BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780544|ref|YP_003064957.1| phosphoglucosamine mutase
protein [Candidatus Liberibacter asiaticus str. psy62]
         (448 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done



>gi|254780544|ref|YP_003064957.1| phosphoglucosamine mutase protein [Candidatus Liberibacter
           asiaticus str. psy62]
 gi|254040221|gb|ACT57017.1| phosphoglucosamine mutase protein [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 448

 Score =  329 bits (843), Expect = 6e-88,   Method: Composition-based stats.
 Identities = 448/448 (100%), Positives = 448/448 (100%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN
Sbjct: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK
Sbjct: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV
Sbjct: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI
Sbjct: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL
Sbjct: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK
Sbjct: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
           PVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLI
Sbjct: 361 PVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420

Query: 421 RIMAEGDDLSRIKRIVDDLAKVIPMIDS 448
           RIMAEGDDLSRIKRIVDDLAKVIPMIDS
Sbjct: 421 RIMAEGDDLSRIKRIVDDLAKVIPMIDS 448


>gi|315122872|ref|YP_004063361.1| phosphoglucosamine mutase protein [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313496274|gb|ADR52873.1| phosphoglucosamine mutase protein [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 448

 Score =  308 bits (787), Expect = 1e-81,   Method: Composition-based stats.
 Identities = 389/448 (86%), Positives = 426/448 (95%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           MK+R+FGTDGIRGKSN FPITP+ MMR+GI VGYL  GKK++RRVVIGKDTRLSGYMLEN
Sbjct: 1   MKQRYFGTDGIRGKSNIFPITPDVMMRVGIVVGYLLGGKKRNRRVVIGKDTRLSGYMLEN 60

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +LVAGFT+AGM++FILGPIPSPAVAMLTRSLRADVGVMISASHN Y DNGIKLFG DGYK
Sbjct: 61  ALVAGFTSAGMNSFILGPIPSPAVAMLTRSLRADVGVMISASHNQYHDNGIKLFGSDGYK 120

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +STDIED IE+LLE DLT YLSCYDSIG+AKR+DGVHDRYIEHVKRTLPRDVTLQGLRIV
Sbjct: 121 ISTDIEDHIESLLEGDLTPYLSCYDSIGNAKRIDGVHDRYIEHVKRTLPRDVTLQGLRIV 180

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           VDCANGASYKVAP VFWELGADVVVIGDKPNG+NINL+CGSTNVLSLQ+KVHEVRADIGI
Sbjct: 181 VDCANGASYKVAPAVFWELGADVVVIGDKPNGMNINLNCGSTNVLSLQKKVHEVRADIGI 240

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           ALDGDGDR+IIVDEK A+VNGDQIMALIAREWMS+SLL+GNGIVTTVMSN+GLERF++ +
Sbjct: 241 ALDGDGDRIIIVDEKSAVVNGDQIMALIAREWMSNSLLKGNGIVTTVMSNVGLERFLSEI 300

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           GLSLKRT+VGDRY+MEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVL YIK+YDK
Sbjct: 301 GLSLKRTQVGDRYVMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLSYIKKYDK 360

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
           PVSTICHCFEEYPQFLRS+ VKD+ ILN+  +VQAIADAESELRG+DRL+VRASGTE LI
Sbjct: 361 PVSTICHCFEEYPQFLRSIKVKDSFILNNPLVVQAIADAESELRGMDRLVVRASGTEPLI 420

Query: 421 RIMAEGDDLSRIKRIVDDLAKVIPMIDS 448
           RIMAEG+  S+I+RIVDDLAKVIPMIDS
Sbjct: 421 RIMAEGESFSKIRRIVDDLAKVIPMIDS 448


>gi|190893270|ref|YP_001979812.1| phosphoglucosamine mutase [Rhizobium etli CIAT 652]
 gi|226723908|sp|B3PYX0|GLMM_RHIE6 RecName: Full=Phosphoglucosamine mutase
 gi|190698549|gb|ACE92634.1| phosphoglucosamine mutase protein [Rhizobium etli CIAT 652]
          Length = 450

 Score =  301 bits (770), Expect = 2e-79,   Method: Composition-based stats.
 Identities = 306/448 (68%), Positives = 367/448 (81%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           MKRR+FGTDGIRG+SN FP+TP+  MR+GIA G +FR      RVVIGKDTRLSGYMLEN
Sbjct: 1   MKRRYFGTDGIRGQSNVFPMTPDLAMRVGIAAGTIFRRGNHRHRVVIGKDTRLSGYMLEN 60

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           ++VAGFTAAG+DAFILGPIP+PAVAMLTRSLR D+GVMISASHNPY+DNGIKLFGPDGYK
Sbjct: 61  AMVAGFTAAGLDAFILGPIPTPAVAMLTRSLRCDIGVMISASHNPYEDNGIKLFGPDGYK 120

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +S DIE  IE LLE DL++ L+  D IG AKRVDGVHDRYIEH KRTLPRDVTLQGLRI 
Sbjct: 121 LSDDIEAEIEDLLEKDLSTQLAKSDDIGRAKRVDGVHDRYIEHAKRTLPRDVTLQGLRIA 180

