PSIBLAST alignment of GI: 254780544 and protein with PDB id: 2z0f

gi|160286310|pdb|2Z0F|A Chain A, Crystal Structure Of Putative Phosphoglucomutase From Thermus Thermophilus Hb8 Length = 524
>gi|160286311|pdb|2Z0F|B Chain B, Crystal Structure Of Putative Phosphoglucomutase From Thermus Thermophilus Hb8 Length = 524
 Score =  116 bits (291), Expect = 6e-24,   Method: Composition-based stats.
 Identities = 94/498 (18%), Positives = 166/498 (33%), Gaps = 60/498 (12%)

Query: 6   FGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSLVAG 65
           FGT G RG S     T   ++ I  A+  L         + + KDT         + ++ 
Sbjct: 26  FGTSGHRGSSLKATFTEAHVLAIAQAIAELRPSFGATGPLFLAKDTHALSEPAWATALSV 85

Query: 66  FTAAGMDAF---ILGPIPSPAVAMLTRSLRADV-----GVMISASHNPYQDNGIKLFGPD 117
           F A G++          P+P V++      A       GV+++ SHNP +D G K   P 
Sbjct: 86  FAAHGIEVRVEADGDYTPTPLVSLAILEHNAHHEAKADGVLLTPSHNPPEDGGFKYNPPT 145

Query: 118 GYKVSTDIEDRIETLLEDDLTSYLSCYDSIG----------------HAKRVDGVHDRYI 161
           G   +  I   IE      L   L     +                 + ++V    D   
Sbjct: 146 GGPANARITRAIEERANALLQEGLKGVKRLPLREALARAKPFDYAGLYVEKVAEAVDLEA 205

Query: 162 EHVKRTLPRDVTLQGLRIVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGS 221
                       L G  + V      S+ +  EV             K +   I +DC S
Sbjct: 206 IRASGLRIGVDPLGGASLRVWERLAESHGLPLEVVNPTLDPTFRFMPKDHDGKIRMDCSS 265

Query: 222 TNVLSLQRKVHEVRADIGIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGN 281
              ++      + R D+ I  D D DR  IV  +  ++N +  +A       +     G 
Sbjct: 266 PYAMAG-LLALKDRFDLAIGNDPDADRHGIVTPR-GLMNPNHYLAAALHHLYTTRSWPGA 323

Query: 282 GIVTTVMSNIGLERFIAGLGLSLKRTEVGDRYIME-----YMKNNGFNVGGEQSGHIILS 336
            +  T +++  L+R    LG  +  T VG ++ +      ++   G    G         
Sbjct: 324 KVGKTAVTSALLDRVAQALGREVYETPVGFKHFVAGLLEGWLGFAGEESAGASFLRFDGR 383

Query: 337 DYGSTGDGLVAALQVLRYIKQYDKPVSTICHCFEE---YPQF----------------LR 377
            + +  DG++  L     + +  +    +     E    P +                  
Sbjct: 384 PFSTDKDGILMGLLAAELMAKRGQAPDALYEALAEKLGRPYYARKDLPVSPEAKARLARL 443

Query: 378 SVSVKDTSILNSSSIVQAIADAESE---LRGID------RLIVRASGTESLIRIMAEGD- 427
           S      S L    ++Q +  A      L GI          VR SGTE + ++ AE   
Sbjct: 444 SAKEVHPSTLAGEPVLQVLDRATGNGEPLGGIKVVAANAWFAVRPSGTEDVAKVYAESFL 503

Query: 428 DLSRIKRIVDDLAKVIPM 445
             + ++R++++   ++  
Sbjct: 504 GEAHLERVLEEATALLHK 521