRSVSVK--DTSILNSSSIVQAIADAESELRGIDRLIVRASGTE 417
           K + ++     ++PQ L +V  +  +T       ++ ++A+AE+ L    R+++R SGTE
Sbjct: 357 KSLKSLLSGMTKFPQKLINVRYEPSETDYCLDPDVLASVAEAETALGDTGRVLLRKSGTE 416

Query: 418 SLIRIMAEGDDLSRIKRIVDDLAKVI 443
            LIR+M E        +    +A+V+
Sbjct: 417 PLIRVMVEAQSAEDADKWSAHIAQVV 442


>gi|309703602|emb|CBJ02942.1| phosphoglucosamine mutase [Escherichia coli ETEC H10407]
          Length = 445

 Score =  394 bits (1011), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 210/448 (46%), Positives = 298/448 (66%), Gaps = 10/448 (2%)

Query: 3   RRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSL 62
           R++FGTDGIRG+    PITP+F++++G A G +   +   R+++IGKDTR+SGYMLE++L
Sbjct: 4   RKYFGTDGIRGRVGDAPITPDFVLKLGWAAGKVL-ARHGSRKIIIGKDTRISGYMLESAL 62

Query: 63  VAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVS 122
            AG  AAG+ A   GP+P+PAVA LTR+ RA+ G++ISASHNP+ DNGIK F  DG K+ 
Sbjct: 63  EAGLAAAGLSALFTGPMPTPAVAYLTRTFRAEAGIVISASHNPFYDNGIKFFSIDGTKLP 122

Query: 123 TDIEDRIETLLEDDLTSYLSCYDS--IGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
             +E+ IE  +E ++    SC DS  +G A R+     RYIE  K T P +++L  L+IV
Sbjct: 123 DAVEEAIEAEMEKEI----SCVDSAELGKASRIVDAAGRYIEFCKATFPNELSLSELKIV 178

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           VDCANGA+Y +AP V  ELGA+V+ IG +PNG+NIN + G+T+V +LQ +V   +AD+GI
Sbjct: 179 VDCANGATYHIAPNVLRELGANVIAIGCEPNGVNINAEVGATDVRALQARVLAEKADLGI 238

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           A DGDGDRVI+VD +G  V+GDQIM +IARE +    LRG G V T+MSN+GLE  +  L
Sbjct: 239 AFDGDGDRVIMVDHEGNKVDGDQIMYIIAREGLRQGQLRG-GAVGTLMSNMGLELALKQL 297

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           G+   R +VGDRY++E M+  G+ +G E SGH+IL D  +TGDG+VA LQVL  + +   
Sbjct: 298 GIPFARAKVGDRYVLEKMQEKGWRIGAENSGHVILLDKTTTGDGIVAGLQVLAAMARNHM 357

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTS--ILNSSSIVQAIADAESELRGIDRLIVRASGTES 418
            +  +C   + +PQ L +V     S   L   S+    A+ E+ L    R+++R SGTE 
Sbjct: 358 SLHDLCSGMKMFPQILVNVRYTAGSGDPLEHESVKAVTAEVEAALSNRGRVLLRKSGTEP 417

Query: 419 LIRIMAEGDDLSRIKRIVDDLAKVIPMI 446
           LIR+M EG+D +++      +A  +  +
Sbjct: 418 LIRVMVEGEDEAQVTEFAHRIADAVKAV 445


>gi|330877238|gb|EGH11387.1| phosphoglucosamine mutase [Pseudomonas syringae pv. morsprunorum
           str. M302280PT]
 gi|330963970|gb|EGH64230.1| phosphoglucosamine mutase [Pseudomonas syringae pv. actinidiae str.
           M302091]
          Length = 447

 Score =  393 bits (1010), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 195/443 (44%), Positives = 296/443 (66%), Gaps = 6/443 (1%)

Query: 3   RRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSL 62
           R++FGTDGIRG+   FPITP FM+++G A G  FR K    R+++GKDTR+SGYM E++L
Sbjct: 4   RKYFGTDGIRGRVGQFPITPEFMLKLGWAAGMAFR-KMGACRILVGKDTRISGYMFESAL 62

Query: 63  VAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVS 122
            AG +AAG D  +LGP+P+PA+A LTR+  A+ G++ISASHNP+ DNGIK F   G K+ 
Sbjct: 63  EAGLSAAGADVLLLGPMPTPAIAYLTRTFHAEAGIVISASHNPHYDNGIKFFSGQGTKLP 122

Query: 123 TDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVVD 182
            +IE  IE LL+  +T   S  +++G   R++    RYIE  K ++P      GL++V+D
Sbjct: 123 DEIEMMIEELLDAPMTVAES--ENLGKVSRINDAAGRYIEFCKSSVPTSTDFAGLKVVID 180

Query: 183 CANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIAL 242
           CA+GA+YKVAP VF ELGA VVV+  +P+G+NIN DCGST++ +LQ  V    AD+GI  
Sbjct: 181 CAHGATYKVAPNVFRELGAQVVVLSAQPDGLNINKDCGSTHMEALQAAVVAEHADMGIGF 240

Query: 243 DGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLGL 302
           DGDGDRV++VD  G IV+GD+++ +IAR+      L+G G+V T+MSN+GLE  +A   +
Sbjct: 241 DGDGDRVLMVDHTGTIVDGDELLYIIARDLHERGRLQG-GVVGTLMSNLGLELALAEQNI 299

Query: 303 SLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKPV 362
              R  VGDRY++  +    + +GGE SGHI+   + +TGD ++A+LQV+  +++    +
Sbjct: 300 PFVRANVGDRYVIAELLERNWQIGGENSGHIVCFQHATTGDAIIASLQVILALRRSGISL 359

Query: 363 STICHCFEEYPQFLRSVSVKDTSI--LNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
           +       + PQ L +V  + +S+  +   S+ +A A    ++ G  R+++R SGTE L+
Sbjct: 360 AEARLKLRKCPQILINVRFEGSSVDPVTHPSVQEACARVTEQMAGRGRVLLRKSGTEPLV 419

Query: 421 RIMAEGDDLSRIKRIVDDLAKVI 443
           R+M EG+D ++++   ++LAK++
Sbjct: 420 RVMVEGEDETQVRAYAEELAKLV 442


>gi|218691466|ref|YP_002399678.1| phosphoglucosamine mutase [Escherichia coli ED1a]
 gi|254798579|sp|B7N0V9|GLMM_ECO81 RecName: Full=Phosphoglucosamine mutase
 gi|218429030|emb|CAR09977.2| phosphoglucosamine mutase [Escherichia coli ED1a]
          Length = 445

 Score =  393 bits (1010), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 210/448 (46%), Positives = 299/448 (66%), Gaps = 10/448 (2%)

Query: 3   RRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSL 62
           R++FGTDGIRG+    PITP+F++++G A G +   +   R+++IGKDTR+SGYMLE++L
Sbjct: 4   RKYFGTDGIRGRVGDAPITPDFVLKLGWAAGKVL-ARHGSRKIIIGKDTRISGYMLESAL 62

Query: 63  VAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVS 122
            AG  AAG+ A   GP+P+PAVA LTR+ RA+ G++ISASHNP+ DNGIK F  DG K+ 
Sbjct: 63  EAGLAAAGLSALFTGPMPTPAVAYLTRTFRAEAGIVISASHNPFYDNGIKFFSIDGTKLP 122

Query: 123 TDIEDRIETLLEDDLTSYLSCYDS--IGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
             +E+ IE  +E ++    SC DS  +G A R+     RYIE  K T P +++L  L+IV
Sbjct: 123 DAVEEAIEAEMEKEI----SCVDSAELGKASRIVDAAGRYIEFCKATFPNELSLSELKIV 178

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           VDCANGA+Y +AP V  ELGA+V+ IG +PNG+NIN + G+T+V +LQ +V   +AD+GI
Sbjct: 179 VDCANGATYHIAPNVLRELGANVIAIGCEPNGVNINAEVGATDVRALQARVLAEKADLGI 238

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           A DGDGDRVI+VD +G  V+GDQIM +IARE +    LRG G V T+MSN+GLE  +  L
Sbjct: 239 AFDGDGDRVIMVDHEGNKVDGDQIMYIIAREGLRQGQLRG-GAVGTLMSNMGLELALKQL 297

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           G+  +R +VGDRY++E M+  G+ +G E SGH+IL D  +TGDG+VA LQVL  + +   
Sbjct: 298 GIPFERAKVGDRYVLEKMQEKGWRIGAENSGHVILLDKTTTGDGIVAGLQVLAAMARNHM 357

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTS--ILNSSSIVQAIADAESELRGIDRLIVRASGTES 418
            +  +C   + +PQ L +V     S   L   S+    A+ E+ L    R+++R SGTE 
Sbjct: 358 SLHDLCSGMKMFPQILVNVRYTAGSGDPLEHESVKAVTAEVEAALGSRGRVLLRKSGTEP 417

Query: 419 LIRIMAEGDDLSRIKRIVDDLAKVIPMI 446
           LIR+M EG+D +++      +A  +  +
Sbjct: 418 LIRVMVEGEDEAQVTEFAHRIADAVKAV 445


>gi|332535626|ref|ZP_08411390.1| phosphoglucosamine mutase [Pseudoalteromonas haloplanktis ANT/505]
 gi|332034953|gb|EGI71476.1| phosphoglucosamine mutase [Pseudoalteromonas haloplanktis ANT/505]
          Length = 449

 Score =  393 bits (1009), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 196/448 (43%), Positives = 299/448 (66%), Gaps = 8/448 (1%)

Query: 2   KRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENS 61
           +R++FGTDG+RG   T PI P F M++G A G +   +   ++V+IGKDTR+SGYMLE +
Sbjct: 3   ERKYFGTDGVRGLVGTPPINPEFAMKLGWAAGRVLS-QSGTKKVIIGKDTRISGYMLETA 61

Query: 62  LVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKV 121
           L AG  AAG+D  +LGP+P+PAVA L ++ RA+ G++ISASHNPY DNGIK F   G K+
Sbjct: 62  LEAGLIAAGIDVVLLGPMPTPAVAYLAQTFRAEAGIVISASHNPYYDNGIKFFNGQGLKL 121

Query: 122 STDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVV 181
             ++E +IE +L++ +T   S  D +G A R+     RYIE  K   P+ ++L+GL+IVV
Sbjct: 122 DDEVELQIEAMLDEQMTCVAS--DKLGKASRLVSADGRYIEFCKSQFPQGLSLEGLKIVV 179

Query: 182 DCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIA 241
           DCANGA+Y +AP V  ELGA+V+    +PNG+NIN +CG+T+V +L+RKV E +AD+GIA
Sbjct: 180 DCANGATYHIAPSVMRELGAEVITHACEPNGVNINHECGATHVDTLKRKVLEFKADVGIA 239

Query: 242 LDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLG 301
            DGDGDRV++VD  G + +GD ++ +IA +     +L G G+V TVMSN+GLE  +   G
Sbjct: 240 YDGDGDRVMMVDHNGRVFDGDDLVYIIACQAAEDDML-GGGVVGTVMSNMGLENALKAKG 298

Query: 302 LSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKP 361
           +   R++VGDRY+ME ++  G+ +GGE SGH++  D  STGDG++++LQVL  +   ++ 
Sbjct: 299 IEFARSKVGDRYVMELLQQKGWKIGGESSGHVLNLDLISTGDGIISSLQVLAAMVAQNRT 358

Query: 362 VSTICHCFEEYPQFLRSVS-VKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
           +  +   F +YP  + +V     T    +  ++ A+A+ E  L    R+++R SGTE ++
Sbjct: 359 LQDLGAGFTKYPMKMINVRYTAGTDPTKAPEVLSAVAEVELALGDKGRVLLRKSGTEPVV 418

Query: 421 RIMAEGDDLSRIKRIVDDLAKVIPMIDS 448
           R+M E +   + K ++D   K+  +++S
Sbjct: 419 RVMVEAE---QEKIVIDSAQKIAAVVES 443


>gi|152991661|ref|YP_001357382.1| phosphoglucosamine mutase [Sulfurovum sp. NBC37-1]
 gi|158705809|sp|A6Q6B6|GLMM_SULNB RecName: Full=Phosphoglucosamine mutase
 gi|151423522|dbj|BAF71025.1| phosphoglucosamine mutase [Sulfurovum sp. NBC37-1]
          Length = 445

 Score =  393 bits (1009), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 197/436 (45%), Positives = 290/436 (66%), Gaps = 5/436 (1%)

Query: 5   FFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSLVA 64
            FGTDG+RGK+    ++    MR+ +A G  F+   K  ++++GKDTR SGYM+EN+LV+
Sbjct: 3   LFGTDGVRGKAGK-KVSAVNTMRLAMATGIYFKQFAKTNKILVGKDTRRSGYMIENALVS 61

Query: 65  GFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVSTD 124
           G TA G D   +GP+P+PA+A LT ++R D G+MISASHNPY DNGIK F  +G K++  
Sbjct: 62  GLTAVGFDVIQIGPMPTPAIAFLTENMRCDAGIMISASHNPYYDNGIKFFDSEGNKLNRS 121

Query: 125 IEDRIETLLEDD--LTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVVD 182
            E++IE +  DD  L         IG +KR+D V  RYI H+K + P+ ++L G R+V+D
Sbjct: 122 EEEKIEEIFADDDALEDAQVTGKYIGKSKRIDDVIGRYIVHIKNSFPKSLSLAGKRVVID 181

Query: 183 CANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIAL 242
           CANGA Y V P V  ELGA+VVV+GD+P+G NIN  CG+ +  +L + V + RADIG+AL
Sbjct: 182 CANGAGYIVGPTVLQELGAEVVVVGDEPDGFNINEGCGAMHPENLAKVVLDKRADIGLAL 241

Query: 243 DGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLGL 302
           DGD DR+++VDEKG  V+GD++MA++A    +   LRG+G+V TVMSN GLE ++   G+
Sbjct: 242 DGDADRLVVVDEKGETVDGDKLMAVLAVHLKNTGELRGDGMVATVMSNQGLEEYLLEHGI 301

Query: 303 SLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKPV 362
           ++ R+ VGD+ ++E M+  G N GGEQSGHII SDY  TGDG+ +ALQ L Y+       
Sbjct: 302 TVYRSAVGDKNVVEMMQEKGVNFGGEQSGHIIFSDYAKTGDGISSALQALAYLVSTGTKT 361

Query: 363 STICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLIRI 422
           S   + +E YPQ L ++ +++   L S   ++ + + + E  G+ R + R SGTE+ IR+
Sbjct: 362 SEAFNPYESYPQMLVNLPIEEKKPLESIEGLEQLME-QVEAEGM-RHLFRYSGTENKIRL 419

Query: 423 MAEGDDLSRIKRIVDD 438
           + EG +   ++ ++D+
Sbjct: 420 LLEGKNEKALETMMDE 435


>gi|148826007|ref|YP_001290760.1| phosphoglucosamine mutase [Haemophilus influenzae PittEE]
 gi|158705796|sp|A5UC76|GLMM_HAEIE RecName: Full=Phosphoglucosamine mutase
 gi|148716167|gb|ABQ98377.1| predicted phosphomannomutase [Haemophilus influenzae PittEE]
          Length = 445

 Score =  393 bits (1009), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 206/448 (45%), Positives = 299/448 (66%), Gaps = 9/448 (2%)

Query: 3   RRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSL 62
           R++FGTDG+RGK   +PITP+F +++G A G +    +  + V+IGKDTR+SGYMLE++L
Sbjct: 4   RKYFGTDGVRGKVGAYPITPDFALKLGWAAGKVLS-SQGSKMVLIGKDTRISGYMLESAL 62

Query: 63  VAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVS 122
            AG  AAG+ A   GP+P+PA+A LTR+ RA+ G++ISASHNPY DNGIK F   G K+ 
Sbjct: 63  EAGLAAAGLSAAFTGPMPTPAIAYLTRTFRAEAGIVISASHNPYYDNGIKFFSAKGTKLP 122

Query: 123 TDIEDRIETLLEDDLTSYLSCYDS--IGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
            +IE+ IE +LE  +     C +S  +G A R++    RYIE  K T P  + L+G +IV
Sbjct: 123 DEIEEAIEAMLEQPM----DCVESAELGKASRINDAAGRYIEFCKGTFPAHLGLEGYKIV 178

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           +DCANGA+Y +AP VF ELGA+V+ IG  PNG+NIN  CG+T+V +LQ KV E +AD+G+
Sbjct: 179 IDCANGATYHIAPNVFRELGAEVIEIGTDPNGLNINEKCGATDVTALQAKVVETKADVGL 238

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           A DGDGDR+++VD  G  V+GDQI+ +IARE +    L+G G+V T+MSN+ LE  +  L
Sbjct: 239 AYDGDGDRIMMVDHLGNKVDGDQILFIIAREALRSGQLKG-GVVGTLMSNMSLEIALKML 297

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           G+   R  VGDRY++E M  N + +GGE SGHII++D  +TGDG+VA+L VL  + Q+  
Sbjct: 298 GVPFLRANVGDRYVLEKMLENDWTLGGENSGHIIIADKNTTGDGIVASLAVLAAMAQHKL 357

Query: 361 PVSTICHCFEEYPQFLRSVSVK-DTSILNSSSIVQAIADAESELRGIDRLIVRASGTESL 419
            ++ +    + +PQ L +V      + L S ++    A+ E  L G  R+++R SGTE L
Sbjct: 358 SLNELASAVKLFPQVLINVRFAGGENPLESDAVKSVAAEVEKRLEGKGRILLRKSGTEPL 417

Query: 420 IRIMAEGDDLSRIKRIVDDLAKVIPMID 447
           IR+M E  D    ++  +++A+ +  I+
Sbjct: 418 IRVMVECQDAELAQQCAEEIAEAVKKIN 445


>gi|171463558|ref|YP_001797671.1| phosphoglucosamine mutase [Polynucleobacter necessarius subsp.
           necessarius STIR1]
 gi|171193096|gb|ACB44057.1| phosphoglucosamine mutase [Polynucleobacter necessarius subsp.
           necessarius STIR1]
          Length = 450

 Score =  393 bits (1009), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 213/452 (47%), Positives = 290/452 (64%), Gaps = 15/452 (3%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVG-YLFRGKKKHRR--VVIGKDTRLSGYM 57
           MK+++FGTDGIRG+   FPI P FM R+G A G  L R  K   R  V+IGKDTR+SGY+
Sbjct: 4   MKKQYFGTDGIRGEVGQFPIVPEFMTRLGYATGKVLTRAVKPGERCKVLIGKDTRVSGYL 63

Query: 58  LENSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPD 117
           LE SL AGF AAG+D  + GPIP+P VA LT++LR   G++ISASHNPYQDNGIK F  +
Sbjct: 64  LEASLEAGFAAAGVDVMLCGPIPTPGVAYLTKALRLSAGLVISASHNPYQDNGIKFFSAN 123

Query: 118 GYKVSTDIEDRIETLLEDDLTSYLSCYDS--IGHAKRVDGVHDRYIEHVKRTLPRDVTLQ 175
           G K+S D E  IE     +L+S + C  S  +G A R+D    RYIE  K T P ++ L+
Sbjct: 124 GDKLSDDFELAIEA----ELSSPMGCVSSKELGKAFRLDDAAGRYIEFCKSTFPGELNLK 179

Query: 176 GLRIVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVR 235
           GL++VVDCANGA+Y  AP VF ELGA+VV IG  P+G NIN  CG+T   +L  KV E +
Sbjct: 180 GLKLVVDCANGAAYHTAPHVFHELGAEVVAIGVSPDGRNINDGCGATAPATLIAKVKEEK 239

Query: 236 ADIGIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLER 295
           AD+GI LDGD DR+ +VD  G + NGD+++ ++ ++ +      G G V T+M+N+ +E 
Sbjct: 240 ADLGIVLDGDADRLQMVDASGRLFNGDELLYVLVKDRLDRGQQLG-GAVGTLMTNLAVEN 298

Query: 296 FIAGLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYI 355
            I  LG+  +R  VGDRY++E +K NG+ +GGE SGH++  D  STGDG +AALQVL  +
Sbjct: 299 AIRSLGIGFERANVGDRYVLELLKQNGWIIGGEGSGHLLCLDRHSTGDGTIAALQVLAAM 358