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           +DCANGA+YKVAP V WELGADVV IG++PNG NINL+CGST+ ++LQ+KV EVRADIGI
Sbjct: 181 IDCANGAAYKVAPAVLWELGADVVTIGNEPNGTNINLNCGSTSPVALQKKVDEVRADIGI 240

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           ALDGD DRVIIVDE G+IV+GDQ+MA+IA  W     LRGNGIV TVMSN+GLERF+   
Sbjct: 241 ALDGDADRVIIVDENGSIVDGDQLMAVIAESWAESQQLRGNGIVATVMSNLGLERFLDER 300

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           G++L RT+VGDRY++E+M+ + +NVGGEQSGHI+LSDYG+TGDGLVAALQ+L  +K+  +
Sbjct: 301 GMALARTKVGDRYVVEHMRQHNYNVGGEQSGHIVLSDYGTTGDGLVAALQILAAVKRTGR 360

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
            VS +C  FE  PQ LR+V +     L    + +AIADAE+EL    RL++R SGTE LI
Sbjct: 361 TVSEVCRRFEPVPQLLRNVRISGGKPLEDIQVQKAIADAEAELAKTGRLVIRPSGTEPLI 420

Query: 421 RIMAEGDDLSRIKRIVDDLAKVIPMIDS 448
           R+MAEGDD ++I+RIV++L   I  + S
Sbjct: 421 RVMAEGDDRAQIERIVNELIGTISNVRS 448


>gi|327193461|gb|EGE60357.1| phosphoglucosamine mutase protein [Rhizobium etli CNPAF512]
          Length = 450

 Score =  300 bits (767), Expect = 3e-79,   Method: Composition-based stats.
 Identities = 307/448 (68%), Positives = 367/448 (81%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           MKRR+FGTDGIRG+SN FP+TP+  MR+GIA G +FR      RVVIGKDTRLSGYMLEN
Sbjct: 1   MKRRYFGTDGIRGQSNVFPMTPDLAMRVGIAAGTIFRRGNHRHRVVIGKDTRLSGYMLEN 60

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           ++VAGFTAAG+DAFILGPIP+PAVAMLTRSLR D+GVMISASHNPY+DNGIKLFGPDGYK
Sbjct: 61  AMVAGFTAAGLDAFILGPIPTPAVAMLTRSLRCDIGVMISASHNPYEDNGIKLFGPDGYK 120

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +S DIE  IE LLE DL++ L+  D IG AKRVDGVHDRYIEH KRTLPRDVTLQGLRI 
Sbjct: 121 LSDDIEAEIEDLLEKDLSTQLAKSDDIGRAKRVDGVHDRYIEHAKRTLPRDVTLQGLRIA 180

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           +DCANGA+YKVAP V WELGADVV IG++PNG NINL+CGST+ ++LQ+KV EVRADIGI
Sbjct: 181 IDCANGAAYKVAPAVLWELGADVVTIGNEPNGTNINLNCGSTSPVALQKKVDEVRADIGI 240

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           ALDGD DRVIIVDE G+IV+GDQ+MA+IA  W     LRGNGIV TVMSN+GLERF+   
Sbjct: 241 ALDGDADRVIIVDENGSIVDGDQLMAVIAESWAESQQLRGNGIVATVMSNLGLERFLDER 300

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           G++L RT+VGDRY++E+M+ + +NVGGEQSGHI+LSDYG+TGDGLVAALQ+L  +K+  +
Sbjct: 301 GMALARTKVGDRYVVEHMRQHNYNVGGEQSGHIVLSDYGTTGDGLVAALQILAAVKRTGR 360

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
            VS +C  FE  PQ LR+V +     L    + +AIADAE+EL    RL++R SGTE LI
Sbjct: 361 TVSEVCRRFEPVPQLLRNVRISGGKPLEDIQVQKAIADAEAELAKTGRLVIRPSGTEPLI 420

Query: 421 RIMAEGDDLSRIKRIVDDLAKVIPMIDS 448
           R+MAEGDD S+I+RIV++L   I  + S
Sbjct: 421 RVMAEGDDRSQIERIVNELIGTISNVRS 448


>gi|209550771|ref|YP_002282688.1| phosphoglucosamine mutase [Rhizobium leguminosarum bv. trifolii
           WSM2304]
 gi|226723909|sp|B5ZNL4|GLMM_RHILW RecName: Full=Phosphoglucosamine mutase
 gi|209536527|gb|ACI56462.1| phosphoglucosamine mutase [Rhizobium leguminosarum bv. trifolii
           WSM2304]
          Length = 450

 Score =  300 bits (767), Expect = 4e-79,   Method: Composition-based stats.
 Identities = 303/446 (67%), Positives = 364/446 (81%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           MKRR+FGTDGIRG+SN FP+TP+  MR+GIA G +FR      RVVIGKDTRLSGYMLEN
Sbjct: 1   MKRRYFGTDGIRGQSNVFPMTPDLAMRVGIAAGTIFRRGNHRHRVVIGKDTRLSGYMLEN 60

