PSIBLAST alignment of GI: 254780544 and protein with PDB id: 1p5d

>gi|42543249|pdb|1P5D|X Chain X, Enzyme-Ligand Complex Of P. Aeruginosa PmmPGM Length = 463
>gi|42543250|pdb|1P5G|X Chain X, Enzyme-Ligand Complex Of P. Aeruginosa PmmPGM Length = 463
>gi|42543277|pdb|1PCJ|X Chain X, Enzyme-Ligand Complex Of P. Aeruginosa PmmPGM Length = 463
>gi|42543278|pdb|1PCM|X Chain X, Enzyme-Ligand Complex Of P. Aeruginosa PmmPGM Length = 463
 Score =  183 bits (464), Expect = 5e-44,   Method: Composition-based stats.
 Identities = 116/462 (25%), Positives = 191/462 (41%), Gaps = 33/462 (7%)

Query: 4   RFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSLV 63
             F    IRG      +T      IG A+G     + +   V +G+D RLSG  L   L+
Sbjct: 12  SIFRAYDIRGVVGD-TLTAETAYWIGRAIGSESLARGE-PCVAVGRDGRLSGPELVKQLI 69

Query: 64  AGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVST 123
            G    G     +G +P+P +      L    GVM++  HNP   NG K+        + 
Sbjct: 70  QGLVDCGCQVSDVGMVPTPVLYYAANVLEGKSGVMLTGXHNPPDYNGFKIVVAGETLANE 129

Query: 124 DIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVVDC 183
            I+   E + ++DL S +   + +          D    + K+        + +++VVDC
Sbjct: 130 QIQALRERIEKNDLASGVGSVEQV----------DILPRYFKQIRDDIAMAKPMKVVVDC 179

Query: 184 ANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNV---LSLQRKVHEVRADIGI 240
            NG +  +AP++   LG  V+ +  + +G   N             L  KV    AD+G+
Sbjct: 180 GNGVAGVIAPQLIEALGCSVIPLYCEVDGNFPNHHPDPGKPENLKDLIAKVKAENADLGL 239

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           A DGDGDRV +V   G I+  D+++ L A++ +S     G  I+  V     L   I+G 
Sbjct: 240 AFDGDGDRVGVVTNTGTIIYPDRLLMLFAKDVVS--RNPGADIIFDVKCTRRLIALISGY 297

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           G      + G   I + MK  G  + GE SGH+   +     D  + +   L  I   D+
Sbjct: 298 GGRPVMWKTGHSLIKKKMKETGALLAGEMSGHVFFKERWFGFDDGIYSAARLLEILSQDQ 357

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTSILNSS-SIVQAI-------ADAESELRGI------ 406
             S   H F  +P  + +  +  T   +S  +I++A+           + L G+      
Sbjct: 358 RDSE--HVFSAFPSDISTPEINITVTEDSKFAIIEALQRDAQWGEGNITTLDGVRVDYPK 415

Query: 407 DRLIVRASGTESLIRIMAEGDDLSRIKRIVDDLAKVIPMIDS 448
              +VRAS T  ++ +  E D    ++RI       +  +DS
Sbjct: 416 GWGLVRASNTTPVLVLRFEADTEEELERIKTVFRNQLKAVDS 457