Query: 356 KQYDKPVSTICHCFEEYPQFLRSVSVK---DTSILNSSSIVQAIADAESELRGIDRLIVR 412
            Q  K ++ +      YPQ L +V  K   D  +    S+ + I   E +L+GI R+++R
Sbjct: 359 SQNQKSLAQLLASVTVYPQVLLNVRFKLGYDWKL--DESLKKQINKVEMDLKGIGRVLIR 416

Query: 413 ASGTESLIRIMAEGDDLSRIKRIVDDLAKVIP 444
           ASGTE L+R+M E  +          +A +IP
Sbjct: 417 ASGTEPLLRVMVETGNGDVAMCAAKSIADLIP 448


>gi|283788186|ref|YP_003368051.1| phosphoglucosamine mutase [Citrobacter rodentium ICC168]
 gi|282951640|emb|CBG91340.1| phosphoglucosamine mutase [Citrobacter rodentium ICC168]
          Length = 445

 Score =  393 bits (1009), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 209/448 (46%), Positives = 300/448 (66%), Gaps = 10/448 (2%)

Query: 3   RRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSL 62
           R++FGTDGIRG+    PITP+F++++G A G +   +   R+++IGKDTR+SGYMLE++L
Sbjct: 4   RKYFGTDGIRGRVGDAPITPDFVLKLGWAAGKVL-ARHGSRKIIIGKDTRISGYMLESAL 62

Query: 63  VAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVS 122
            AG  AAG+ A   GP+P+PAVA LTR+ RA+ G++ISASHNP+ DNGIK F  DG K+ 
Sbjct: 63  EAGLAAAGLSASFTGPMPTPAVAYLTRTFRAEAGIVISASHNPFYDNGIKFFSIDGTKLP 122

Query: 123 TDIEDRIETLLEDDLTSYLSCYDS--IGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
            D+E+ IE  +E ++T    C DS  +G A R+     RYIE  K T P +++L  L+IV
Sbjct: 123 DDVEEAIEAEMEKEIT----CVDSAELGKASRIVDAAGRYIEFCKGTFPNELSLNELKIV 178

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           VDCANGA+Y +AP V  ELGA V+ IG +PNG+NIN   G+T+V +LQ +V   +AD+GI
Sbjct: 179 VDCANGATYHIAPNVLRELGAKVIAIGCEPNGVNINEQVGATDVRALQARVVAEKADLGI 238

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           ALDGDGDR+I+VD +G  V+GDQIM +IARE +    LRG G V T+MSN+GLE  +  L
Sbjct: 239 ALDGDGDRIIMVDHEGNKVDGDQIMYIIAREALRQGQLRG-GAVGTLMSNMGLELALKQL 297

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           G+   R +VGDRY++E M+  G+ +G E SGH+IL D  +TGDG+VA LQVL  + +   
Sbjct: 298 GIPFTRAKVGDRYVLEKMQEKGWRIGAENSGHVILLDKTTTGDGIVAGLQVLAAMVRNHM 357

Query: 361 PVSTICHCFEEYPQFLRSV--SVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTES 418
            +  +C   + +PQ L +V  +    + L + ++    A+ E+ L    R+++R SGTE 
Sbjct: 358 SLHDLCSGMKMFPQVLVNVRYTAGSGNPLENETVKAVTAEVEAALGNRGRVLLRKSGTEP 417

Query: 419 LIRIMAEGDDLSRIKRIVDDLAKVIPMI 446
           LIR+M EG+D +++      +A  +  +
Sbjct: 418 LIRVMVEGEDEAQVTEFAHRIADAVKAV 445


>gi|119775378|ref|YP_928118.1| phosphoglucosamine mutase [Shewanella amazonensis SB2B]
 gi|158705790|sp|A1S7U2|GLMM2_SHEAM RecName: Full=Phosphoglucosamine mutase 2
 gi|119767878|gb|ABM00449.1| phosphoglucosamine mutase [Shewanella amazonensis SB2B]
          Length = 452

 Score =  393 bits (1009), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 205/456 (44%), Positives = 298/456 (65%), Gaps = 17/456 (3%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M R++FGTDG+RGK   FPITP+F M++G A G +       + V+IGKDTRLSGYMLE+
Sbjct: 1   MSRKYFGTDGVRGKVGEFPITPDFAMKLGWAAGTVMAASGT-KEVIIGKDTRLSGYMLES 59

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           ++ AGF AAG++  + GP+P+PA+A LT + RAD GV+ISASHNPY DNGIK F   G K
Sbjct: 60  AMEAGFCAAGVNVALTGPLPTPAIAYLTSTFRADAGVVISASHNPYYDNGIKFFSNTGTK 119

Query: 121 VSTDIEDRIETLLEDDLTS-YLSCY--DSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGL 177
           ++ + E  IE LL   +    ++C   D +G  +R++    RYIE  K T P  ++L GL
Sbjct: 120 LTDEQELEIERLLVSAIEGGAMTCVASDKLGKVRRINDAAGRYIEFCKGTFPNSLSLTGL 179

Query: 178 RIVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRAD 237
           +IVVD A+GA+Y +A  V+ ELGA+V+ I DKP+GININ  CG+T++ SLQ  V    AD
Sbjct: 180 KIVVDSAHGAAYHIAKNVYRELGAEVISINDKPDGININEHCGATHMDSLQTAVMIHEAD 239

Query: 238 IGIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRG---NGIVTTVMSNIGLE 294
           +GIALDGD DR+++VD KG +++GD ++ L+A+        RG   +G++ T+MSN+G E
Sbjct: 240 LGIALDGDADRLMMVDSKGQVIDGDALLYLLAKSAQQ----RGEQVSGVIGTLMSNLGFE 295

Query: 295 RFIAGLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRY 354
           + +A LG+  KR +VGDRY++E +K  G+ +GGE SGH+++ D+ +TGD +VA+LQVLR 
Sbjct: 296 QALANLGIPFKRAKVGDRYVVELLKETGWRLGGENSGHLLMLDFTTTGDAIVASLQVLRA 355

Query: 355 IKQYDKPVSTICHCFEEYPQFLRSVSVKDTSI--LNSSSIVQAIADAESELRGIDRLIVR 412
           + +    ++        +PQ L +V +   +   L+  S+  A+A AES L    R+++R
Sbjct: 356 LLESGAGLADAITELNMFPQVLINVRLNGNAAVGLSHPSVSDAVATAESALGNDGRVLLR 415

Query: 413 ASGTESLIRIMAEGDDLSRIKR----IVDDLAKVIP 444
            SGTE LIR+M E  D  +  +    I D +  V P
Sbjct: 416 KSGTEPLIRVMVEAKDAVKANQYAELIADAVRAVFP 451


>gi|88860506|ref|ZP_01135144.1| phosphoglucosamine mutase [Pseudoalteromonas tunicata D2]
 gi|88817704|gb|EAR27521.1| phosphoglucosamine mutase [Pseudoalteromonas tunicata D2]
          Length = 450

 Score =  393 bits (1009), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 194/447 (43%), Positives = 302/447 (67%), Gaps = 7/447 (1%)

Query: 3   RRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSL 62
           ++ FGTDG+RG    +PITP F +++G A G +   K   ++V+IGKDTR+SGY+LE SL
Sbjct: 4   KKHFGTDGVRGLVGEYPITPGFALKLGWAAGKVLS-KAGTKKVLIGKDTRISGYLLETSL 62

Query: 63  VAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVS 122
            AG  +AG++  +LGP+P+PAVA LT++ RA+ G++ISASHNP+ DNGIK F   G K+ 
Sbjct: 63  EAGLISAGINVVLLGPMPTPAVAYLTQTFRAEAGIVISASHNPFHDNGIKFFSSQGLKLP 122

Query: 123 TDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVVD 182
            ++E  IE +L++++T   S  + +G A+R++    RYIE  K   P  ++L GL+IVVD
Sbjct: 123 DEVELEIEAMLDEEMTCVSS--ELLGKARRLENADGRYIEFCKSQFPNGMSLAGLKIVVD 180

Query: 183 CANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIAL 242
           CANGA+Y +AP V  ELGA+VV    +PNG+NINL+CG+T+V +L RKV E +AD+GIA 
Sbjct: 181 CANGATYHIAPSVLTELGAEVVSFACQPNGLNINLECGATHVDALVRKVLEEKADVGIAY 240

Query: 243 DGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLGL 302
           DGDGDRV++VD KG + +GD I+ ++A +      L   G+  TVMSN+GLE  +   G+
Sbjct: 241 DGDGDRVMMVDRKGRVFDGDDIVYILACQAQQDGSLGDGGVAGTVMSNMGLENALIQRGI 300

Query: 303 SLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKPV 362
              R++VGDRY+ME +K  G+ +GGE SGHI+  +  +TGDG++++LQVL  +   +K +
Sbjct: 301 PFARSKVGDRYVMELLKEKGWKIGGESSGHILNLNLTTTGDGIISSLQVLAAMIAQNKTL 360

Query: 363 STICHCFEEYPQFLRSVSV-KDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLIR 421
             +   F +YP  + +V   ++T  ++   ++ A+ + E+ L G  R+++R SGTE ++R
Sbjct: 361 EDLGKGFVKYPMKMINVRYPQNTDPVSDERVLAAVQEVETALDGKGRVLLRKSGTEPVVR 420

Query: 422 IMAEGDDLSRIKRIVDDLAKVIPMIDS 448
           +M E +   + K+++D   K+  +++S
Sbjct: 421 VMVEAE---QEKQVLDSAKKIALVVES 444


>gi|253686969|ref|YP_003016159.1| phosphoglucosamine mutase [Pectobacterium carotovorum subsp.
           carotovorum PC1]
 gi|259647724|sp|C6DKI6|GLMM_PECCP RecName: Full=Phosphoglucosamine mutase
 gi|251753547|gb|ACT11623.1| phosphoglucosamine mutase [Pectobacterium carotovorum subsp.
           carotovorum PC1]
          Length = 445

 Score =  393 bits (1009), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 209/442 (47%), Positives = 293/442 (66%), Gaps = 5/442 (1%)

Query: 3   RRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSL 62
           R++FGTDG+RGK    PITP+F++++G A G +   +   R+++IGKDTR+SGYMLE++L
Sbjct: 4   RKYFGTDGVRGKVGDTPITPDFVLKLGWAAGKVL-ARHGSRKIIIGKDTRISGYMLESAL 62

Query: 63  VAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVS 122
            AG  AAG+ A   GP+P+PAVA LTR+ RA+ G++ISASHNPY DNGIK F  DG K+ 
Sbjct: 63  EAGLAAAGLSASFTGPMPTPAVAYLTRTFRAEAGIVISASHNPYYDNGIKFFSIDGTKLP 122

Query: 123 TDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVVD 182
            ++E+ IE  LE  LT   S    +G A R+     RYIE  K T P +++L GL+IVVD
Sbjct: 123 DEVEEAIEAELEKPLTCVESA--ELGKASRIVDAAGRYIEFCKGTFPSELSLNGLKIVVD 180

Query: 183 CANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIAL 242
           CANGA+Y +AP V  ELGA V+ IG +P+G+NIN +CG+T+V  LQ +V   +AD+G+A 
Sbjct: 181 CANGATYHIAPSVLRELGAKVIAIGCEPDGMNINEECGATDVRQLQARVLAEKADVGLAF 240

Query: 243 DGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLGL 302
           DGDGDR+I+VD  G  V+GDQI+ +IARE +    LRG G V T+MSN+GLE  +  LG+
Sbjct: 241 DGDGDRLIMVDHLGNKVDGDQILYIIAREGLRQGQLRG-GAVGTLMSNMGLEVALKQLGI 299

Query: 303 SLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKPV 362
              R +VGDRY++E M+  G+ +G E SGH+IL D  +TGDG++A LQVL  I +    +
Sbjct: 300 PFARAKVGDRYVLEMMQAKGWRIGAENSGHVILLDKTTTGDGVIAGLQVLTAIVRNHMSL 359

Query: 363 STICHCFEEYPQFLRSVSVK-DTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLIR 421
             +C   + +PQ L +V    +   L    + Q   D E EL G  R+++R SGTE LIR
Sbjct: 360 HDLCSGMKLFPQILVNVRFTGENDPLEDKKVQQITQDVEKELAGRGRVLLRKSGTEPLIR 419

Query: 422 IMAEGDDLSRIKRIVDDLAKVI 443
           +M EG+    +  + + +A  +
Sbjct: 420 VMVEGEHEETVIALANRIADAV 441


>gi|145632767|ref|ZP_01788500.1| predicted phosphomannomutase [Haemophilus influenzae 3655]
 gi|144986423|gb|EDJ92989.1| predicted phosphomannomutase [Haemophilus influenzae 3655]
          Length = 445

 Score =  393 bits (1009), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 207/448 (46%), Positives = 300/448 (66%), Gaps = 9/448 (2%)

Query: 3   RRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSL 62
           R++FGTDG+RGK   +PITP+F +++G A G +    +  + V+IGKDTR+SGYMLE++L
Sbjct: 4   RKYFGTDGVRGKVGAYPITPDFALKLGWAAGKVL-ASQGSKMVLIGKDTRISGYMLESAL 62

Query: 63  VAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVS 122
            AG  AAG+ A   GP+P+PA+A LTR+ RA+ G++ISASHNPY DNGIK F   G K+ 
Sbjct: 63  EAGLAAAGLSAAFTGPMPTPAIAYLTRTFRAEAGIVISASHNPYYDNGIKFFSAKGTKLP 122

Query: 123 TDIEDRIETLLEDDLTSYLSCYDS--IGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
            +IE+ IE +LE  +     C +S  +G A R++    RYIE  K T P  + L+G +IV
Sbjct: 123 DEIEEAIEAMLEQPI----DCVESAELGKASRINDAAGRYIEFCKGTFPAHLGLEGYKIV 178

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           VDCANGA+Y +AP VF ELGA+V+ IG  PNG+NIN  CG+T+V +LQ KV E++AD+G+
Sbjct: 179 VDCANGATYHIAPNVFRELGAEVIEIGTDPNGLNINEKCGATDVTALQAKVVEMKADVGL 238

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           A DGDGDR+++VD  G  V+GDQI+ +IARE +    L+G G+V T+MSN+ LE  +  L
Sbjct: 239 AYDGDGDRIMMVDHLGNKVDGDQILFIIAREALRSGQLKG-GVVGTLMSNMSLEIALKML 297

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           G+   R  VGDRY++E M  N + +GGE SGHII++D  +TGDG+VA+L VL  + Q+  
Sbjct: 298 GVPFLRANVGDRYVLEKMLENDWTLGGENSGHIIIADKNTTGDGIVASLAVLAAMAQHKL 357

Query: 361 PVSTICHCFEEYPQFLRSVSVK-DTSILNSSSIVQAIADAESELRGIDRLIVRASGTESL 419
            ++ +    + +PQ L +V      + L S ++    A+ E  L G  R+++R SGTE L
Sbjct: 358 SLNELASAVKLFPQVLINVRFTGGDNPLESDAVKSVAAEVEKRLEGKGRILLRKSGTEPL 417

Query: 420 IRIMAEGDDLSRIKRIVDDLAKVIPMID 447
           IR+M E  D    ++  +++A+ +  I+
Sbjct: 418 IRVMVECQDAELAQQCAEEIAEAVKKIN 445


>gi|15803716|ref|NP_289750.1| phosphoglucosamine mutase [Escherichia coli O157:H7 EDL933]
 gi|15833309|ref|NP_312082.1| phosphoglucosamine mutase [Escherichia coli O157:H7 str. Sakai]
 gi|168749230|ref|ZP_02774252.1| phosphoglucosamine mutase [Escherichia coli O157:H7 str. EC4113]
 gi|168754156|ref|ZP_02779163.1| phosphoglucosamine mutase [Escherichia coli O157:H7 str. EC4401]
 gi|168762141|ref|ZP_02787148.1| phosphoglucosamine mutase [Escherichia coli O157:H7 str. EC4501]
 gi|168769593|ref|ZP_02794600.1| phosphoglucosamine mutase [Escherichia coli O157:H7 str. EC4486]
 gi|168773158|ref|ZP_02798165.1| phosphoglucosamine mutase [Escherichia coli O157:H7 str. EC4196]
 gi|168781318|ref|ZP_02806325.1| phosphoglucosamine mutase [Escherichia coli O157:H7 str. EC4076]
 gi|168786060|ref|ZP_02811067.1| phosphoglucosamine mutase [Escherichia coli O157:H7 str. EC869]
 gi|168797776|ref|ZP_02822783.1| phosphoglucosamine mutase [Escherichia coli O157:H7 str. EC508]
 gi|195938395|ref|ZP_03083777.1| phosphoglucosamine mutase [Escherichia coli O157:H7 str. EC4024]
 gi|208806052|ref|ZP_03248389.1| phosphoglucosamine mutase [Escherichia coli O157:H7 str. EC4206]
 gi|208812169|ref|ZP_03253498.1| phosphoglucosamine mutase [Escherichia coli O157:H7 str. EC4045]
 gi|208821515|ref|ZP_03261835.1| phosphoglucosamine mutase [Escherichia coli O157:H7 str. EC4042]
 gi|209400076|ref|YP_002272646.1| phosphoglucosamine mutase [Escherichia coli O157:H7 str. EC4115]
 gi|217327689|ref|ZP_03443772.1| phosphoglucosamine mutase [Escherichia coli O157:H7 str. TW14588]
 gi|254795125|ref|YP_003079962.1| phosphoglucosamine mutase [Escherichia coli O157:H7 str. TW14359]
 gi|261228187|ref|ZP_05942468.1| phosphoglucosamine mutase [Escherichia coli O157:H7 str. FRIK2000]
 gi|261255043|ref|ZP_05947576.1| phosphoglucosamine mutase [Escherichia coli O157:H7 str. FRIK966]
 gi|81765280|sp|Q8X9L2|GLMM_ECO57 RecName: Full=Phosphoglucosamine mutase
 gi|226722739|sp|B5YS65|GLMM_ECO5E RecName: Full=Phosphoglucosamine mutase
 gi|12517788|gb|AAG58310.1|AE005546_4 similar to phosphoglucomutases and phosphomannomutases [Escherichia
           coli O157:H7 str. EDL933]
 gi|13363528|dbj|BAB37478.1| putative phosphoglucomutase / phosphomannomutase [Escherichia coli
           O157:H7 str. Sakai]
 gi|187770844|gb|EDU34688.1| phosphoglucosamine mutase [Escherichia coli O157:H7 str. EC4196]
 gi|188016364|gb|EDU54486.1| phosphoglucosamine mutase [Escherichia coli O157:H7 str. EC4113]
 gi|189001029|gb|EDU70015.1| phosphoglucosamine mutase [Escherichia coli O157:H7 str. EC4076]
 gi|189358449|gb|EDU76868.1| phosphoglucosamine mutase [Escherichia coli O157:H7 str. EC4401]
 gi|189361423|gb|EDU79842.1| phosphoglucosamine mutase [Escherichia coli O157:H7 str. EC4486]
 gi|189367579|gb|EDU85995.1| phosphoglucosamine mutase [Escherichia coli O157:H7 str. EC4501]
 gi|189373813|gb|EDU92229.1| phosphoglucosamine mutase [Escherichia coli O157:H7 str. EC869]
 gi|189379724|gb|EDU98140.1| phosphoglucosamine mutase [Escherichia coli O157:H7 str. EC508]
 gi|208725853|gb|EDZ75454.1| phosphoglucosamine mutase [Escherichia coli O157:H7 str. EC4206]
 gi|208733446|gb|EDZ82133.1| phosphoglucosamine mutase [Escherichia coli O157:H7 str. EC4045]
 gi|208741638|gb|EDZ89320.1| phosphoglucosamine mutase [Escherichia coli O157:H7 str. EC4042]
 gi|209161476|gb|ACI38909.1| phosphoglucosamine mutase [Escherichia coli O157:H7 str. EC4115]
 gi|209758280|gb|ACI77452.1| putative phosphoglucomutase / phosphomannomutase [Escherichia coli]
 gi|209758282|gb|ACI77453.1| putative phosphoglucomutase / phosphomannomutase [Escherichia coli]
 gi|209758286|gb|ACI77455.1| putative phosphoglucomutase / phosphomannomutase [Escherichia coli]
 gi|217320056|gb|EEC28481.1| phosphoglucosamine mutase [Escherichia coli O157:H7 str. TW14588]
 gi|254594525|gb|ACT73886.1| phosphoglucosamine mutase [Escherichia coli O157:H7 str. TW14359]
 gi|320189529|gb|EFW64188.1| Phosphoglucosamine mutase [Escherichia coli O157:H7 str. EC1212]
 gi|320640247|gb|EFX09819.1| phosphoglucosamine mutase [Escherichia coli O157:H7 str. G5101]
 gi|326337876|gb|EGD61710.1| Phosphoglucosamine mutase [Escherichia coli O157:H7 str. 1125]
 gi|326347446|gb|EGD71171.1| Phosphoglucosamine mutase [Escherichia coli O157:H7 str. 1044]
          Length = 445

 Score =  393 bits (1009), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 210/448 (46%), Positives = 298/448 (66%), Gaps = 10/448 (2%)

Query: 3   RRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSL 62
           R++FGTDGIRG+    PITP+F++++G A G +   +   R+++IGKDTR+SGYMLE++L
Sbjct: 4   RKYFGTDGIRGRVGDAPITPDFVLKLGWAAGKVL-ARHGSRKIIIGKDTRISGYMLESAL 62

Query: 63  VAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVS 122
            AG  AAG+ A   GP+P+PAVA LTR+ RA+ G++ISASHNP+ DNGIK F  DG K+ 
Sbjct: 63  EAGLAAAGLSALFTGPMPTPAVAYLTRTFRAEAGIVISASHNPFYDNGIKFFSIDGTKLP 122

Query: 123 TDIEDRIETLLEDDLTSYLSCYDS--IGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
             +E+ IE  +E ++    SC DS  +G A R+     RYIE  K T P +++L  L+IV
Sbjct: 123 DAVEEAIEAEMEKEI----SCVDSAELGKASRIVDAAGRYIEFCKATFPNELSLSELKIV 178

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           VDCANGA+Y +AP V  ELGA+V+ IG +PNG+NIN + G+T+V +LQ +V   +AD+GI
Sbjct: 179 VDCANGATYHIAPNVLRELGANVIAIGCEPNGVNINAEVGATDVRALQARVLAEKADLGI 238

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           A DGDGDRVI+VD +G  V+GDQIM +IARE +    LRG G V T+MSN+GLE  +  L
Sbjct: 239 AFDGDGDRVIMVDHEGNKVDGDQIMYIIAREGLRQGQLRG-GAVGTLMSNMGLELALKQL 297

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           G+   R +VGDRY++E M+  G+ +G E SGH+IL D  +TGDG+VA LQVL  + +   
Sbjct: 298 GIPFARAKVGDRYVLEKMQEKGWRIGAENSGHVILLDKTTTGDGIVAGLQVLAAMARNHM 357

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTS--ILNSSSIVQAIADAESELRGIDRLIVRASGTES 418
            +  +C   + +PQ L +V     S   L   S+    A+ E+ L    R+++R SGTE 
Sbjct: 358 SLHDLCSGMKMFPQILVNVRYTAGSGDPLEHESVKAVTAEVETALGSRGRVLLRKSGTEP 417

Query: 419 LIRIMAEGDDLSRIKRIVDDLAKVIPMI 446
           LIR+M EG+D +++      +A  +  +
Sbjct: 418 LIRVMVEGEDEAQVTEFAHRIADAVKAV 445


>gi|26249759|ref|NP_755799.1| phosphoglucosamine mutase [Escherichia coli CFT073]
 gi|74313713|ref|YP_312132.1| phosphoglucosamine mutase [Shigella sonnei Ss046]
 gi|91212597|ref|YP_542583.1| phosphoglucosamine mutase [Escherichia coli UTI89]
 gi|110643416|ref|YP_671146.1| phosphoglucosamine mutase [Escherichia coli 536]
 gi|117625470|ref|YP_858793.1| phosphoglucosamine mutase [Escherichia coli APEC O1]
 gi|170684162|ref|YP_001745448.1| phosphoglucosamine mutase [Escherichia coli SMS-3-5]
 gi|191172210|ref|ZP_03033753.1| phosphoglucosamine mutase [Escherichia coli F11]
 gi|194433729|ref|ZP_03066004.1| phosphoglucosamine mutase [Shigella dysenteriae 1012]
 gi|215488492|ref|YP_002330923.1| phosphoglucosamine mutase [Escherichia coli O127:H6 str. E2348/69]
 gi|218560246|ref|YP_002393159.1| phosphoglucosamine mutase [Escherichia coli S88]
 gi|218706796|ref|YP_002414315.1| phosphoglucosamine mutase [Escherichia coli UMN026]
 gi|227887897|ref|ZP_04005702.1| phosphoglucosamine mutase [Escherichia coli 83972]
 gi|237706073|ref|ZP_04536554.1| mrsA [Escherichia sp. 3_2_53FAA]
 gi|291284550|ref|YP_003501368.1| Phosphoglucosamine mutase [Escherichia coli O55:H7 str. CB9615]
 gi|293406785|ref|ZP_06650711.1| glmM [Escherichia coli FVEC1412]
 gi|293416606|ref|ZP_06659245.1| phosphoglucosamine mutase [Escherichia coli B185]
 gi|298382526|ref|ZP_06992123.1| glmM [Escherichia coli FVEC1302]
 gi|300897940|ref|ZP_07116319.1| phosphoglucosamine mutase [Escherichia coli MS 198-1]
 gi|300938086|ref|ZP_07152864.1| phosphoglucosamine mutase [Escherichia coli MS 21-1]
 gi|300980132|ref|ZP_07174852.1| phosphoglucosamine mutase [Escherichia coli MS 200-1]
 gi|301022031|ref|ZP_07185974.1| phosphoglucosamine mutase [Escherichia coli MS 69-1]
 gi|301047981|ref|ZP_07195023.1| phosphoglucosamine mutase [Escherichia coli MS 185-1]
 gi|312968487|ref|ZP_07782696.1| phosphoglucosamine mutase [Escherichia coli 2362-75]
 gi|331648976|ref|ZP_08350064.1| phosphoglucosamine mutase [Escherichia coli M605]
 gi|331654780|ref|ZP_08355780.1| phosphoglucosamine mutase [Escherichia coli M718]
 gi|331659463|ref|ZP_08360405.1| phosphoglucosamine mutase [Escherichia coli TA206]
 gi|331664788|ref|ZP_08365693.1| phosphoglucosamine mutase [Escherichia coli TA143]
 gi|331684823|ref|ZP_08385415.1| phosphoglucosamine mutase [Escherichia coli H299]
 gi|81589990|sp|Q8FD84|GLMM_ECOL6 RecName: Full=Phosphoglucosamine mutase
 gi|84029254|sp|Q3YX65|GLMM_SHISS RecName: Full=Phosphoglucosamine mutase
 gi|122422296|sp|Q1R6G2|GLMM_ECOUT RecName: Full=Phosphoglucosamine mutase
 gi|123343571|sp|Q0TCT4|GLMM_ECOL5 RecName: Full=Phosphoglucosamine mutase
 gi|158512552|sp|A1AG79|GLMM_ECOK1 RecName: Full=Phosphoglucosamine mutase
 gi|226722738|sp|B7MB95|GLMM_ECO45 RecName: Full=Phosphoglucosamine mutase
 gi|226722743|sp|B7NDG0|GLMM_ECOLU RecName: Full=Phosphoglucosamine mutase
 gi|226722745|sp|B1LFS6|GLMM_ECOSM RecName: Full=Phosphoglucosamine mutase
 gi|254798577|sp|B7UJ69|GLMM_ECO27 RecName: Full=Phosphoglucosamine mutase
 gi|26110187|gb|AAN82373.1|AE016767_133 Protein mrsA [Escherichia coli CFT073]
 gi|73857190|gb|AAZ89897.1| MrsA [Shigella sonnei Ss046]
 gi|91074171|gb|ABE09052.1| protein MrsA [Escherichia coli UTI89]
 gi|110345008|gb|ABG71245.1| protein MrsA [Escherichia coli 536]
 gi|115514594|gb|ABJ02669.1| phosphoglucosamine mutase [Escherichia coli APEC O1]
 gi|170521880|gb|ACB20058.1| phosphoglucosamine mutase [Escherichia coli SMS-3-5]
 gi|190907520|gb|EDV67116.1| phosphoglucosamine mutase [Escherichia coli F11]
 gi|194417992|gb|EDX34086.1| phosphoglucosamine mutase [Shigella dysenteriae 1012]
 gi|209758278|gb|ACI77451.1| putative phosphoglucomutase / phosphomannomutase [Escherichia coli]
 gi|209758284|gb|ACI77454.1| putative phosphoglucomutase / phosphomannomutase [Escherichia coli]
 gi|215266564|emb|CAS11003.1| phosphoglucosamine mutase [Escherichia coli O127:H6 str. E2348/69]
 gi|218367015|emb|CAR04786.1| phosphoglucosamine mutase [Escherichia coli S88]
 gi|218433893|emb|CAR14810.1| phosphoglucosamine mutase [Escherichia coli UMN026]
 gi|226899113|gb|EEH85372.1| mrsA [Escherichia sp. 3_2_53FAA]
 gi|227835293|gb|EEJ45759.1| phosphoglucosamine mutase [Escherichia coli 83972]
 gi|281180218|dbj|BAI56548.1| phosphoglucosamine mutase [Escherichia coli SE15]
 gi|284923199|emb|CBG36293.1| phosphoglucosamine mutase [Escherichia coli 042]
 gi|290764423|gb|ADD58384.1| Phosphoglucosamine mutase [Escherichia coli O55:H7 str. CB9615]
 gi|291426791|gb|EFE99823.1| glmM [Escherichia coli FVEC1412]
 gi|291431962|gb|EFF04945.1| phosphoglucosamine mutase [Escherichia coli B185]
 gi|294492751|gb|ADE91507.1| phosphoglucosamine mutase [Escherichia coli IHE3034]
 gi|298277666|gb|EFI19182.1| glmM [Escherichia coli FVEC1302]
 gi|300300124|gb|EFJ56509.1| phosphoglucosamine mutase [Escherichia coli MS 185-1]
 gi|300307854|gb|EFJ62374.1| phosphoglucosamine mutase [Escherichia coli MS 200-1]
 gi|300358370|gb|EFJ74240.1| phosphoglucosamine mutase [Escherichia coli MS 198-1]
 gi|300397746|gb|EFJ81284.1| phosphoglucosamine mutase [Escherichia coli MS 69-1]
 gi|300456946|gb|EFK20439.1| phosphoglucosamine mutase [Escherichia coli MS 21-1]
 gi|307555270|gb|ADN48045.1| phosphoglucosamine mutase [Escherichia coli ABU 83972]
 gi|307625225|gb|ADN69529.1| phosphoglucosamine mutase [Escherichia coli UM146]
 gi|312286705|gb|EFR14616.1| phosphoglucosamine mutase [Escherichia coli 2362-75]
 gi|315288922|gb|EFU48320.1| phosphoglucosamine mutase [Escherichia coli MS 110-3]
 gi|315294922|gb|EFU54261.1| phosphoglucosamine mutase [Escherichia coli MS 153-1]
 gi|315297873|gb|EFU57143.1| phosphoglucosamine mutase [Escherichia coli MS 16-3]
 gi|320181451|gb|EFW56369.1| Phosphoglucosamine mutase [Shigella boydii ATCC 9905]
 gi|320645544|gb|EFX14553.1| phosphoglucosamine mutase [Escherichia coli O157:H- str. 493-89]
 gi|320650854|gb|EFX19311.1| phosphoglucosamine mutase [Escherichia coli O157:H- str. H 2687]
 gi|320656235|gb|EFX24147.1| phosphoglucosamine mutase [Escherichia coli O55:H7 str. 3256-97 TW
           07815]
 gi|320661925|gb|EFX29333.1| phosphoglucosamine mutase [Escherichia coli O55:H7 str. USDA 5905]
 gi|323189203|gb|EFZ74487.1| phosphoglucosamine mutase [Escherichia coli RN587/1]
 gi|323951305|gb|EGB47180.1| phosphoglucosamine mutase [Escherichia coli H252]
 gi|323957677|gb|EGB53391.1| phosphoglucosamine mutase [Escherichia coli H263]
 gi|323966356|gb|EGB61790.1| phosphoglucosamine mutase [Escherichia coli M863]
 gi|323979107|gb|EGB74185.1| phosphoglucosamine mutase [Escherichia coli TW10509]
 gi|324012097|gb|EGB81316.1| phosphoglucosamine mutase [Escherichia coli MS 60-1]
 gi|324115220|gb|EGC09184.1| phosphoglucosamine mutase [Escherichia fergusonii B253]
 gi|327251267|gb|EGE62956.1| phosphoglucosamine mutase [Escherichia coli STEC_7v]
 gi|330909230|gb|EGH37744.1| phosphoglucosamine mutase [Escherichia coli AA86]
 gi|331042723|gb|EGI14865.1| phosphoglucosamine mutase [Escherichia coli M605]
 gi|331048162|gb|EGI20239.1| phosphoglucosamine mutase [Escherichia coli M718]
 gi|331054045|gb|EGI26074.1| phosphoglucosamine mutase [Escherichia coli TA206]
 gi|331058036|gb|EGI30018.1| phosphoglucosamine mutase [Escherichia coli TA143]
 gi|331078438|gb|EGI49644.1| phosphoglucosamine mutase [Escherichia coli H299]
 gi|332086393|gb|EGI91540.1| phosphoglucosamine mutase [Shigella dysenteriae 155-74]
          Length = 445

 Score =  393 bits (1009), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 210/448 (46%), Positives = 298/448 (66%), Gaps = 10/448 (2%)

Query: 3   RRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSL 62
           R++FGTDGIRG+    PITP+F++++G A G +   +   R+++IGKDTR+SGYMLE++L
Sbjct: 4   RKYFGTDGIRGRVGDAPITPDFVLKLGWAAGKVL-ARHGSRKIIIGKDTRISGYMLESAL 62

Query: 63  VAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVS 122
            AG  AAG+ A   GP+P+PAVA LTR+ RA+ G++ISASHNP+ DNGIK F  DG K+ 
Sbjct: 63  EAGLAAAGLSALFTGPMPTPAVAYLTRTFRAEAGIVISASHNPFYDNGIKFFSIDGTKLP 122

Query: 123 TDIEDRIETLLEDDLTSYLSCYDS--IGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
             +E+ IE  +E ++    SC DS  +G A R+     RYIE  K T P +++L  L+IV
Sbjct: 123 DAVEEAIEAEMEKEI----SCVDSAELGKASRIVDAAGRYIEFCKATFPNELSLSELKIV 178

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           VDCANGA+Y +AP V  ELGA+V+ IG +PNG+NIN + G+T+V +LQ +V   +AD+GI
Sbjct: 179 VDCANGATYHIAPNVLRELGANVIAIGCEPNGVNINAEVGATDVRALQARVLAEKADLGI 238

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           A DGDGDRVI+VD +G  V+GDQIM +IARE +    LRG G V T+MSN+GLE  +  L
Sbjct: 239 AFDGDGDRVIMVDHEGNKVDGDQIMYIIAREGLRQGQLRG-GAVGTLMSNMGLELALKQL 297

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           G+   R +VGDRY++E M+  G+ +G E SGH+IL D  +TGDG+VA LQVL  + +   
Sbjct: 298 GIPFARAKVGDRYVLEKMQEKGWRIGAENSGHVILLDKTTTGDGIVAGLQVLAAMARNHM 357

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTS--ILNSSSIVQAIADAESELRGIDRLIVRASGTES 418
            +  +C   + +PQ L +V     S   L   S+    A+ E+ L    R+++R SGTE 
Sbjct: 358 SLHDLCSGMKMFPQILVNVRYTAGSGDPLEHESVKAVTAEVEAALGSRGRVLLRKSGTEP 417

Query: 419 LIRIMAEGDDLSRIKRIVDDLAKVIPMI 446
           LIR+M EG+D +++      +A  +  +
Sbjct: 418 LIRVMVEGEDEAQVTEFAHRIADAVKAV 445


>gi|218701945|ref|YP_002409574.1| phosphoglucosamine mutase [Escherichia coli IAI39]
 gi|226722740|sp|B7NKP3|GLMM_ECO7I RecName: Full=Phosphoglucosamine mutase
 gi|218371931|emb|CAR19787.1| phosphoglucosamine mutase [Escherichia coli IAI39]
          Length = 445

 Score =  393 bits (1009), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 210/448 (46%), Positives = 298/448 (66%), Gaps = 10/448 (2%)

Query: 3   RRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSL 62
           R++FGTDGIRG+    PITP+F++++G A G +   +   R+++IGKDTR+SGYMLE++L
Sbjct: 4   RKYFGTDGIRGRVGDAPITPDFVLKLGWAAGKVL-ARHGSRKIIIGKDTRISGYMLESAL 62

Query: 63  VAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVS 122
            AG  AAG+ A   GP+P+PAVA LTR+ RA+ G++ISASHNP+ DNGIK F  DG K+ 
Sbjct: 63  EAGLAAAGLSALFTGPMPTPAVAYLTRTFRAEAGIVISASHNPFYDNGIKFFSIDGTKLP 122

Query: 123 TDIEDRIETLLEDDLTSYLSCYDS--IGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
             +E+ IE  +E ++    SC DS  +G A R+     RYIE  K T P +++L  L+IV
Sbjct: 123 DAVEEAIEAEMEKEI----SCVDSAELGKASRIVDAAGRYIEFCKATFPNELSLSELKIV 178

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           VDCANGA+Y +AP V  ELGA+V+ IG +PNG+NIN + G+T+V +LQ +V   +AD+GI
Sbjct: 179 VDCANGATYHIAPNVLRELGANVIAIGCEPNGVNINAEVGATDVRALQARVLAEKADLGI 238

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           A DGDGDRVI+VD +G  V+GDQIM +IARE +    LRG G V T+MSN+GLE  +  L
Sbjct: 239 AFDGDGDRVIMVDHEGNKVDGDQIMYIIAREGLRQGQLRG-GAVGTLMSNMGLELALKQL 297

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           G+   R +VGDRY++E M+  G+ +G E SGH+IL D  +TGDG+VA LQVL  + +   
Sbjct: 298 GIPFARAKVGDRYVLEKMQEKGWRIGAENSGHVILLDKTTTGDGIVAGLQVLAAMARNHM 357

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTS--ILNSSSIVQAIADAESELRGIDRLIVRASGTES 418
            +  +C   + +PQ L +V     S   L   S+    A+ E+ L    R+++R SGTE 
Sbjct: 358 SLHDLCSGMKMFPQILVNVRYTADSGDPLEHESVKAVTAEVEAALGSRGRVLLRKSGTEP 417

Query: 419 LIRIMAEGDDLSRIKRIVDDLAKVIPMI 446
           LIR+M EG+D +++      +A  +  +
Sbjct: 418 LIRVMVEGEDEAQVTEFAHRIADAVKAV 445


>gi|255065041|ref|ZP_05316896.1| phosphoglucosamine mutase [Neisseria sicca ATCC 29256]
 gi|261365203|ref|ZP_05978086.1| phosphoglucosamine mutase [Neisseria mucosa ATCC 25996]
 gi|255050462|gb|EET45926.1| phosphoglucosamine mutase [Neisseria sicca ATCC 29256]
 gi|288566464|gb|EFC88024.1| phosphoglucosamine mutase [Neisseria mucosa ATCC 25996]
          Length = 445

 Score =  393 bits (1009), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 200/445 (44%), Positives = 296/445 (66%), Gaps = 6/445 (1%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRR--VVIGKDTRLSGYML 58
           M +++FGTDG+RG+   FPITP+F++++G A G +       ++  V+IGKDTR+SGYML
Sbjct: 1   MAKKYFGTDGVRGEVGQFPITPDFVLKLGYAAGQVLVQHDGGQKPTVLIGKDTRISGYML 60

Query: 59  ENSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDG 118
           E +LVAGFTAAG++    GP+P+P VA LTR+LR   GVMISASHN Y DNGIK F   G
Sbjct: 61  EAALVAGFTAAGVNVIQTGPLPTPGVAYLTRALRLSAGVMISASHNVYSDNGIKFFAEGG 120

Query: 119 YKVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLR 178
            K+S +IE  IE  +++++ +  S    +G A+R++G  DRYIE  K T P  + L+GL+
Sbjct: 121 VKLSDEIELEIEAKIDEEMKTQPSA--RLGRARRINGADDRYIEFCKSTFPSHLDLRGLK 178

Query: 179 IVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADI 238
           +VVD A+GA Y VAP+VF ELGA VV IGD+PNG NIN  CG+T+  +LQ  V +  AD 
Sbjct: 179 LVVDTAHGAGYDVAPKVFHELGAQVVSIGDEPNGYNINEKCGATHPKALQAAVLQNEADY 238

Query: 239 GIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIA 298
           GIALDGDGDR+++VD  G + +GD ++ +IA+      +  G G+V TVM+N+ +E  + 
Sbjct: 239 GIALDGDGDRLMMVDRNGKVYDGDSLIYVIAKARAREGINIG-GVVGTVMTNMAMEIALK 297

Query: 299 GLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQY 358
             G+   R +VGDRY++E +   G+ +GGE SGHI+  D  +TGDG+++ALQVL  ++  
Sbjct: 298 EQGVDFCRAKVGDRYVLEQLNQRGWLIGGEASGHILCMDKHNTGDGIISALQVLAALQIL 357

Query: 359 DKPVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTES 418
           ++ ++T+C  ++ YPQ + +V ++       +S    +A+ E EL G  R+++RASGTE 
Sbjct: 358 NQDLATVCADWQPYPQTMINVRIQKGQKWQEAS-KDVLAEVEKELEGKGRVVLRASGTEP 416

Query: 419 LIRIMAEGDDLSRIKRIVDDLAKVI 443
           ++R+M E       K+  + +A  I
Sbjct: 417 VVRVMVEARQADWAKKGAERIAAAI 441


>gi|16131066|ref|NP_417643.1| phosphoglucosamine mutase [Escherichia coli str. K-12 substr.
           MG1655]
 gi|30064514|ref|NP_838685.1| phosphoglucosamine mutase [Shigella flexneri 2a str. 2457T]
 gi|89109939|ref|AP_003719.1| phosphoglucosamine mutase [Escherichia coli str. K-12 substr.
           W3110]
 gi|157155381|ref|YP_001464651.1| phosphoglucosamine mutase [Escherichia coli E24377A]
 gi|157162659|ref|YP_001459977.1| phosphoglucosamine mutase [Escherichia coli HS]
 gi|170018574|ref|YP_001723528.1| phosphoglucosamine mutase [Escherichia coli ATCC 8739]
 gi|170082711|ref|YP_001732031.1| phosphoglucosamine mutase [Escherichia coli str. K-12 substr.
           DH10B]
 gi|187732448|ref|YP_001881909.1| phosphoglucosamine mutase [Shigella boydii CDC 3083-94]
 gi|191168039|ref|ZP_03029839.1| phosphoglucosamine mutase [Escherichia coli B7A]
 gi|193062105|ref|ZP_03043201.1| phosphoglucosamine mutase [Escherichia coli E22]
 gi|194430228|ref|ZP_03062726.1| phosphoglucosamine mutase [Escherichia coli B171]
 gi|194438765|ref|ZP_03070851.1| phosphoglucosamine mutase [Escherichia coli 101-1]
 gi|209920651|ref|YP_002294735.1| phosphoglucosamine mutase [Escherichia coli SE11]
 gi|218555746|ref|YP_002388659.1| phosphoglucosamine mutase [Escherichia coli IAI1]
 gi|238902278|ref|YP_002928074.1| phosphoglucosamine mutase [Escherichia coli BW2952]
 gi|253771990|ref|YP_003034821.1| phosphoglucosamine mutase [Escherichia coli 'BL21-Gold(DE3)pLysS
           AG']
 gi|254038341|ref|ZP_04872399.1| phosphoglucosamine mutase [Escherichia sp. 1_1_43]
 gi|254163118|ref|YP_003046226.1| phosphoglucosamine mutase [Escherichia coli B str. REL606]
 gi|256018905|ref|ZP_05432770.1| phosphoglucosamine mutase [Shigella sp. D9]
 gi|256024249|ref|ZP_05438114.1| phosphoglucosamine mutase [Escherichia sp. 4_1_40B]
 gi|260845989|ref|YP_003223767.1| phosphoglucosamine mutase [Escherichia coli O103:H2 str. 12009]
 gi|260857303|ref|YP_003231194.1| phosphoglucosamine mutase [Escherichia coli O26:H11 str. 11368]
 gi|260869927|ref|YP_003236329.1| phosphoglucosamine mutase [Escherichia coli O111:H- str. 11128]
 gi|293412548|ref|ZP_06655271.1| phosphoglucosamine mutase [Escherichia coli B354]
 gi|300817572|ref|ZP_07097788.1| phosphoglucosamine mutase [Escherichia coli MS 107-1]
 gi|300823861|ref|ZP_07103985.1| phosphoglucosamine mutase [Escherichia coli MS 119-7]
 gi|300904361|ref|ZP_07122214.1| phosphoglucosamine mutase [Escherichia coli MS 84-1]
 gi|300918932|ref|ZP_07135491.1| phosphoglucosamine mutase [Escherichia coli MS 115-1]
 gi|300926085|ref|ZP_07141903.1| phosphoglucosamine mutase [Escherichia coli MS 182-1]
 gi|300929866|ref|ZP_07145312.1| phosphoglucosamine mutase [Escherichia coli MS 187-1]
 gi|300948825|ref|ZP_07162893.1| phosphoglucosamine mutase [Escherichia coli MS 116-1]
 gi|300955761|ref|ZP_07168106.1| phosphoglucosamine mutase [Escherichia coli MS 175-1]
 gi|301025980|ref|ZP_07189462.1| phosphoglucosamine mutase [Escherichia coli MS 196-1]
 gi|301301767|ref|ZP_07207901.1| phosphoglucosamine mutase [Escherichia coli MS 124-1]
 gi|301326402|ref|ZP_07219756.1| phosphoglucosamine mutase [Escherichia coli MS 78-1]
 gi|301644886|ref|ZP_07244858.1| phosphoglucosamine mutase [Escherichia coli MS 146-1]
 gi|307139862|ref|ZP_07499218.1| phosphoglucosamine mutase [Escherichia coli H736]
 gi|307313119|ref|ZP_07592745.1| phosphoglucosamine mutase [Escherichia coli W]
 gi|309793753|ref|ZP_07688179.1| phosphoglucosamine mutase [Escherichia coli MS 145-7]
 gi|312972550|ref|ZP_07786724.1| phosphoglucosamine mutase [Escherichia coli 1827-70]
 gi|331643874|ref|ZP_08345005.1| phosphoglucosamine mutase [Escherichia coli H736]
 gi|331670003|ref|ZP_08370848.1| phosphoglucosamine mutase [Escherichia coli TA271]
 gi|331679255|ref|ZP_08379927.1| phosphoglucosamine mutase [Escherichia coli H591]
 gi|332279994|ref|ZP_08392407.1| phosphoglucosamine mutase [Shigella sp. D9]
 gi|401561|sp|P31120|GLMM_ECOLI RecName: Full=Phosphoglucosamine mutase
 gi|166990413|sp|A7ZS72|GLMM_ECO24 RecName: Full=Phosphoglucosamine mutase
 gi|166990414|sp|A8A4Z0|GLMM_ECOHS RecName: Full=Phosphoglucosamine mutase
 gi|189040784|sp|B1IQU7|GLMM_ECOLC RecName: Full=Phosphoglucosamine mutase
 gi|226722741|sp|B7M082|GLMM_ECO8A RecName: Full=Phosphoglucosamine mutase
 gi|226722742|sp|B1XGY6|GLMM_ECODH RecName: Full=Phosphoglucosamine mutase
 gi|226722744|sp|B6I1P9|GLMM_ECOSE RecName: Full=Phosphoglucosamine mutase
 gi|226723921|sp|B2U201|GLMM_SHIB3 RecName: Full=Phosphoglucosamine mutase
 gi|259647718|sp|C4ZSR5|GLMM_ECOBW RecName: Full=Phosphoglucosamine mutase
 gi|290443|gb|AAA16122.1| putative [Escherichia coli]
 gi|606114|gb|AAA57977.1| yhbF [Escherichia coli str. K-12 substr. MG1655]
 gi|1789566|gb|AAC76208.1| phosphoglucosamine mutase [Escherichia coli str. K-12 substr.
           MG1655]
 gi|30042773|gb|AAP18496.1| putative phosphoglucomutase [Shigella flexneri 2a str. 2457T]
 gi|73671320|gb|AAZ80071.1| GlmM [Escherichia coli LW1655F+]
 gi|85675970|dbj|BAE77220.1| phosphoglucosamine mutase [Escherichia coli str. K12 substr. W3110]
 gi|157068339|gb|ABV07594.1| phosphoglucosamine mutase [Escherichia coli HS]
 gi|157077411|gb|ABV17119.1| phosphoglucosamine mutase [Escherichia coli E24377A]
 gi|169753502|gb|ACA76201.1| phosphoglucosamine mutase [Escherichia coli ATCC 8739]
 gi|169890546|gb|ACB04253.1| phosphoglucosamine mutase [Escherichia coli str. K-12 substr.
           DH10B]
 gi|187429440|gb|ACD08714.1| phosphoglucosamine mutase [Shigella boydii CDC 3083-94]
 gi|190901908|gb|EDV61657.1| phosphoglucosamine mutase [Escherichia coli B7A]
 gi|192932325|gb|EDV84923.1| phosphoglucosamine mutase [Escherichia coli E22]
 gi|194411729|gb|EDX28053.1| phosphoglucosamine mutase [Escherichia coli B171]
 gi|194422237|gb|EDX38238.1| phosphoglucosamine mutase [Escherichia coli 101-1]
 gi|209913910|dbj|BAG78984.1| phosphoglucosamine mutase [Escherichia coli SE11]
 gi|218362514|emb|CAR00138.1| phosphoglucosamine mutase [Escherichia coli IAI1]
 gi|226839965|gb|EEH71986.1| phosphoglucosamine mutase [Escherichia sp. 1_1_43]
 gi|238862042|gb|ACR64040.1| phosphoglucosamine mutase [Escherichia coli BW2952]
 gi|242378719|emb|CAQ33509.1| phosphoglucosamine mutase [Escherichia coli BL21(DE3)]
 gi|253323034|gb|ACT27636.1| phosphoglucosamine mutase [Escherichia coli 'BL21-Gold(DE3)pLysS
           AG']
 gi|253975019|gb|ACT40690.1| phosphoglucosamine mutase [Escherichia coli B str. REL606]
 gi|253979175|gb|ACT44845.1| phosphoglucosamine mutase [Escherichia coli BL21(DE3)]
 gi|257755952|dbj|BAI27454.1| phosphoglucosamine mutase [Escherichia coli O26:H11 str. 11368]
 gi|257761136|dbj|BAI32633.1| phosphoglucosamine mutase [Escherichia coli O103:H2 str. 12009]
 gi|257766283|dbj|BAI37778.1| phosphoglucosamine mutase [Escherichia coli O111:H- str. 11128]
 gi|260447797|gb|ACX38219.1| phosphoglucosamine mutase [Escherichia coli DH1]
 gi|281602559|gb|ADA75543.1| Phosphoglucosamine mutase [Shigella flexneri 2002017]
 gi|291469319|gb|EFF11810.1| phosphoglucosamine mutase [Escherichia coli B354]
 gi|299879875|gb|EFI88086.1| phosphoglucosamine mutase [Escherichia coli MS 196-1]
 gi|300317394|gb|EFJ67178.1| phosphoglucosamine mutase [Escherichia coli MS 175-1]
 gi|300403712|gb|EFJ87250.1| phosphoglucosamine mutase [Escherichia coli MS 84-1]
 gi|300413958|gb|EFJ97268.1| phosphoglucosamine mutase [Escherichia coli MS 115-1]
 gi|300417850|gb|EFK01161.1| phosphoglucosamine mutase [Escherichia coli MS 182-1]
 gi|300451714|gb|EFK15334.1| phosphoglucosamine mutase [Escherichia coli MS 116-1]
 gi|300462228|gb|EFK25721.1| phosphoglucosamine mutase [Escherichia coli MS 187-1]
 gi|300523629|gb|EFK44698.1| phosphoglucosamine mutase [Escherichia coli MS 119-7]
 gi|300529870|gb|EFK50932.1| phosphoglucosamine mutase [Escherichia coli MS 107-1]
 gi|300842748|gb|EFK70508.1| phosphoglucosamine mutase [Escherichia coli MS 124-1]
 gi|300846891|gb|EFK74651.1| phosphoglucosamine mutase [Escherichia coli MS 78-1]
 gi|301076831|gb|EFK91637.1| phosphoglucosamine mutase [Escherichia coli MS 146-1]
 gi|306907030|gb|EFN37538.1| phosphoglucosamine mutase [Escherichia coli W]
 gi|308122710|gb|EFO59972.1| phosphoglucosamine mutase [Escherichia coli MS 145-7]
 gi|310334927|gb|EFQ01132.1| phosphoglucosamine mutase [Escherichia coli 1827-70]
 gi|313648582|gb|EFS13024.1| phosphoglucosamine mutase [Shigella flexneri 2a str. 2457T]
 gi|315062482|gb|ADT76809.1| phosphoglucosamine mutase [Escherichia coli W]
 gi|315137762|dbj|BAJ44921.1| phosphoglucosamine mutase [Escherichia coli DH1]
 gi|315257101|gb|EFU37069.1| phosphoglucosamine mutase [Escherichia coli MS 85-1]
 gi|315617259|gb|EFU97868.1| phosphoglucosamine mutase [Escherichia coli 3431]
 gi|320174540|gb|EFW49676.1| Phosphoglucosamine mutase [Shigella dysenteriae CDC 74-1112]
 gi|320186663|gb|EFW61387.1| Phosphoglucosamine mutase [Shigella flexneri CDC 796-83]
 gi|320202090|gb|EFW76665.1| Phosphoglucosamine mutase [Escherichia coli EC4100B]
 gi|323154389|gb|EFZ40590.1| phosphoglucosamine mutase [Escherichia coli EPECa14]
 gi|323162868|gb|EFZ48703.1| phosphoglucosamine mutase [Escherichia coli E128010]
 gi|323173564|gb|EFZ59193.1| phosphoglucosamine mutase [Escherichia coli LT-68]
 gi|323178648|gb|EFZ64224.1| phosphoglucosamine mutase [Escherichia coli 1180]
 gi|323183130|gb|EFZ68528.1| phosphoglucosamine mutase [Escherichia coli 1357]
 gi|323376930|gb|ADX49198.1| phosphoglucosamine mutase [Escherichia coli KO11]
 gi|323936130|gb|EGB32424.1| phosphoglucosamine mutase [Escherichia coli E1520]
 gi|323941724|gb|EGB37903.1| phosphoglucosamine mutase [Escherichia coli E482]
 gi|323946970|gb|EGB42986.1| phosphoglucosamine mutase [Escherichia coli H120]
 gi|323961169|gb|EGB56783.1| phosphoglucosamine mutase [Escherichia coli H489]
 gi|323970261|gb|EGB65532.1| phosphoglucosamine mutase [Escherichia coli TA007]
 gi|324018299|gb|EGB87518.1| phosphoglucosamine mutase [Escherichia coli MS 117-3]
 gi|331037345|gb|EGI09569.1| phosphoglucosamine mutase [Escherichia coli H736]
 gi|331062916|gb|EGI34830.1| phosphoglucosamine mutase [Escherichia coli TA271]
 gi|331073320|gb|EGI44643.1| phosphoglucosamine mutase [Escherichia coli H591]
 gi|332102346|gb|EGJ05692.1| phosphoglucosamine mutase [Shigella sp. D9]
 gi|332345132|gb|AEE58466.1| phosphoglucosamine mutase GlmM [Escherichia coli UMNK88]
 gi|332752335|gb|EGJ82725.1| phosphoglucosamine mutase [Shigella flexneri 4343-70]
 gi|332752861|gb|EGJ83246.1| phosphoglucosamine mutase [Shigella flexneri K-671]
 gi|332754403|gb|EGJ84769.1| phosphoglucosamine mutase [Shigella flexneri 2747-71]
 gi|332765172|gb|EGJ95399.1| phosphoglucosamine mutase [Shigella flexneri 2930-71]
 gi|333000110|gb|EGK19693.1| phosphoglucosamine mutase [Shigella flexneri K-218]
 gi|333014558|gb|EGK33905.1| phosphoglucosamine mutase [Shigella flexneri K-304]
          Length = 445

 Score =  392 bits (1008), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 210/448 (46%), Positives = 298/448 (66%), Gaps = 10/448 (2%)

Query: 3   RRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSL 62
           R++FGTDGIRG+    PITP+F++++G A G +   +   R+++IGKDTR+SGYMLE++L
Sbjct: 4   RKYFGTDGIRGRVGDAPITPDFVLKLGWAAGKVL-ARHGSRKIIIGKDTRISGYMLESAL 62

Query: 63  VAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVS 122
            AG  AAG+ A   GP+P+PAVA LTR+ RA+ G++ISASHNP+ DNGIK F  DG K+ 
Sbjct: 63  EAGLAAAGLSALFTGPMPTPAVAYLTRTFRAEAGIVISASHNPFYDNGIKFFSIDGTKLP 122

Query: 123 TDIEDRIETLLEDDLTSYLSCYDS--IGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
             +E+ IE  +E ++    SC DS  +G A R+     RYIE  K T P +++L  L+IV
Sbjct: 123 DAVEEAIEAEMEKEI----SCVDSAELGKASRIVDAAGRYIEFCKATFPNELSLSELKIV 178

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           VDCANGA+Y +AP V  ELGA+V+ IG +PNG+NIN + G+T+V +LQ +V   +AD+GI
Sbjct: 179 VDCANGATYHIAPNVLRELGANVIAIGCEPNGVNINAEVGATDVRALQARVLAEKADLGI 238

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           A DGDGDRVI+VD +G  V+GDQIM +IARE +    LRG G V T+MSN+GLE  +  L
Sbjct: 239 AFDGDGDRVIMVDHEGNKVDGDQIMYIIAREGLRQGQLRG-GAVGTLMSNMGLELALKQL 297

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           G+   R +VGDRY++E M+  G+ +G E SGH+IL D  +TGDG+VA LQVL  + +   
Sbjct: 298 GIPFARAKVGDRYVLEKMQEKGWRIGAENSGHVILLDKTTTGDGIVAGLQVLAAMARNHM 357

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTS--ILNSSSIVQAIADAESELRGIDRLIVRASGTES 418
            +  +C   + +PQ L +V     S   L   S+    A+ E+ L    R+++R SGTE 
Sbjct: 358 SLHDLCSGMKMFPQILVNVRYTAGSGDPLEHESVKAVTAEVEAALGNRGRVLLRKSGTEP 417

Query: 419 LIRIMAEGDDLSRIKRIVDDLAKVIPMI 446
           LIR+M EG+D +++      +A  +  +
Sbjct: 418 LIRVMVEGEDEAQVTEFAHRIADAVKAV 445


>gi|238755152|ref|ZP_04616498.1| Phosphoglucosamine mutase [Yersinia ruckeri ATCC 29473]
 gi|238706599|gb|EEP98970.1| Phosphoglucosamine mutase [Yersinia ruckeri ATCC 29473]
          Length = 446

 Score =  392 bits (1008), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 213/445 (47%), Positives = 297/445 (66%), Gaps = 10/445 (2%)

Query: 3   RRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSL 62
           R++FGTDGIRGK    PITP F++++G A G +   +   R+++IGKDTR+SGYMLE++L
Sbjct: 4   RKYFGTDGIRGKVGDNPITPEFVLKLGWAAGKVL-ARHGSRKIIIGKDTRISGYMLESAL 62

Query: 63  VAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVS 122
            AG  AAG+ A   GP+P+PAVA LTR+ RA+ G++ISASHNP+ DNGIK F  DG K+ 
Sbjct: 63  EAGLAAAGLSASFTGPMPTPAVAYLTRAFRAEAGIVISASHNPFYDNGIKFFDIDGAKLP 122

Query: 123 TDIEDRIETLLEDDLTSYLSCYDS--IGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
            ++E+ IE  +E  LT    C +S  +G A R+     RYIE  K T P ++ L GL+IV
Sbjct: 123 DEVEEAIEAEMEKPLT----CVESSELGKASRIVDAAGRYIEFCKGTFPNELNLNGLKIV 178

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           VDCANGA+Y +AP V  ELGA V+ IG +PNG+NIN +CG+T+V  LQ +V   +A +G+
Sbjct: 179 VDCANGATYHIAPSVLRELGATVISIGCEPNGMNINEECGATDVRMLQERVLAEKAHVGL 238

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           A DGDGDR+++VD  G  V+GDQI+ +IARE +    L+G G V T+MSN+GLE  +  L
Sbjct: 239 AFDGDGDRLMMVDHLGNKVDGDQILYIIAREGLRQGQLKG-GAVGTLMSNMGLELALKQL 297

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           G+   R +VGDRY++E M+ NG+ +G E SGH+IL D  +TGDG+VA LQVL  + + D 
Sbjct: 298 GIPFARAKVGDRYVLEKMQENGWRIGAENSGHVILLDKTTTGDGIVAGLQVLTAMVRNDM 357

Query: 361 PVSTICHCFEEYPQFLRSVSVK-DTSILNSSSIVQAIADAESELRGIDRLIVRASGTESL 419
            +  +C   +  PQ L +V    + + L S +++      E+EL G  R+++R SGTE L
Sbjct: 358 SLHDLCSGMKLLPQILVNVRFSGNHNPLESDAVLAVTQQVEAELAGRGRVLLRKSGTEPL 417

Query: 420 IRIMAEGDD-LSRIKRIVDDLAKVI 443
           IR+M EGDD   RIK     +A  +
Sbjct: 418 IRVMVEGDDEEERIKSFAHRIADAV 442


>gi|34499250|ref|NP_903465.1| phosphoglucosamine mutase [Chromobacterium violaceum ATCC 12472]
 gi|81654490|sp|Q7NRI6|GLMM_CHRVO RecName: Full=Phosphoglucosamine mutase
 gi|34105101|gb|AAQ61457.1| phosphoglucosamine mutase [Chromobacterium violaceum ATCC 12472]
          Length = 445

 Score =  392 bits (1008), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 202/430 (46%), Positives = 296/430 (68%), Gaps = 7/430 (1%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRR--VVIGKDTRLSGYML 58
           M R++FGTDG+RG+   FPITP F+M++G A G +     +  R  V+IGKDTR+SGYML
Sbjct: 1   MSRKYFGTDGVRGEVGKFPITPEFVMKLGYAAGRVLVNHDQDSRPTVLIGKDTRISGYML 60

Query: 59  ENSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDG 118
           E +L AGFTAAG++  + GP+P+P +A LTR+LR + GV+ISASHNP+QDNGIK F   G
Sbjct: 61  EAALQAGFTAAGVNVLLTGPLPTPGIAYLTRALRLEAGVVISASHNPFQDNGIKFFAEGG 120

Query: 119 YKVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLR 178
            K+   +E  IE +L+  + +  S    +G A+R+DG  +RYIE  K T P +++L+GL+
Sbjct: 121 NKLDDALELEIEAMLDQPMATNPSL--ELGRARRIDGAAERYIEFCKSTFPNELSLKGLK 178

Query: 179 IVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADI 238
           +VVDCANGA+Y +AP+VF ELGA++V IG +PNG NIN   G+T   +LQ  V E +AD 
Sbjct: 179 LVVDCANGATYHIAPKVFHELGAELVEIGCEPNGYNINDKVGATYPKTLQMAVLEHQADF 238

Query: 239 GIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIA 298
           GIALDGDGDR+I+VD  G + +GDQ++ +IA+   +   L+G G+V TVM+N+ +E  + 
Sbjct: 239 GIALDGDGDRLIMVDAAGRVYDGDQLIYVIAKARAARGELKG-GVVGTVMTNMAMELALQ 297

Query: 299 GLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQY 358
             G+   R +VGDRY++E +  +G+ VGGE SGHI+  D  STGDG++++LQVL  +KQ 
Sbjct: 298 KQGVPFGRAKVGDRYVLEMLHADGWQVGGEASGHILCLDKHSTGDGIISSLQVLASLKQL 357

Query: 359 DKPVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTES 418
              ++ IC  +  +PQ L  ++V+       ++    +A+AE+ L+G  R+++R SGTE 
Sbjct: 358 GLSLAEICADWRPFPQTL--INVRHNGCDWKAASAAPLAEAEAALQGRGRVVLRPSGTEP 415

Query: 419 LIRIMAEGDD 428
           ++R+M E DD
Sbjct: 416 VVRVMVEADD 425


>gi|283836278|ref|ZP_06356019.1| phosphoglucosamine mutase [Citrobacter youngae ATCC 29220]
 gi|291067641|gb|EFE05750.1| phosphoglucosamine mutase [Citrobacter youngae ATCC 29220]
          Length = 445

 Score =  392 bits (1008), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 211/445 (47%), Positives = 300/445 (67%), Gaps = 10/445 (2%)

Query: 3   RRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSL 62
           R++FGTDGIRG+    PITP+F++++G A G +   +   R+++IGKDTR+SGYMLE++L
Sbjct: 4   RKYFGTDGIRGRVGDSPITPDFVLKLGWAAGKVL-ARHGSRKIIIGKDTRISGYMLESAL 62

Query: 63  VAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVS 122
            AG  AAG+ A   GP+P+PAVA LTR+ RA+ G++ISASHNPY DNGIK F  DG K+ 
Sbjct: 63  EAGLAAAGLSASFTGPMPTPAVAYLTRAFRAEAGIVISASHNPYYDNGIKFFSIDGTKLP 122

Query: 123 TDIEDRIETLLEDDLTSYLSCYDS--IGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
             +E+ IE  +E  +T    C DS  +G A R+     RYIE  K T P +++L  L+IV
Sbjct: 123 DAVEEAIEAEMEKAIT----CVDSAELGKATRIVDAAGRYIEFCKGTFPNELSLSELKIV 178

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           VDCANGA+Y +AP V  ELGA+V+ IG +PNG+NIN + G+T+V +LQ +V   +AD+GI
Sbjct: 179 VDCANGATYHIAPNVLRELGANVIAIGCEPNGVNINEEVGATDVRALQARVIAEKADLGI 238

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           ALDGDGDRVI+VD +G  V+GDQIM +IARE +    LRG G V T+MSN+GLE  +  L
Sbjct: 239 ALDGDGDRVIMVDHEGNKVDGDQIMYIIAREALRQGQLRG-GAVGTLMSNMGLELALKQL 297

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           G+   R +VGDRY++E M+  G+++G E SGH+IL D  +TGDG+VA LQVL  + +   
Sbjct: 298 GIPFARAKVGDRYVLEKMQEKGWSIGAENSGHVILLDKTTTGDGIVAGLQVLTAMVRNHM 357

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTS--ILNSSSIVQAIADAESELRGIDRLIVRASGTES 418
            +  +C   + +PQ L +V     S   L + ++   +A+ E+ L    R+++R SGTE 
Sbjct: 358 SLHDLCSGMKMFPQLLVNVRYTAGSGDPLENENVKAVMAEVEAALGNRGRVLLRKSGTEP 417

Query: 419 LIRIMAEGDDLSRIKRIVDDLAKVI 443
           LIR+M EG+D +++      +A  +
Sbjct: 418 LIRVMVEGEDEAQVTEFAHRIADAV 442


>gi|330969646|gb|EGH69712.1| phosphoglucosamine mutase [Pseudomonas syringae pv. aceris str.
           M302273PT]
          Length = 447

 Score =  392 bits (1008), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 195/443 (44%), Positives = 295/443 (66%), Gaps = 6/443 (1%)

Query: 3   RRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSL 62
           R++FGTDGIRG+   FPITP FM+++G A G  FR K    R+++GKDTR+SGYM E++L
Sbjct: 4   RKYFGTDGIRGRVGQFPITPEFMLKLGWAAGMAFR-KMGACRILVGKDTRISGYMFESAL 62

Query: 63  VAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVS 122
            AG +AAG D  +LGP+P+PA+A LTR+  A+ G++ISASHNP+ DNGIK F   G K+ 
Sbjct: 63  EAGLSAAGADVLLLGPMPTPAIAYLTRTFHAEAGIVISASHNPHYDNGIKFFSGQGTKLP 122

Query: 123 TDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVVD 182
            +IE  IE LL+  +T   S  +++G   R++    RYIE  K ++P      GL++V+D
Sbjct: 123 DEIEMMIEELLDAPMTVAES--ENLGKVSRINDAAGRYIEFCKSSVPTSTDFAGLKVVID 180

Query: 183 CANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIAL 242
           CA+GA+YKVAP VF ELGA VVV+  +P+G+NIN DCGST++ +LQ  V    AD+GI  
Sbjct: 181 CAHGATYKVAPNVFRELGAQVVVLSAQPDGLNINKDCGSTHMEALQAAVLAEHADMGIGF 240

Query: 243 DGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLGL 302
           DGDGDRV++VD  G IV+GD+++ +IAR+      L+G G+V T+MSN+GLE  +A  G+
Sbjct: 241 DGDGDRVLMVDHTGTIVDGDELLYIIARDLHERGRLQG-GVVGTLMSNLGLELALAEQGI 299

Query: 303 SLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKPV 362
              R  VGDRY++  +    + +GGE SGHI+   + +TGD ++A+LQV+  +++    +
Sbjct: 300 PFVRANVGDRYVIAELLERNWQIGGENSGHIVCFQHATTGDAIIASLQVILALRRSGVSL 359

Query: 363 STICHCFEEYPQFLRSVSVKDTSI--LNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
           +       + PQ L +V    + +  ++  S+  A A    ++ G  R+++R SGTE L+
Sbjct: 360 AEARLKLRKCPQILINVRFAGSGVDPVSHPSVKDACARVTEQMAGRGRVLLRKSGTEPLV 419

Query: 421 RIMAEGDDLSRIKRIVDDLAKVI 443
           R+M EG+D ++++   ++LAK++
Sbjct: 420 RVMVEGEDETQVRAYAEELAKLV 442


>gi|320666760|gb|EFX33739.1| phosphoglucosamine mutase [Escherichia coli O157:H7 str. LSU-61]
          Length = 445

 Score =  392 bits (1008), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 210/448 (46%), Positives = 298/448 (66%), Gaps = 10/448 (2%)

Query: 3   RRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSL 62
           R++FGTDGIRG+    PITP+F++++G A G +   +   R+++IGKDTR+SGYMLE++L
Sbjct: 4   RKYFGTDGIRGRVGDAPITPDFVLKLGWAAGKVL-ARHGSRKIIIGKDTRISGYMLESAL 62

Query: 63  VAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVS 122
            AG  AAG+ A   GP+P+PAVA LTR+ RA+ G++ISASHNP+ DNGIK F  DG K+ 
Sbjct: 63  EAGLAAAGLSALFTGPMPTPAVAYLTRTFRAEAGIVISASHNPFYDNGIKFFSIDGTKLP 122

Query: 123 TDIEDRIETLLEDDLTSYLSCYDS--IGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
             +E+ IE  +E ++    SC DS  +G A R+     RYIE  K T P +++L  L+IV
Sbjct: 123 DAVEEGIEAEMEKEI----SCVDSAELGKASRIVDAAGRYIEFCKATFPNELSLSELKIV 178

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           VDCANGA+Y +AP V  ELGA+V+ IG +PNG+NIN + G+T+V +LQ +V   +AD+GI
Sbjct: 179 VDCANGATYHIAPNVLRELGANVIAIGCEPNGVNINAEVGATDVRALQARVLAEKADLGI 238

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           A DGDGDRVI+VD +G  V+GDQIM +IARE +    LRG G V T+MSN+GLE  +  L
Sbjct: 239 AFDGDGDRVIMVDHEGNKVDGDQIMYIIAREGLRQGQLRG-GAVGTLMSNMGLELALKQL 297

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           G+   R +VGDRY++E M+  G+ +G E SGH+IL D  +TGDG+VA LQVL  + +   
Sbjct: 298 GIPFARAKVGDRYVLEKMQEKGWRIGAENSGHVILLDKTTTGDGIVAGLQVLAAMARNHM 357

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTS--ILNSSSIVQAIADAESELRGIDRLIVRASGTES 418
            +  +C   + +PQ L +V     S   L   S+    A+ E+ L    R+++R SGTE 
Sbjct: 358 SLHDLCSGMKMFPQILVNVRYTAGSGDPLEHESVKAVTAEVEAALGSRGRVLLRKSGTEP 417

Query: 419 LIRIMAEGDDLSRIKRIVDDLAKVIPMI 446
           LIR+M EG+D +++      +A  +  +
Sbjct: 418 LIRVMVEGEDEAQVTEFAHRIADAVKAV 445


>gi|217972666|ref|YP_002357417.1| phosphoglucosamine mutase [Shewanella baltica OS223]
 gi|217497801|gb|ACK45994.1| phosphoglucosamine mutase [Shewanella baltica OS223]
          Length = 450

 Score =  392 bits (1008), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 206/434 (47%), Positives = 287/434 (66%), Gaps = 8/434 (1%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M R++FGTDG+RGK   FPI P+F M++G A G +       + V+IGKDTR SGYMLE+
Sbjct: 1   MSRKYFGTDGVRGKVGEFPINPDFAMKLGWAAGTVL-ASMGTKEVLIGKDTRSSGYMLES 59

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           ++ AGF+AAG++  ++GP+P+PAVA L  + RAD GV+ISASHNP+ DNGIK F   G K
Sbjct: 60  AMEAGFSAAGVNVALIGPMPTPAVAYLASTFRADAGVVISASHNPFYDNGIKFFSNSGTK 119

Query: 121 VSTDIEDRIETLLEDDLT-SYLSCYDS--IGHAKRVDGVHDRYIEHVKRTLPRDVTLQGL 177
           ++   E  IE LLE  L  + + C  S  +G  +R+D    RYIE  K T P  ++L GL
Sbjct: 120 LNDAQELEIEALLEKALNQNAMQCVASENLGKVRRIDDAAGRYIEFCKGTFPNHLSLTGL 179

Query: 178 RIVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRAD 237
           +IVVD A+GA+Y +AP V+ ELGA+V+ I DKPNG+NIN  CG+T++ SLQ  V    AD
Sbjct: 180 KIVVDSAHGAAYHIAPNVYRELGAEVISINDKPNGVNINDHCGATHLDSLQTAVMVHEAD 239

Query: 238 IGIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFI 297
           +GIALDGD DRV+ VD  G +V+GD+I+ ++A    S   + G G+V T+MSN+GLE  +
Sbjct: 240 LGIALDGDADRVMFVDHNGHVVDGDEILFILAHAAHSKGEMTG-GVVGTLMSNLGLELAL 298

Query: 298 AGLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQ 357
             + +   R +VGDRY++E +K  G+ +GGE SGHI+   + STGDG+VA+LQVL+ + +
Sbjct: 299 KQMDIPFLRAKVGDRYVVEQLKATGWQLGGEGSGHILSLQHASTGDGIVASLQVLKAVLE 358

Query: 358 YDKPVSTICHCFEEYPQFL---RSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRAS 414
             K +S I     + PQ L   R  +    SIL ++S+ QA+  AE  L    R+++R S
Sbjct: 359 SQKSLSEIKAGMTKLPQVLINVRLATADADSILATASVQQAVIKAEGILGDRGRVLLRKS 418

Query: 415 GTESLIRIMAEGDD 428
           GTE LIR+M E  D
Sbjct: 419 GTEPLIRVMVESTD 432


>gi|188532500|ref|YP_001906297.1| phosphoglucosamine mutase [Erwinia tasmaniensis Et1/99]
 gi|226722746|sp|B2VGT8|GLMM_ERWT9 RecName: Full=Phosphoglucosamine mutase
 gi|188027542|emb|CAO95389.1| Phosphoglucosamine mutase [Erwinia tasmaniensis Et1/99]
          Length = 444

 Score =  392 bits (1008), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 207/446 (46%), Positives = 300/446 (67%), Gaps = 5/446 (1%)

Query: 2   KRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENS 61
           +R++FGTDGIRGK    PITP+F++++G A G +   +   ++++IGKDTR+SGYMLE++
Sbjct: 3   ERKYFGTDGIRGKVGESPITPDFVLKLGFAAGKVL-ARHGSKQIIIGKDTRISGYMLESA 61

Query: 62  LVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKV 121
           L AG  AAG+ A   GP+P+PAVA LTR+ RA+ G++ISASHNP+ DNGIK F  +G K+
Sbjct: 62  LEAGLAAAGLSAAFTGPMPTPAVAYLTRTFRAEAGIVISASHNPFDDNGIKFFSTEGTKL 121

Query: 122 STDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVV 181
             D+E  IE  +E  +T   S   ++G A R+     RYIE  K T P  ++L GL+IVV
Sbjct: 122 PDDVEAAIEAEMEKPITCVESA--ALGRASRIVDAAGRYIEFCKGTFPSQLSLNGLKIVV 179

Query: 182 DCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIA 241
           DCANGA+Y +AP V  ELGA V+ IG +P+G+NIN +CG+T++  LQ +V   +AD+G+A
Sbjct: 180 DCANGATYHIAPNVLRELGATVISIGVQPDGMNINKECGATDLRLLQERVLAEKADVGLA 239

Query: 242 LDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLG 301
            DGDGDR+++VD  G  V+GDQI+ LIARE +    LRG G+V T+MSN+GLE  +  LG
Sbjct: 240 YDGDGDRIMMVDHLGHKVDGDQILYLIAREGLRQGELRG-GVVGTLMSNMGLELALKQLG 298

Query: 302 LSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKP 361
           +   R +VGDRY++E +K  G+ +G E SGH+IL D  +TGDG+VA LQVL  + +    
Sbjct: 299 IPFARAKVGDRYVLEKLKEKGWRLGAENSGHVILLDKTTTGDGIVAGLQVLTAMVRNHMS 358

Query: 362 VSTICHCFEEYPQFLRSVSVKDTS-ILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
           +  +C   +  PQ L +V    +S  L  + +    A+AE EL+G  R+++R SGTE LI
Sbjct: 359 LHDLCSGMKLLPQILVNVRFSGSSDPLEDARVKAVTAEAEIELKGRGRVLLRKSGTEPLI 418

Query: 421 RIMAEGDDLSRIKRIVDDLAKVIPMI 446
           R+M EG+D + +  + + +A  +  +
Sbjct: 419 RVMVEGEDEALVSTLANRIADAVKAV 444


>gi|237730096|ref|ZP_04560577.1| phosphoglucosamine mutase [Citrobacter sp. 30_2]
 gi|226908702|gb|EEH94620.1| phosphoglucosamine mutase [Citrobacter sp. 30_2]
          Length = 445

 Score =  392 bits (1008), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 211/445 (47%), Positives = 298/445 (66%), Gaps = 10/445 (2%)

Query: 3   RRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSL 62
           R++FGTDGIRG+    PITP+F++++G A G +   +   R+++IGKDTR+SGYMLE++L
Sbjct: 4   RKYFGTDGIRGRVGDAPITPDFVLKLGWAAGKVL-ARHGSRKIIIGKDTRISGYMLESAL 62

Query: 63  VAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVS 122
            AG  AAG+ A   GP+P+PAVA LTR+ RA+ G++ISASHNPY DNGIK F  DG K+ 
Sbjct: 63  EAGLAAAGLSASFTGPMPTPAVAYLTRAFRAEAGIVISASHNPYYDNGIKFFSTDGTKLP 122

Query: 123 TDIEDRIETLLEDDLTSYLSCYDS--IGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
             +E+ IE  +E  +T    C DS  +G A R+     RYIE  K T P +++L  L+IV
Sbjct: 123 DAVEEAIEAEMEKAIT----CVDSAELGKATRIVDAAGRYIEFCKGTFPNELSLNELKIV 178

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           VDCANGA+Y +AP V  ELGA+V+ IG +PNG+NIN + G+T+V +LQ +V   +AD+GI
Sbjct: 179 VDCANGATYHIAPNVLRELGANVIAIGCEPNGVNINEEVGATDVRALQARVIAEKADLGI 238

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           ALDGDGDRVI+VD +G  V+GDQIM +IARE +    LRG G V T+MSN+GLE  +  L
Sbjct: 239 ALDGDGDRVIMVDHEGNKVDGDQIMYIIAREALRQGQLRG-GAVGTLMSNMGLELALKQL 297

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           G+   R +VGDRY++E M+  G+ +G E SGH+IL D  +TGDG+VA LQVL  + +   
Sbjct: 298 GIPFARAKVGDRYVLEKMQEKGWRIGAENSGHVILLDKTTTGDGIVAGLQVLAAMVRNHM 357

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTS--ILNSSSIVQAIADAESELRGIDRLIVRASGTES 418
            +  +C   + +PQ L +V     S   L   ++   +A+ E+ L    R+++R SGTE 
Sbjct: 358 SLHDLCSGMKMFPQLLVNVRYTAGSGDPLEHENVKAVMAEVEAALGNRGRVLLRKSGTEP 417

Query: 419 LIRIMAEGDDLSRIKRIVDDLAKVI 443
           LIR+M EG+D +++      +A  +
Sbjct: 418 LIRVMVEGEDEAQVTEFAHRIADAV 442


>gi|161870538|ref|YP_001599710.1| phosphoglucomutase/phosphomannomutase [Neisseria meningitidis
           053442]
 gi|189040789|sp|A9M1R2|GLMM_NEIM0 RecName: Full=Phosphoglucosamine mutase
 gi|161596091|gb|ABX73751.1| phosphoglucomutase/phosphomannomutase [Neisseria meningitidis
           053442]
          Length = 444

 Score =  392 bits (1008), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 196/427 (45%), Positives = 289/427 (67%), Gaps = 6/427 (1%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRR--VVIGKDTRLSGYML 58
           M +++FGTDG+RG+   FPITP+F++++G A G +       ++  V+IGKDTR+SGYML
Sbjct: 1   MAKKYFGTDGVRGEVGQFPITPDFVLKLGYAAGQVLVQHDTDQKPTVLIGKDTRISGYML 60

Query: 59  ENSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDG 118
           E +LVAGFTAAG++    GP+P+P VA LTR+LR   GVMISASHN Y DNGIK F   G
Sbjct: 61  EAALVAGFTAAGVNVIQTGPLPTPGVAYLTRALRLSAGVMISASHNAYSDNGIKFFAEGG 120

Query: 119 YKVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLR 178
            K+S +IE  IE  +++++ +  S    +G A+R+ G  DRYIE  K T P    L+GL+
Sbjct: 121 VKLSDEIELEIEAKIDEEMKTQPSA--RLGRARRISGADDRYIEFCKSTFPTHSDLRGLK 178

Query: 179 IVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADI 238
           +VVD ANGA+Y VAP+VF ELGA VV IGD+P+G NIN  CG+T+  +LQ  V +  AD 
Sbjct: 179 LVVDAANGAAYSVAPKVFHELGAQVVSIGDEPDGYNINEKCGATHTKTLQAAVLQNEADY 238

Query: 239 GIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIA 298
           GIALDGDGDR+++VD+ G + +GD ++ +IA+      +  G G+V TVM+N+ +E  + 
Sbjct: 239 GIALDGDGDRLMMVDKNGKVYDGDSLIYVIAKARAREGINIG-GVVGTVMTNMAMEIALK 297

Query: 299 GLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQY 358
             G+   R +VGDRY++E +    + +GGE SGHI+  D  +TGDG+++ALQVL  ++  
Sbjct: 298 EQGVDFCRAKVGDRYVLEQLNQRSWLIGGEASGHILCMDKHNTGDGIISALQVLAALQTL 357

Query: 359 DKPVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTES 418
           ++ ++T+C  ++ YPQ + +V ++       +S    +A+ E EL G  R+++RASGTE 
Sbjct: 358 NQDLATVCADWQPYPQTMINVRIQKGQKWQEAS-KDVLAEVEKELEGKGRVVLRASGTEP 416

Query: 419 LIRIMAE 425
           ++R+M E
Sbjct: 417 VVRVMVE 423


>gi|325578449|ref|ZP_08148584.1| phosphoglucosamine mutase [Haemophilus parainfluenzae ATCC 33392]
 gi|325160185|gb|EGC72314.1| phosphoglucosamine mutase [Haemophilus parainfluenzae ATCC 33392]
          Length = 444

 Score =  392 bits (1008), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 208/444 (46%), Positives = 297/444 (66%), Gaps = 9/444 (2%)

Query: 3   RRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSL 62
           R++FGTDG+RGK  T+PITP+F +++G A G +    +  R V+IGKDTR+SGYMLE++L
Sbjct: 4   RKYFGTDGVRGKVGTYPITPDFALKLGWAAGKVL-ASQGSRTVLIGKDTRISGYMLESAL 62

Query: 63  VAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVS 122
            AG  AAG+ A   GP+P+PA+A LTR+ RA+ G++ISASHNPY DNGIK F   G K+ 
Sbjct: 63  EAGLAAAGLSAAFTGPMPTPAIAYLTRTFRAEAGIVISASHNPYYDNGIKFFSSQGTKLP 122

Query: 123 TDIEDRIETLLEDDLTSYLSCYDS--IGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
            DIE+ IE +L+  +     C +S  +G A R+     RYIE  K T P  + L G +IV
Sbjct: 123 DDIEEAIEAMLDQPM----DCVESADLGKASRISDAAGRYIEFCKSTFPAHLGLDGYKIV 178

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           VDCANGA+Y +AP V  ELGA+V+ IG  PNGININ  CG+T+V +LQ KV E +AD+G+
Sbjct: 179 VDCANGATYHIAPNVLRELGAEVIEIGTDPNGININEKCGATDVKALQEKVLETKADVGL 238

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           A DGDGDR+++VD  G  V+GDQI+ +IARE +    L+G G+V T+MSN+ LE  +  L
Sbjct: 239 AYDGDGDRIMMVDHLGNKVDGDQILFIIAREALRSGQLKG-GVVGTLMSNMSLEIALKML 297

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           G+   R  VGDRY++E M  + + +GGE SGHII++D  +TGDG++A+L VL  + Q+  
Sbjct: 298 GVPFLRANVGDRYVLEKMVEHNWTLGGENSGHIIIADKNTTGDGIIASLAVLSAMVQHRL 357

Query: 361 PVSTICHCFEEYPQFLRSVSVK-DTSILNSSSIVQAIADAESELRGIDRLIVRASGTESL 419
            ++ +    + +PQ L +V      + L S ++    AD E  L G  R+++R SGTE L
Sbjct: 358 SLNELASAVKLFPQVLINVRFAGGDNPLESEAVKAVAADVEKRLEGKGRILLRKSGTEPL 417

Query: 420 IRIMAEGDDLSRIKRIVDDLAKVI 443
           IR+M E +D +  K+  +++A+ +
Sbjct: 418 IRVMVECEDGALAKQCAEEIAEAV 441


>gi|309750890|gb|ADO80874.1| Phosphoglucosamine mutase [Haemophilus influenzae R2866]
          Length = 445

 Score =  392 bits (1008), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 206/450 (45%), Positives = 300/450 (66%), Gaps = 9/450 (2%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           + R++FGTDG+RGK   +PITP+F +++G A G +    +  + V+IGKDTR+SGYMLE+
Sbjct: 2   VNRKYFGTDGVRGKVGAYPITPDFALKLGWAAGKVL-ASQGSKMVLIGKDTRISGYMLES 60

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +L AG  AAG+ A   GP+P+PA+A LTR+ RA+ G++ISASHNPY DNGIK F   G K
Sbjct: 61  ALEAGLAAAGLSAAFTGPMPTPAIAYLTRTFRAEAGIVISASHNPYYDNGIKFFSAKGTK 120

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDS--IGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLR 178
           +  +IE+ IE +LE  +     C +S  +G A R++    RYIE  K T P  + L+G +
Sbjct: 121 LPDEIEEAIEAMLEQPM----DCVESAELGKASRINDAAGRYIEFCKGTFPAHLGLEGYK 176

Query: 179 IVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADI 238
           IVVDCANGA+Y +AP VF ELGA+V+ IG  PNG+NIN  CG+T+V +LQ KV E +AD+
Sbjct: 177 IVVDCANGATYHIAPNVFRELGAEVIEIGTDPNGLNINEKCGATDVTALQAKVVETKADV 236

Query: 239 GIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIA 298
           G+A DGDGDR+++VD  G  V+GDQI+ +IARE +    L+G G+V T+MSN+ LE  + 
Sbjct: 237 GLAYDGDGDRIMMVDHLGNKVDGDQILFIIAREALRSGQLKG-GVVGTLMSNMSLEIALK 295

Query: 299 GLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQY 358
            LG+   R  VGDRY++E M  N + +GGE SGHII++D  +TGDG+VA+L VL  + Q+
Sbjct: 296 MLGVPFLRANVGDRYVLEKMVENDWTLGGENSGHIIIADKNTTGDGIVASLAVLAAMAQH 355

Query: 359 DKPVSTICHCFEEYPQFLRSVSVK-DTSILNSSSIVQAIADAESELRGIDRLIVRASGTE 417
              ++ +    + +PQ L +V      + L + ++    A+ E  L G  R+++R SGTE
Sbjct: 356 KLSLNELASAVKLFPQVLINVRFAGGENPLENDAVKSVAAEVEKRLEGKGRILLRKSGTE 415

Query: 418 SLIRIMAEGDDLSRIKRIVDDLAKVIPMID 447
            LIR+M E  D    ++  +++A+ +  I+
Sbjct: 416 PLIRVMVECQDAELAQQCAEEIAEAVKKIN 445


>gi|319776276|ref|YP_004138764.1| phosphomannomutase [Haemophilus influenzae F3047]
 gi|317450867|emb|CBY87091.1| predicted phosphomannomutase [Haemophilus influenzae F3047]
          Length = 445

 Score =  392 bits (1008), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 205/448 (45%), Positives = 299/448 (66%), Gaps = 9/448 (2%)

Query: 3   RRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSL 62
           R++FGTDG+RGK   +PITP+F +++G A G +    +  + V+IGKDTR+SGYMLE++L
Sbjct: 4   RKYFGTDGVRGKVGAYPITPDFALKLGWAAGKVL-ASQGSKMVLIGKDTRISGYMLESAL 62

Query: 63  VAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVS 122
            AG  AAG+ A   GP+P+PA+A LTR+ RA+ G++ISASHNPY DNGIK F   G K+ 
Sbjct: 63  EAGLAAAGLSAAFTGPMPTPAIAYLTRTFRAEAGIVISASHNPYYDNGIKFFSAKGTKLP 122

Query: 123 TDIEDRIETLLEDDLTSYLSCYDS--IGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
            +IE+ IE +LE  +     C +S  +G A R++    RYIE  K T P  + L+G +IV
Sbjct: 123 DEIEEAIEAMLEQTM----DCVESAELGKASRINDAAGRYIEFCKGTFPAHLGLEGYKIV 178

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           VDCANGA+Y +AP V  ELGA+V+ IG  PNG+NIN  CG+T+V +LQ KV E +AD+G+
Sbjct: 179 VDCANGATYHIAPNVLRELGAEVIEIGTDPNGLNINEKCGATDVTALQAKVVETKADVGL 238

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           A DGDGDR+++VD  G  V+GDQI+ +IARE +    L+G G+V T+MSN+ LE  +  L
Sbjct: 239 AYDGDGDRIMMVDHLGNKVDGDQILFIIAREALRSGQLKG-GVVGTLMSNMSLEIALKML 297

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           G+   R  VGDRY++E M  N + +GGE SGHII++D  +TGDG+VA+L VL  + Q+  
Sbjct: 298 GVPFLRANVGDRYVLEKMVENDWTLGGENSGHIIIADKNTTGDGIVASLAVLAAMAQHKL 357

Query: 361 PVSTICHCFEEYPQFLRSVSVK-DTSILNSSSIVQAIADAESELRGIDRLIVRASGTESL 419
            ++ +    + +PQ L +V      ++L + ++    A+ E  L G  R+++R SGTE L
Sbjct: 358 SLNELASAVKLFPQVLINVRFAGGENLLENDAVKSVAAEVEKRLEGKGRILLRKSGTEPL 417

Query: 420 IRIMAEGDDLSRIKRIVDDLAKVIPMID 447
           IR+M E  D    ++  +++A+ +  I+
Sbjct: 418 IRVMVECQDAELAQQCAEEIAEAVKKIN 445


>gi|306816482|ref|ZP_07450614.1| phosphoglucosamine mutase [Escherichia coli NC101]
 gi|222034893|emb|CAP77636.1| Phosphoglucosamine mutase [Escherichia coli LF82]
 gi|305850047|gb|EFM50506.1| phosphoglucosamine mutase [Escherichia coli NC101]
 gi|312947733|gb|ADR28560.1| phosphoglucosamine mutase [Escherichia coli O83:H1 str. NRG 857C]
 gi|324008776|gb|EGB77995.1| phosphoglucosamine mutase [Escherichia coli MS 57-2]
          Length = 445

 Score =  392 bits (1007), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 209/448 (46%), Positives = 298/448 (66%), Gaps = 10/448 (2%)

Query: 3   RRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSL 62
           R++FGTDGIRG+    P+TP+F++++G A G +   +   R+++IGKDTR+SGYMLE++L
Sbjct: 4   RKYFGTDGIRGRVGDAPVTPDFVLKLGWAAGKVL-ARHGSRKIIIGKDTRISGYMLESAL 62

Query: 63  VAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVS 122
            AG  AAG+ A   GP+P+PAVA LTR+ RA+ G++ISASHNP+ DNGIK F  DG K+ 
Sbjct: 63  EAGLAAAGLSALFTGPMPTPAVAYLTRTFRAEAGIVISASHNPFYDNGIKFFSIDGTKLP 122

Query: 123 TDIEDRIETLLEDDLTSYLSCYDS--IGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
             +E+ IE  +E ++    SC DS  +G A R+     RYIE  K T P +++L  L+IV
Sbjct: 123 DAVEEAIEAEMEKEI----SCVDSAELGKASRIVDAAGRYIEFCKATFPNELSLSELKIV 178

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           VDCANGA+Y +AP V  ELGA+V+ IG +PNG+NIN + G+T+V +LQ +V   +AD+GI
Sbjct: 179 VDCANGATYHIAPNVLRELGANVIAIGCEPNGVNINAEVGATDVRALQARVLAEKADLGI 238

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           A DGDGDRVI+VD +G  V+GDQIM +IARE +    LRG G V T+MSN+GLE  +  L
Sbjct: 239 AFDGDGDRVIMVDHEGNKVDGDQIMYIIAREGLRQGQLRG-GAVGTLMSNMGLELALKQL 297

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           G+   R +VGDRY++E M+  G+ +G E SGH+IL D  +TGDG+VA LQVL  + +   
Sbjct: 298 GIPFARAKVGDRYVLEKMQEKGWRIGAENSGHVILLDKTTTGDGIVAGLQVLAAMARNHM 357

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTS--ILNSSSIVQAIADAESELRGIDRLIVRASGTES 418
            +  +C   + +PQ L +V     S   L   S+    A+ E+ L    R+++R SGTE 
Sbjct: 358 SLHDLCSGMKMFPQILVNVRYTAGSGDPLEHESVKAVTAEVEAALGSRGRVLLRKSGTEP 417

Query: 419 LIRIMAEGDDLSRIKRIVDDLAKVIPMI 446
           LIR+M EG+D +++      +A  +  +
Sbjct: 418 LIRVMVEGEDEAQVTEFAHRIADAVKAV 445


>gi|226329687|ref|ZP_03805205.1| hypothetical protein PROPEN_03599 [Proteus penneri ATCC 35198]
 gi|225202873|gb|EEG85227.1| hypothetical protein PROPEN_03599 [Proteus penneri ATCC 35198]
          Length = 445

 Score =  392 bits (1007), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 210/446 (47%), Positives = 300/446 (67%), Gaps = 5/446 (1%)

Query: 2   KRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENS 61
           +R++FGTDGIRGK    PITP+F++++G A G +   +   R+++IGKDTR+SGYMLE++
Sbjct: 3   ERKYFGTDGIRGKVGDSPITPDFVLKLGWAAGKVL-ARHGSRKIIIGKDTRISGYMLESA 61

Query: 62  LVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKV 121
           L AG  AAG+ A   GP+P+PAVA LTR+ RA+ G++ISASHNPY DNGIK F  DG K+
Sbjct: 62  LEAGLAAAGLSASFTGPMPTPAVAYLTRTFRAEAGIVISASHNPYYDNGIKFFSIDGTKL 121

Query: 122 STDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVV 181
             ++E+ IE  +E  +T   S    +G A R+     RYIE  K T P +  L GL++VV
Sbjct: 122 PDEVEEAIEAEMEKPITCVESA--ELGRANRIVDAAGRYIEFCKGTFPNENNLNGLKVVV 179

Query: 182 DCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIA 241
           DCA+GA+Y +AP VF ELGA+V+ IG +P GININ +CG+T+V  LQ++V E  AD+G+A
Sbjct: 180 DCAHGATYHIAPNVFRELGAEVITIGCEPTGININEECGATDVRMLQKRVLEEGADVGLA 239

Query: 242 LDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLG 301
            DGDGDR+I+VD +G  V+GDQI+ +IARE +    LRG G V T+MSN+GLE  +  LG
Sbjct: 240 FDGDGDRIIMVDHQGLKVDGDQILYIIAREALRQGQLRG-GAVGTLMSNMGLEIALKQLG 298

Query: 302 LSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKP 361
           +   R +VGDRY++E ++  G+ +G E SGHIIL D  +TGDG+VA LQVL  + +    
Sbjct: 299 IPFVRAKVGDRYVLEKLQEKGWRLGAENSGHIILLDKTTTGDGIVAGLQVLSAMVRNHMS 358

Query: 362 VSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADA-ESELRGIDRLIVRASGTESLI 420
           +  +C   +  PQ L +V    +     ++ VQ +A A E EL G  R+++R SGTE LI
Sbjct: 359 LHDLCSGMKLLPQVLVNVRFTGSHDPLQTAEVQKVAKAVEDELAGKGRVLLRKSGTEPLI 418

Query: 421 RIMAEGDDLSRIKRIVDDLAKVIPMI 446
           R+M EG++  ++  + + +A  +  +
Sbjct: 419 RVMVEGENEEQVTAMANRIADAVKHV 444


>gi|260596197|ref|YP_003208768.1| phosphoglucosamine mutase [Cronobacter turicensis z3032]
 gi|260215374|emb|CBA27393.1| Phosphoglucosamine mutase [Cronobacter turicensis z3032]
          Length = 445

 Score =  392 bits (1007), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 211/448 (47%), Positives = 297/448 (66%), Gaps = 10/448 (2%)

Query: 3   RRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSL 62
           R++FGTDGIRG+    PITP+F++++G A G +   +   R+V+IGKDTR+SGYMLE++L
Sbjct: 4   RKYFGTDGIRGRVGDAPITPDFVLKLGWAAGKVL-ARHGSRKVIIGKDTRISGYMLESAL 62

Query: 63  VAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVS 122
            AG  AAG+ A   GP+P+PAVA LTR+ RA+ G++ISASHNP+ DNGIK F  +G K+ 
Sbjct: 63  EAGLAAAGLSALFTGPMPTPAVAYLTRTFRAEAGIVISASHNPFYDNGIKFFSIEGTKLP 122

Query: 123 TDIEDRIETLLEDDLTSYLSCYDS--IGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
            ++E+ IE  LE ++    SC DS  +G A R+     RYIE  K T P +++L  L+IV
Sbjct: 123 DEVEEAIEAELEKEI----SCVDSAELGKASRIVDAAGRYIEFCKGTFPNELSLNALKIV 178

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           VDCANGA+Y +AP V  ELGA V+ IG +P+G+NIN  CG+T+V  LQ +V   +AD+GI
Sbjct: 179 VDCANGATYHIAPNVLRELGARVITIGSEPDGLNINEKCGATDVRLLQERVVAEKADLGI 238

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           A DGDGDRVI+VD +G  V+GDQI+ +IARE +    LRG G V T+MSN+GLE  +  L
Sbjct: 239 AFDGDGDRVIMVDHEGNKVDGDQILYIIAREGLRQGQLRG-GAVGTLMSNMGLEVALKQL 297

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           G+   R +VGDRY++E M+  G+ +G E SGH+IL D  +TGDG+VAALQVL  I +   
Sbjct: 298 GIPFARAKVGDRYVLEKMQEKGWRIGAENSGHVILLDKTTTGDGIVAALQVLTAIARNHM 357

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTS--ILNSSSIVQAIADAESELRGIDRLIVRASGTES 418
            +  +C   + +PQ L +V     S   L  +++     D E  L    R+++R SGTE 
Sbjct: 358 SLHDLCSGMKLFPQILVNVRFTPGSGDPLEHATVKAVTEDVEQALGKRGRVLLRKSGTEP 417

Query: 419 LIRIMAEGDDLSRIKRIVDDLAKVIPMI 446
           LIR+M EG+D +++      +A  +  +
Sbjct: 418 LIRVMVEGEDEAQVTEFAHRIADAVKAV 445


>gi|218550459|ref|YP_002384250.1| phosphoglucosamine mutase [Escherichia fergusonii ATCC 35469]
 gi|226722747|sp|B7LR43|GLMM_ESCF3 RecName: Full=Phosphoglucosamine mutase
 gi|218358000|emb|CAQ90646.1| phosphoglucosamine mutase [Escherichia fergusonii ATCC 35469]
 gi|325498757|gb|EGC96616.1| phosphoglucosamine mutase [Escherichia fergusonii ECD227]
          Length = 445

 Score =  392 bits (1007), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 210/448 (46%), Positives = 297/448 (66%), Gaps = 10/448 (2%)

Query: 3   RRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSL 62
           R++FGTDGIRG+    PITP+F++++G A G +   +   R+++IGKDTR+SGYMLE++L
Sbjct: 4   RKYFGTDGIRGRVGDAPITPDFVLKLGWAAGKVL-ARHGSRKIIIGKDTRISGYMLESAL 62

Query: 63  VAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVS 122
            AG  AAG+ A   GP+P+PAVA LTR+ RA+ G++ISASHNP+ DNGIK F  DG K+ 
Sbjct: 63  EAGLAAAGLSALFTGPMPTPAVAYLTRTFRAEAGIVISASHNPFYDNGIKFFSIDGTKLP 122

Query: 123 TDIEDRIETLLEDDLTSYLSCYDS--IGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
             +E+ IE  +E ++    SC DS  +G A R+     RYIE  K T P +++L  L+IV
Sbjct: 123 DAVEEAIEAEMEKEI----SCVDSAELGKASRIVDAAGRYIEFCKATFPNELSLSELKIV 178

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           VDCANGA+Y +AP V  ELGA+V+ IG +PNG+NIN + G+T+V +LQ +V   +AD+GI
Sbjct: 179 VDCANGATYHIAPNVLRELGANVIAIGCEPNGVNINAEVGATDVRALQARVLAEKADLGI 238

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           A DGDGDRVI+VD +G  V+GDQIM +IARE +    LRG G V T+MSN+GLE  +  L
Sbjct: 239 AFDGDGDRVIMVDHEGNKVDGDQIMYIIAREGLRQGQLRG-GAVGTLMSNMGLELALKQL 297

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           G+   R +VGDRY++E M+  G+ +G E SGH+IL D  +TGDG+VA LQVL  + +   
Sbjct: 298 GIPFARAKVGDRYVLEKMQEKGWRIGAENSGHVILLDKTTTGDGIVAGLQVLAAMARNHM 357

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTS--ILNSSSIVQAIADAESELRGIDRLIVRASGTES 418
            +  +C   + +PQ L +V     S   L   S+    A+ E+ L    R+++R SGTE 
Sbjct: 358 SLHDLCSGMKMFPQILVNVRYTAGSGDPLEHESVKAVTAEVEAALGSRGRVLLRKSGTEP 417

Query: 419 LIRIMAEGDDLSRIKRIVDDLAKVIPMI 446
           LIR+M EG+D  ++      +A  +  +
Sbjct: 418 LIRVMVEGEDEEQVTEFAHRIADAVKAV 445


>gi|302185427|ref|ZP_07262100.1| phosphoglucosamine mutase [Pseudomonas syringae pv. syringae 642]
          Length = 447

 Score =  392 bits (1007), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 194/443 (43%), Positives = 296/443 (66%), Gaps = 6/443 (1%)

Query: 3   RRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSL 62
           R++FGTDGIRG+   FPITP FM+++G A G  FR K    R+++GKDTR+SGYM E++L
Sbjct: 4   RKYFGTDGIRGRVGQFPITPEFMLKLGWAAGMAFR-KMGACRILVGKDTRISGYMFESAL 62

Query: 63  VAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVS 122
            AG +AAG D  +LGP+P+PA+A LTR+  A+ G++ISASHNP+ DNGIK F   G K+ 
Sbjct: 63  EAGLSAAGADVLLLGPMPTPAIAYLTRTFHAEAGIVISASHNPHYDNGIKFFSGQGTKLP 122

Query: 123 TDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVVD 182
            +IE  IE LL+  +T   S  +++G   R++    RYIE  K ++P      GL++V+D
Sbjct: 123 DEIEMMIEELLDAPMTVAES--ENLGKVSRINDAAGRYIEFCKSSVPTSTDFAGLKVVID 180

Query: 183 CANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIAL 242
           CA+GA+YKVAP VF ELGA VVV+  +P+G+NIN +CGST++ +LQ  V    AD+GI  
Sbjct: 181 CAHGATYKVAPNVFRELGAQVVVLSAQPDGLNINKNCGSTHMEALQAAVLAEHADMGIGF 240

Query: 243 DGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLGL 302
           DGDGDRV++VD  G IV+GD+++ +IAR+      L+G G+V T+MSN+GLE  +A  G+
Sbjct: 241 DGDGDRVLMVDHTGTIVDGDELLYIIARDLHERGRLQG-GVVGTLMSNLGLELALAEQGI 299

Query: 303 SLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKPV 362
              R  VGDRY++  +    + +GGE SGHI+   + +TGD ++A+LQV+  +++    +
Sbjct: 300 PFVRANVGDRYVIAELLERNWQIGGENSGHIVCFPHATTGDAIIASLQVILALRRSGVSL 359

Query: 363 STICHCFEEYPQFLRSVSVKDTSI--LNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
           +       + PQ L +V    + +  ++  S+ +A A    ++ G  R+++R SGTE L+
Sbjct: 360 AEARLKLRKCPQILINVRFAGSGVDPVSHPSVQEACARVTEQMAGRGRVLLRKSGTEPLV 419

Query: 421 RIMAEGDDLSRIKRIVDDLAKVI 443
           R+M EG+D ++++   ++LAK++
Sbjct: 420 RVMVEGEDETQVRAYAEELAKLV 442


>gi|300990777|ref|ZP_07179349.1| phosphoglucosamine mutase [Escherichia coli MS 45-1]
 gi|300407085|gb|EFJ90623.1| phosphoglucosamine mutase [Escherichia coli MS 45-1]
          Length = 445

 Score =  392 bits (1007), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 210/448 (46%), Positives = 298/448 (66%), Gaps = 10/448 (2%)

Query: 3   RRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSL 62
           R++FGTDGIRG+    PITP+F++++G A G +   +   R+++IGKDTR+SGYMLE++L
Sbjct: 4   RKYFGTDGIRGRVGDAPITPDFVLKLGWAAGKVL-ARHGSRKIIIGKDTRISGYMLESAL 62

Query: 63  VAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVS 122
            AG  AAG+ A   GP+P+PAVA LTR+ RA+ G++ISASHNP+ DNGIK F  DG K+ 
Sbjct: 63  EAGLAAAGLSALFTGPMPTPAVAYLTRTFRAEAGIVISASHNPFYDNGIKFFSIDGTKLP 122

Query: 123 TDIEDRIETLLEDDLTSYLSCYDS--IGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
             +E+ IE  +E ++    SC DS  +G A R+     RYIE  K T P +++L  L+IV
Sbjct: 123 DAVEEAIEAEMEKEI----SCVDSAELGKASRIVDAAGRYIEFCKATFPNELSLSELKIV 178

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           VDCANGA+Y +AP V  ELGA+V+ IG +PNG+NIN + G+T+V +LQ +V   +AD+GI
Sbjct: 179 VDCANGATYHIAPNVLRELGANVIAIGCEPNGVNINAEVGATDVRALQARVLAEKADLGI 238

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           A DGDGDRVI+VD +G  V+GDQIM +IARE +    LRG G V T+MSN+GLE  +  L
Sbjct: 239 AFDGDGDRVIMVDHEGNKVDGDQIMYIIAREGLRQGQLRG-GAVGTLMSNMGLELALKQL 297

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           G+   R +VGDRY++E M+  G+ +G E SGH+IL D  +TGDG+VA LQVL  + +   
Sbjct: 298 GIPFARAKVGDRYVLEKMQEKGWRIGAENSGHVILLDKTTTGDGIVAGLQVLAAMARNHM 357

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTS--ILNSSSIVQAIADAESELRGIDRLIVRASGTES 418
            +  +C   + +PQ L +V     S   L   S+    A+ E+ L    R+++R SGTE 
Sbjct: 358 SLHDLCSGMKMFPQILVNVRYTAGSGDPLEHESVKAVTAEVEAALGSRGRVLLRKSGTEP 417

Query: 419 LIRIMAEGDDLSRIKRIVDDLAKVIPMI 446
           LIR+M EG+D +++      +A  +  +
Sbjct: 418 LIRVMMEGEDEAQVTEFAHRIADAVKAV 445


>gi|260900798|ref|ZP_05909193.1| phosphoglucosamine mutase [Vibrio parahaemolyticus AQ4037]
 gi|308108203|gb|EFO45743.1| phosphoglucosamine mutase [Vibrio parahaemolyticus AQ4037]
 gi|328474230|gb|EGF45035.1| phosphoglucosamine mutase [Vibrio parahaemolyticus 10329]
          Length = 446

 Score =  392 bits (1007), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 207/435 (47%), Positives = 297/435 (68%), Gaps = 9/435 (2%)

Query: 2   KRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENS 61
           KRR+FGTDG+RGK   +PITP+F++++G A G +   K+  ++V+IGKDTR+SGYMLE++
Sbjct: 4   KRRYFGTDGVRGKVGQYPITPDFVLKLGWAAGRVL-AKQGTKKVIIGKDTRISGYMLESA 62

Query: 62  LVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKV 121
           L AG  AAG+ A   GP+P+PAVA LT++ RA+ G++ISASHNPY DNGIK F  +G K+
Sbjct: 63  LEAGLAAAGLKATFTGPMPTPAVAYLTQTFRAEAGIVISASHNPYYDNGIKFFSSEGTKL 122

Query: 122 STDIEDRIETLLEDDLTSYLSCYDS--IGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRI 179
             DIE  IE  L+ D+     C +S  +G A R++    RYIE  K T P  ++L  L+I
Sbjct: 123 PDDIELAIEAELDKDI----ECVESSELGKATRLNDAAGRYIEFCKSTFPSTLSLSNLKI 178

Query: 180 VVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIG 239
           VVDCANGA+Y +AP VF ELGADV+ +G +PNGININ + G+T+V +LQ++V E +A +G
Sbjct: 179 VVDCANGATYHIAPNVFKELGADVIAMGVEPNGININEEVGATDVRALQKRVVEEQAHLG 238

Query: 240 IALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAG 299
           +A DGDGDR+I+VD  G  V+GDQI  +IAR+ +    L+G G+V T+M+N+G+E  +  
Sbjct: 239 LAFDGDGDRIIMVDHLGNKVDGDQIAYIIARDALRRGELKG-GVVGTLMTNLGMENGLKQ 297

Query: 300 LGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYD 359
           LG+   R  VGDRY+ME +   G+ +G E SGH+IL D  +TGD +VAALQVL  +   D
Sbjct: 298 LGIPFVRAAVGDRYVMEQLLAKGWKIGAENSGHVILLDKVTTGDAIVAALQVLASVVGSD 357

Query: 360 KPVSTICHCFEEYPQFLRSVSVK-DTSILNSSSIVQAIADAESELRGIDRLIVRASGTES 418
             +  +      YPQ L +V    + + L + +++ A+ + E+EL    R+++R SGTE 
Sbjct: 358 MSLHDLSQGMTLYPQVLENVRFAGENNPLEAQAVLAAVEEVEAELGDKGRVLLRKSGTEP 417

Query: 419 LIRIMAEGDDLSRIK 433
           LIR+M EG+D   ++
Sbjct: 418 LIRVMVEGEDAELVQ 432


>gi|254805446|ref|YP_003083667.1| phosphoglucosamine mutase [Neisseria meningitidis alpha14]
 gi|254668988|emb|CBA07332.1| phosphoglucosamine mutase [Neisseria meningitidis alpha14]
          Length = 444

 Score =  392 bits (1007), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 198/428 (46%), Positives = 292/428 (68%), Gaps = 8/428 (1%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRR--VVIGKDTRLSGYML 58
           M +++FGTDG+RG+   FPITP+F++++G A G +       ++  V+IGKDTR+SGYML
Sbjct: 1   MAKKYFGTDGVRGEVGQFPITPDFVLKLGYAAGQVLVQHDTGQKPTVLIGKDTRISGYML 60

Query: 59  ENSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDG 118
           E +LVAGFTAAG++    GP+P+P VA LTR+LR   GVMISASHN Y DNGIK F   G
Sbjct: 61  EAALVAGFTAAGVNVIQTGPLPTPGVAYLTRALRLSAGVMISASHNAYSDNGIKFFAEGG 120

Query: 119 YKVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLR 178
            K+S ++E  IE  +++++ +  S    +G A+R++G  DRYIE  K T P    L+GL+
Sbjct: 121 VKLSDEVELEIEAKIDEEMKTQPSA--RLGRARRINGADDRYIEFCKSTFPTHSDLRGLK 178

Query: 179 IVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADI 238
           +VVD ANGA+Y VAP+VF ELGA VV IG++PNG NIN  CG+T+  +LQ  V +  AD 
Sbjct: 179 LVVDAANGAAYSVAPKVFHELGAQVVSIGNEPNGYNINEKCGATHTKTLQAVVLQNEADY 238

Query: 239 GIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIA 298
           GIALDGDGDR+++VD+ G + +GD ++ +IA+      +  G G+V TVM+N+ +E  + 
Sbjct: 239 GIALDGDGDRLMMVDKNGQVYDGDSLIYVIAKARAGEGVNIG-GVVGTVMTNMAMENALK 297

Query: 299 GLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQY 358
             G+   R +VGDRY++E +   G+ VGGE SGHI+  D  +TGDG+++ALQVL  ++  
Sbjct: 298 EQGVDFCRAKVGDRYVLEQLNRRGWLVGGEASGHILCMDKHNTGDGIISALQVLAALQTL 357

Query: 359 DKPVSTICHCFEEYPQFLRSVSV-KDTSILNSSSIVQAIADAESELRGIDRLIVRASGTE 417
           ++ ++ +C  ++ YPQ + +V + K  +   +S  V  +A+ E EL G  R+++RASGTE
Sbjct: 358 NQDLAAVCADWQPYPQTMINVRIGKGQNWQEASKTV--LAEVEKELEGKGRVVLRASGTE 415

Query: 418 SLIRIMAE 425
            ++R+M E
Sbjct: 416 PVVRVMVE 423


>gi|746403|gb|AAA97510.1| regulatory protein [Escherichia coli]
          Length = 445

 Score =  392 bits (1007), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 204/448 (45%), Positives = 293/448 (65%), Gaps = 10/448 (2%)

Query: 3   RRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSL 62
           R++FGTDGIRG+    PITP+F++++G A G +   +   R+++IGKDTR+SGYMLE++L
Sbjct: 4   RKYFGTDGIRGRVGDAPITPDFVLKLGWAAGKVL-ARHGSRKIIIGKDTRISGYMLESAL 62

Query: 63  VAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVS 122
            AG  A G+ A   GP+P+PAVA LTR+ RA+ G++ISASHNP+ DNGIK F  DG K+ 
Sbjct: 63  EAGLAARGLSALFTGPMPTPAVAYLTRTFRAEAGIVISASHNPFYDNGIKFFSIDGTKLP 122

Query: 123 TDIEDRIETLLEDDLTSYLSCYDS--IGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
             +E+ IE  +E ++    SC DS  +G A R+     RYIE  K T   +++L  L+I+
Sbjct: 123 DAVEEAIEAEMEKEI----SCVDSAELGKASRIVDAAGRYIEFSKATFRNELSLSELKIL 178

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           V  ANGA+Y +AP V  ELGA+V+ IG +PNG+NIN + G+T+V +LQ +V   +AD+GI
Sbjct: 179 VIGANGATYHIAPNVLRELGANVIAIGCEPNGVNINAEVGATDVRALQARVLAEKADLGI 238

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           A DGDGDRVI+VD +G  V+GDQIM +IARE +    LRG G V T+MSN+GLE  +  L
Sbjct: 239 AFDGDGDRVIMVDHEGNKVDGDQIMYIIAREGLRQGQLRG-GAVGTLMSNMGLELALKQL 297

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           G+   R +VGDRY++E M+  G+ +G E SGH+IL D  +TGDG+VA LQVL  + +   
Sbjct: 298 GIPFARAKVGDRYVLEKMQEKGWRIGAENSGHVILLDKTTTGDGIVAGLQVLAAMARNHM 357

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTS--ILNSSSIVQAIADAESELRGIDRLIVRASGTES 418
            +  +C   + +PQ L +V     S   L   S+    A+ E+ L    R+++  SGTE 
Sbjct: 358 SLHDLCSGMKMFPQILVNVRYTAGSGDPLEHESVKAVTAEVEAALGNRGRVLLCKSGTER 417

Query: 419 LIRIMAEGDDLSRIKRIVDDLAKVIPMI 446
           LIR+M EG+D +++      +A  +  +
Sbjct: 418 LIRVMVEGEDEAQVTEFAHRIADAVKAV 445


>gi|270158117|ref|ZP_06186774.1| phosphoglucosamine mutase [Legionella longbeachae D-4968]
 gi|289163618|ref|YP_003453756.1| phosphoglucomutase [Legionella longbeachae NSW150]
 gi|269990142|gb|EEZ96396.1| phosphoglucosamine mutase [Legionella longbeachae D-4968]
 gi|288856791|emb|CBJ10602.1| putative phosphoglucomutase [Legionella longbeachae NSW150]
          Length = 451

 Score =  392 bits (1007), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 205/447 (45%), Positives = 293/447 (65%), Gaps = 5/447 (1%)

Query: 2   KRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENS 61
           +R++FGTDGIRG      I P F++++G A+G +     + ++VVIGKDTR+SGYMLE++
Sbjct: 3   QRKYFGTDGIRGHVGLSNINPEFVLKLGWAIGQVLANGHR-KKVVIGKDTRVSGYMLESA 61

Query: 62  LVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKV 121
           L AG +AAG+D  +LGP+P+P +A LT++LRA+ G++ISASHN ++DNGIK F  +G K+
Sbjct: 62  LEAGLSAAGVDVALLGPMPTPGIAYLTQTLRANAGIVISASHNQFEDNGIKFFSAEGGKL 121

Query: 122 STDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVV 181
              +E  IE  LE  + +  S  + +G A R++    RYIE  K T+P    L GL++VV
Sbjct: 122 PDSVELAIEEELEKKMQTVPS--EKLGKATRINDATGRYIEFCKSTIPSLTRLSGLKVVV 179

Query: 182 DCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIA 241
           DCANGA+Y VAP VF ELGA V+ I ++P+G NIN +CGST+   L++KV    ADIGI 
Sbjct: 180 DCANGATYHVAPNVFAELGAQVISIANRPDGFNINDNCGSTSPELLRQKVISTGADIGIG 239

Query: 242 LDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLG 301
           LDGDGDR I++D +G IVNGDQI+ +IA++     +L G GIV T+MSN GLER +  LG
Sbjct: 240 LDGDGDRAILIDSEGNIVNGDQILYIIAKDRHQRGVLHG-GIVGTLMSNYGLERALKELG 298

Query: 302 LSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKP 361
           +   R++VGDRY++E +  N + +GGE SGHI+  D  +TGDG+VAALQVL  + +  K 
Sbjct: 299 VPFIRSKVGDRYVLEALHKNDWKIGGEPSGHIVCLDKTTTGDGIVAALQVLSMMVKQGKT 358

Query: 362 VSTICHCFEEYPQFLRSVSVKDTSIL-NSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
           +  +       PQ L +        L  +  +++ I   E  L+G  R+++R SGTE L+
Sbjct: 359 LQQLTQGITLLPQSLVNFKTNHAERLAKNPQVIERIKALEKNLKGDGRVLLRPSGTEPLL 418

Query: 421 RIMAEGDDLSRIKRIVDDLAKVIPMID 447
           R+M EG + S +K+    L   I  ID
Sbjct: 419 RVMVEGINESLVKQYAQKLCDDIRQID 445


>gi|332086094|gb|EGI91256.1| phosphoglucosamine mutase [Shigella boydii 5216-82]
          Length = 445

 Score =  392 bits (1007), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 210/448 (46%), Positives = 297/448 (66%), Gaps = 10/448 (2%)

Query: 3   RRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSL 62
           R++FGTDGIRG+    PITP+F++++G A G +   +   R+++IGKDTR+SGYMLE++L
Sbjct: 4   RKYFGTDGIRGRVGDAPITPDFVLKLGWAAGKVL-ARHGSRKIIIGKDTRISGYMLESAL 62

Query: 63  VAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVS 122
            AG  AAG+ A   GP+P+PAVA LTR+ RA+ G++ISASHNP+ DNGIK F  DG K+ 
Sbjct: 63  EAGLAAAGLSALFTGPMPTPAVAYLTRTFRAEAGIVISASHNPFYDNGIKFFSIDGTKLP 122

Query: 123 TDIEDRIETLLEDDLTSYLSCYDS--IGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
             +E+ IE  +E ++    SC DS  +G A R+     RYIE  K T P +++L  L+IV
Sbjct: 123 DAVEEAIEAEMEKEI----SCVDSAELGKASRIVDAAGRYIEFCKATFPNELSLSELKIV 178

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           VDCANGA+Y +AP V  ELGA+V+ IG +PNG+NIN   G+T+V +LQ +V   +AD+GI
Sbjct: 179 VDCANGATYHIAPNVLRELGANVIAIGCEPNGVNINAKVGATDVRALQARVLAEKADLGI 238

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           A DGDGDRVI+VD +G  V+GDQIM +IARE +    LRG G V T+MSN+GLE  +  L
Sbjct: 239 AFDGDGDRVIMVDHEGNKVDGDQIMYIIAREGLRQGQLRG-GAVGTLMSNMGLELALKQL 297

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           G+   R +VGDRY++E M+  G+ +G E SGH+IL D  +TGDG+VA LQVL  + +   
Sbjct: 298 GIPFARAKVGDRYVLEKMQEKGWRIGAENSGHVILLDKTTTGDGIVAGLQVLAAMARNHM 357

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTS--ILNSSSIVQAIADAESELRGIDRLIVRASGTES 418
            +  +C   + +PQ L +V     S   L   S+    A+ E+ L    R+++R SGTE 
Sbjct: 358 SLHDLCSGMKMFPQILVNVRYTAGSGDPLEHESVKAVTAEVEAALGSRGRVLLRKSGTEP 417

Query: 419 LIRIMAEGDDLSRIKRIVDDLAKVIPMI 446
           LIR+M EG+D +++      +A  +  +
Sbjct: 418 LIRVMVEGEDEAQVTEFAHRIADAVKAV 445


>gi|68250006|ref|YP_249118.1| phosphoglucosamine mutase [Haemophilus influenzae 86-028NP]
 gi|81335570|sp|Q4QKI9|GLMM_HAEI8 RecName: Full=Phosphoglucosamine mutase
 gi|68058205|gb|AAX88458.1| predicted phosphomannomutase [Haemophilus influenzae 86-028NP]
          Length = 445

 Score =  392 bits (1007), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 206/448 (45%), Positives = 299/448 (66%), Gaps = 9/448 (2%)

Query: 3   RRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSL 62
           R++FGTDG+RGK  ++PITP+F +++G A G +    +  + V+IGKDTR+SGYMLE++L
Sbjct: 4   RKYFGTDGVRGKVGSYPITPDFALKLGWAAGKVL-ASQGSKMVLIGKDTRISGYMLESAL 62

Query: 63  VAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVS 122
            AG  AAG+ A   GP+P+PA+A LTR+ RA+ G++ISASHNPY DNGIK F   G K+ 
Sbjct: 63  EAGLAAAGLSAAFTGPMPTPAIAYLTRTFRAEAGIVISASHNPYYDNGIKFFSAKGTKLP 122

Query: 123 TDIEDRIETLLEDDLTSYLSCYDS--IGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
            +IE+ IE +LE  +     C +S  +G A R++    RYIE  K T P  + L+G +IV
Sbjct: 123 DEIEEAIEAMLEQPM----DCVESAELGKASRINDAAGRYIEFCKGTFPAHLGLEGYKIV 178

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           VDCANGA+Y +AP V  ELGA+V+ IG  PNG+NIN  CG+T+V +LQ KV E +AD+G+
Sbjct: 179 VDCANGATYHIAPNVLRELGAEVIEIGTDPNGLNINEKCGATDVTALQAKVVETKADVGL 238

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           A DGDGDR+++VD  G  V+GDQI+ +IARE +    L+G G+V T+MSN+ LE  +  L
Sbjct: 239 AYDGDGDRIMMVDHLGNKVDGDQILFIIAREALRSGQLKG-GVVGTLMSNMSLEIALKML 297

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           G+   R  VGDRY++E M  N + +GGE SGHII++D  +TGDG+VA+L VL  + Q+  
Sbjct: 298 GVPFLRANVGDRYVLEKMLENDWTLGGENSGHIIIADKNTTGDGIVASLAVLAAMAQHKL 357

Query: 361 PVSTICHCFEEYPQFLRSVSVK-DTSILNSSSIVQAIADAESELRGIDRLIVRASGTESL 419
            ++ +    + +PQ L +V      + L S ++    A+ E  L G  R+++R SGTE L
Sbjct: 358 SLNELASAVKLFPQVLINVRFAGGENPLESDAVKSVAAEVEKRLEGKGRILLRKSGTEPL 417

Query: 420 IRIMAEGDDLSRIKRIVDDLAKVIPMID 447
           IR+M E  D    ++  +++A+ +  I+
Sbjct: 418 IRVMVECQDAELAQQCAEEIAEAVKKIN 445


>gi|296313471|ref|ZP_06863412.1| phosphoglucosamine mutase [Neisseria polysaccharea ATCC 43768]
 gi|296839989|gb|EFH23927.1| phosphoglucosamine mutase [Neisseria polysaccharea ATCC 43768]
          Length = 444

 Score =  392 bits (1006), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 199/445 (44%), Positives = 293/445 (65%), Gaps = 6/445 (1%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRR--VVIGKDTRLSGYML 58
           M +++FGTDG+RG+   FPITP+F++++G A G +       ++  V+IGKDTR+SGYML
Sbjct: 1   MAKKYFGTDGVRGEVGQFPITPDFVLKLGYAAGQVLVQHDTDQKPTVLIGKDTRISGYML 60

Query: 59  ENSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDG 118
           E +LVAGFTAAG++    GP+P+P VA LTR+LR   GVMISASHN Y DNGIK F   G
Sbjct: 61  EAALVAGFTAAGVNVIQTGPLPTPGVAYLTRALRLSAGVMISASHNAYSDNGIKFFAEGG 120

Query: 119 YKVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLR 178
            K+S +IE  IE  +++++ +  S    +G A+R+ G  DRYIE  K T P    L+GL+
Sbjct: 121 VKLSDEIELEIEAKIDEEMKTQPSA--RLGRARRISGADDRYIEFCKSTFPSHSDLRGLK 178

Query: 179 IVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADI 238
           +V+D ANGA Y VAP+VF ELGA VV IGD+PNG NIN  CG+T   +LQ  V +  AD 
Sbjct: 179 LVIDTANGAGYGVAPKVFHELGAQVVSIGDEPNGYNINEKCGATYTKTLQAAVLQHEADY 238

Query: 239 GIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIA 298
           GIALDGDGDR+++VD+ G + +GD ++ +IA+      +  G G+V TVM+N+ +E  + 
Sbjct: 239 GIALDGDGDRLMMVDKNGKVYDGDSLIYVIAKARAREGINIG-GVVGTVMTNMAMEIALK 297

Query: 299 GLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQY 358
             G+   R +VGDRY++E +   G+ +GGE SGHI+  D  +TGDG+++ALQVL  ++  
Sbjct: 298 EQGVDFCRAKVGDRYVLEQLNQRGWLIGGEASGHILCMDKHNTGDGIISALQVLAALQIL 357

Query: 359 DKPVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTES 418
           ++ ++T+C  ++ YPQ + +V ++       +S    +A+ E EL G  R+++RASGTE 
Sbjct: 358 NQDLATVCADWQPYPQTMINVRIQKGQKWQEAS-KDVLAEVEKELEGKGRVVLRASGTEP 416

Query: 419 LIRIMAEGDDLSRIKRIVDDLAKVI 443
           ++R+M E       +   + +A  I
Sbjct: 417 VVRVMVEARQADWAREGAERIASAI 441


>gi|197335564|ref|YP_002155237.1| phosphoglucosamine mutase [Vibrio fischeri MJ11]
 gi|226723932|sp|B5FA75|GLMM_VIBFM RecName: Full=Phosphoglucosamine mutase
 gi|197317054|gb|ACH66501.1| phosphoglucosamine mutase [Vibrio fischeri MJ11]
          Length = 445

 Score =  392 bits (1006), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 208/445 (46%), Positives = 300/445 (67%), Gaps = 9/445 (2%)

Query: 2   KRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENS 61
           +R++FGTDG+RG     PITP+F+M++G A G +   K+  ++V+IGKDTR+SGYMLE++
Sbjct: 3   ERKYFGTDGVRGLVGQAPITPDFVMKLGWAAGQVL-AKQGTKKVIIGKDTRISGYMLESA 61

Query: 62  LVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKV 121
           L AG  AAG+ A   GP+P+PAVA LT++ RA+ G++ISASHNPY DNGIK F  +G K+
Sbjct: 62  LEAGLAAAGLQAKFTGPMPTPAVAYLTQTFRAEAGIVISASHNPYYDNGIKFFSSEGTKL 121

Query: 122 STDIEDRIETLLEDDLTSYLSCYDS--IGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRI 179
             D+E  IE  L+  +T    C +S  +G A R++    RYIE  K T P++++L GL+I
Sbjct: 122 PDDVEMAIEAELDKPMT----CVESALLGKASRLNDAAGRYIEFCKSTFPKELSLAGLKI 177

Query: 180 VVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIG 239
           V+DCANGA+Y +AP VF ELGA+++ IG +PNG NIN + G+T+V +LQ KV E +AD G
Sbjct: 178 VIDCANGATYHIAPNVFKELGAEIITIGCEPNGTNINHEVGATDVRALQAKVVEEKADFG 237

Query: 240 IALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAG 299
           +A DGDGDR+I+VDE G  V+GDQI  +IAR+ +    L+G G+V T+M+N+G+E  +  
Sbjct: 238 VAFDGDGDRIIMVDEFGEKVDGDQIAYIIARDALRRGELKG-GVVGTLMTNMGMEVALRN 296

Query: 300 LGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYD 359
           LG+   R++VGDRY+ME +  N + +G E SGH+IL D  +TGD +VAALQV+  I    
Sbjct: 297 LGIPFVRSDVGDRYVMEKLLENNWLIGAENSGHVILLDKVTTGDAIVAALQVIASIVGSK 356

Query: 360 KPVSTICHCFEEYPQFLRSVSVK-DTSILNSSSIVQAIADAESELRGIDRLIVRASGTES 418
             +  +C     +PQ L +V    D   L S ++  A AD E++L    R+++R SGTE 
Sbjct: 357 MSLKELCDGMSMFPQILVNVRFAGDNDPLESEAVKAAQADVEAKLGDNGRVLLRKSGTEP 416

Query: 419 LIRIMAEGDDLSRIKRIVDDLAKVI 443
           LIR+M EG+D   + +    +A  +
Sbjct: 417 LIRVMVEGEDAELVTQYAQQIADAV 441


>gi|329123418|ref|ZP_08251982.1| phosphoglucosamine mutase [Haemophilus aegyptius ATCC 11116]
 gi|327471000|gb|EGF16455.1| phosphoglucosamine mutase [Haemophilus aegyptius ATCC 11116]
          Length = 445

 Score =  392 bits (1006), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 205/450 (45%), Positives = 300/450 (66%), Gaps = 9/450 (2%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           + R++FGTDG+RGK   +PITP+F +++G A G +    +  + V+IGKDTR+SGYMLE+
Sbjct: 2   VNRKYFGTDGVRGKVGAYPITPDFALKLGWAAGKVL-ASQGSKMVLIGKDTRISGYMLES 60

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +L AG  AAG+ A   GP+P+PA+A LTR+ RA+ G++ISASHNPY DNGIK F   G K
Sbjct: 61  ALEAGLAAAGLSAAFTGPMPTPAIAYLTRTFRAEAGIVISASHNPYYDNGIKFFSAKGTK 120

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDS--IGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLR 178
           +  +IE+ IE +LE  +     C +S  +G A R++    RYIE  K T P  + L+G +
Sbjct: 121 LPDEIEEAIEAMLEQPM----DCVESAELGKASRINDAAGRYIEFCKGTFPAHLGLEGYK 176

Query: 179 IVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADI 238
           IVVDCANGA+Y +AP V  ELGA+V+ IG  PNG+NIN  CG+T+V +LQ KV E +AD+
Sbjct: 177 IVVDCANGATYHIAPNVLRELGAEVIEIGTDPNGLNINEKCGATDVTALQAKVVETKADV 236

Query: 239 GIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIA 298
           G+A DGDGDR+++VD  G  V+GDQI+ +IARE +    L+G G+V T+MSN+ LE  + 
Sbjct: 237 GLAYDGDGDRIMMVDHLGNKVDGDQILFIIAREALRSGQLKG-GVVGTLMSNMSLEIALK 295

Query: 299 GLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQY 358
            LG+   R  VGDRY++E M  N + +GGE SGHII++D  +TGDG+VA+L VL  + Q+
Sbjct: 296 MLGVPFLRANVGDRYVLEKMVENDWTLGGENSGHIIIADKNTTGDGIVASLAVLAAMAQH 355

Query: 359 DKPVSTICHCFEEYPQFLRSVSVK-DTSILNSSSIVQAIADAESELRGIDRLIVRASGTE 417
              ++ +    + +PQ L +V      ++L + ++    A+ E  L G  R+++R SGTE
Sbjct: 356 KLSLNELASAVKLFPQVLINVRFAGGENLLENDAVKSVAAEVEKRLEGKGRILLRKSGTE 415

Query: 418 SLIRIMAEGDDLSRIKRIVDDLAKVIPMID 447
            LIR+M E  D    ++  +++A+ +  I+
Sbjct: 416 PLIRVMVECQDAELAQQCAEEIAEAVKKIN 445


>gi|319897094|ref|YP_004135289.1| phosphomannomutase [Haemophilus influenzae F3031]
 gi|317432598|emb|CBY80959.1| predicted phosphomannomutase [Haemophilus influenzae F3031]
          Length = 445

 Score =  392 bits (1006), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 206/448 (45%), Positives = 300/448 (66%), Gaps = 9/448 (2%)

Query: 3   RRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSL 62
           R++FGTDG+RGK  ++PITP+F +++G A G +    +  + V+IGKDTR+SGYMLE++L
Sbjct: 4   RKYFGTDGVRGKVGSYPITPDFALKLGWAAGKVL-ASQGSKMVLIGKDTRISGYMLESAL 62

Query: 63  VAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVS 122
            AG  AAG+ A   GP+P+PA+A LTR+ RA+ G++ISASHNPY DNGIK F   G K+ 
Sbjct: 63  EAGLAAAGLSAAFTGPMPTPAIAYLTRTFRAEAGIVISASHNPYYDNGIKFFSAKGTKLP 122

Query: 123 TDIEDRIETLLEDDLTSYLSCYDS--IGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
            +IE+ IE +LE  +     C +S  +G A R++    RYIE  K T P  + L+G +IV
Sbjct: 123 DEIEEAIEGMLEQPM----DCVESAELGKASRINDAAGRYIEFCKGTFPAHLGLEGYKIV 178

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           VDCANGA+Y +AP V  ELGA+V+ IG  PNG+NIN  CG+T+V +LQ KV E++AD+G+
Sbjct: 179 VDCANGATYHIAPNVLRELGAEVIEIGTDPNGLNINEKCGATDVTALQAKVVEMKADVGL 238

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           A DGDGDR+++VD  G  V+GDQI+ +IARE +    L+G G+V T+MSN+ LE  +  L
Sbjct: 239 AYDGDGDRIMMVDHLGNKVDGDQILFIIAREALRSGQLKG-GVVGTLMSNMSLEIALKML 297

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           G+   R  VGDRY++E M  N + +GGE SGHII++D  +TGDG+VA+L VL  + Q+  
Sbjct: 298 GVPFLRANVGDRYVLEKMVENDWTLGGENSGHIIIADKNTTGDGIVASLAVLAAMAQHKL 357

Query: 361 PVSTICHCFEEYPQFLRSVSVK-DTSILNSSSIVQAIADAESELRGIDRLIVRASGTESL 419
            ++ +    + +PQ L +V      + L S ++    A+ E  L G  R+++R SGTE L
Sbjct: 358 SLNELASAVKLFPQVLINVRFAGGENPLESDAVKSVAAEVEKRLEGKGRILLRKSGTEPL 417

Query: 420 IRIMAEGDDLSRIKRIVDDLAKVIPMID 447
           IR+M E  D    ++  +++A+ +  I+
Sbjct: 418 IRVMVECQDAELAQQCAEEIAEAVKKIN 445


>gi|16273247|ref|NP_439488.1| phosphoglucosamine mutase [Haemophilus influenzae Rd KW20]
 gi|16273368|ref|NP_439614.1| phosphoglucosamine mutase [Haemophilus influenzae Rd KW20]
 gi|260581545|ref|ZP_05849351.1| phosphoglucosamine mutase [Haemophilus influenzae RdAW]
 gi|1171026|sp|P45164|GLMM_HAEIN RecName: Full=Phosphoglucosamine mutase
 gi|1574303|gb|AAC23110.1| mrsA protein (mrsA) [Haemophilus influenzae Rd KW20]
 gi|1574798|gb|AAC22984.1| mrsA protein (mrsA) [Haemophilus influenzae Rd KW20]
 gi|260091801|gb|EEW75758.1| phosphoglucosamine mutase [Haemophilus influenzae RdAW]
          Length = 445

 Score =  392 bits (1006), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 206/448 (45%), Positives = 298/448 (66%), Gaps = 9/448 (2%)

Query: 3   RRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSL 62
           R++FGTDG+RGK   +PITP+F +++G A G +    +  + V+IGKDTR+SGYMLE++L
Sbjct: 4   RKYFGTDGVRGKVGAYPITPDFALKLGWAAGKVL-ASQGSKMVLIGKDTRISGYMLESAL 62

Query: 63  VAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVS 122
            AG  AAG+ A   GP+P+PA+A LTR+ RA+ G++ISASHNPY DNGIK F   G K+ 
Sbjct: 63  EAGLAAAGLSAAFTGPMPTPAIAYLTRTFRAEAGIVISASHNPYYDNGIKFFSAKGTKLP 122

Query: 123 TDIEDRIETLLEDDLTSYLSCYDS--IGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
            +IE+ IE +LE  +     C +S  +G A R++    RYIE  K T P  + L+G +IV
Sbjct: 123 DEIEEAIEAMLEQPM----DCVESAELGKASRINDAAGRYIEFCKGTFPAHLGLEGYKIV 178

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           VDCANGA+Y +AP V  ELGA+V+ IG  PNG+NIN  CG+T+V +LQ KV E +AD+G+
Sbjct: 179 VDCANGATYHIAPNVLRELGAEVIEIGTDPNGLNINEKCGATDVTALQAKVVETKADVGL 238

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           A DGDGDR+++VD  G  V+GDQI+ +IARE +    L+G G+V T+MSN+ LE  +  L
Sbjct: 239 AYDGDGDRIMMVDHLGNKVDGDQILFIIAREALRSGQLKG-GVVGTLMSNMSLEIALKML 297

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           G+   R  VGDRY++E M  N + +GGE SGHII++D  +TGDG+VA+L VL  + Q+  
Sbjct: 298 GVPFLRANVGDRYVLEKMVENDWTLGGENSGHIIIADKNTTGDGIVASLAVLAAMAQHKL 357

Query: 361 PVSTICHCFEEYPQFLRSVSVK-DTSILNSSSIVQAIADAESELRGIDRLIVRASGTESL 419
            ++ +    + +PQ L +V      + L S ++    A+ E  L G  R+++R SGTE L
Sbjct: 358 SLNELASAVKLFPQVLINVRFAGGENPLESDAVKSVAAEVEKRLEGKGRILLRKSGTEPL 417

Query: 420 IRIMAEGDDLSRIKRIVDDLAKVIPMID 447
           IR+M E  D    ++  +++A+ +  I+
Sbjct: 418 IRVMVECQDAELAQQCAEEIAEAVKKIN 445


>gi|119710814|gb|ABL96596.1| GlmM [Enterobacter sp. BL-2]
          Length = 445

 Score =  392 bits (1006), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 209/448 (46%), Positives = 298/448 (66%), Gaps = 10/448 (2%)

Query: 3   RRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSL 62
           R++FGTDGIRG+    PITP+F++++G A G +   +   R+++IGKDTR+SGYMLE++L
Sbjct: 4   RKYFGTDGIRGRVGDAPITPDFVLKLGWAAGKVL-