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           ++VAGFTAAG+DAFILGPIP+PAVAMLTRSLR D+GVMISASHNPY+DNGIKLFGPDGYK
Sbjct: 61  AMVAGFTAAGLDAFILGPIPTPAVAMLTRSLRCDIGVMISASHNPYEDNGIKLFGPDGYK 120

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +S D+E  IE LLE DL + L+  D IG AKRVDGVHDRYIEH KRTLPRDVTLQGLRI 
Sbjct: 121 LSDDLEAEIEDLLEKDLNAQLAKSDDIGRAKRVDGVHDRYIEHAKRTLPRDVTLQGLRIA 180

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           +DCANGA+YKVAP V WELGA+VV IG++PNG NINL+CGST+ ++LQ+KV EVRADIGI
Sbjct: 181 IDCANGAAYKVAPAVLWELGAEVVTIGNEPNGTNINLNCGSTSPVALQKKVDEVRADIGI 240

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           ALDGD DRVIIVDE G+IV+GDQ+MA+IA  W     LRGNGIV TVMSN+GLERF+   
Sbjct: 241 ALDGDADRVIIVDENGSIVDGDQLMAVIAESWAESQQLRGNGIVATVMSNLGLERFLDDR 300

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           G++L RT VGDRY++E+M+ + +NVGGEQSGHI+LSDYG+TGDGLVAALQ+L  +K+  +
Sbjct: 301 GMALARTRVGDRYVVEHMRQHNYNVGGEQSGHIVLSDYGTTGDGLVAALQILAAVKRTGR 360

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
            VS +C  FE  PQ LR+V +     L    + +AIADAE+EL    RL++R SGTE LI
Sbjct: 361 TVSEVCRRFEPVPQLLRNVRISGGKPLEDIQVQKAIADAEAELAKNGRLVIRPSGTEPLI 420

Query: 421 RIMAEGDDLSRIKRIVDDLAKVIPMI 446
           R+MAEGDD ++I+RIV++L   I  +
Sbjct: 421 RVMAEGDDRAQIERIVNELIGTISNV 446


>gi|86359048|ref|YP_470940.1| phosphosugar isomerase protein [Rhizobium etli CFN 42]
 gi|123510886|sp|Q2K4M3|GLMM_RHIEC RecName: Full=Phosphoglucosamine mutase
 gi|86283150|gb|ABC92213.1| probable phosphosugar isomerase protein [Rhizobium etli CFN 42]
          Length = 450

 Score =  299 bits (765), Expect = 7e-79,   Method: Composition-based stats.
 Identities = 303/446 (67%), Positives = 365/446 (81%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           MKRR+FGTDGIRG+SN FP+TP+  MR+GIA G +FR      RVVIGKDTRLSGYMLEN
Sbjct: 1   MKRRYFGTDGIRGQSNVFPMTPDLAMRVGIAAGTIFRRGNHRHRVVIGKDTRLSGYMLEN 60

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           ++VAGFTAAG+DAFILGPIP+PAVAMLTRSLR D+GVMISASHNPY+DNGIKLFGPDGYK
Sbjct: 61  AMVAGFTAAGLDAFILGPIPTPAVAMLTRSLRCDIGVMISASHNPYEDNGIKLFGPDGYK 120

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +S DIE  IE LLE DL + L+  D IG AKRVDGVHDRYIEH KRTLPRDVTLQGLR+ 
Sbjct: 121 LSDDIEAEIEDLLEKDLNAQLAKSDDIGRAKRVDGVHDRYIEHAKRTLPRDVTLQGLRVA 180

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           +DCANGA+YKVAP V WELGADVV IG++PNG NINL+CGST+ ++LQ+KV EVRADIGI
Sbjct: 181 IDCANGAAYKVAPAVLWELGADVVTIGNEPNGTNINLNCGSTSPVALQKKVDEVRADIGI 240

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           ALDGD DRVII+DE G+IV+GDQ+MA+IA  W     LRGNGIV TVMSN+GLERF+   
Sbjct: 241 ALDGDADRVIIIDENGSIVDGDQLMAVIAESWAESQQLRGNGIVATVMSNLGLERFLDER 300

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           G++L RT+VGDRY++E+M+ + +NVGGEQSGHI+LSDYG+TGDGLVAALQ+L  +K+  +
Sbjct: 301 GMALARTKVGDRYVVEHMRQHNYNVGGEQSGHIVLSDYGTTGDGLVAALQILAAVKRTGR 360

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
            VS +C  FE  PQ LR+V +     L    + +AIADAE+EL    RL++R SGTE LI
Sbjct: 361 TVSEVCRRFEPVPQLLRNVRISGGKPLEDIQVQKAIADAEAELARNGRLVIRPSGTEPLI 420

Query: 421 RIMAEGDDLSRIKRIVDDLAKVIPMI 446
           R+MAEGDD ++I+RIV++L   I  +
Sbjct: 421 RVMAEGDDRAQIERIVNELIGTISNV 446


>gi|150397820|ref|YP_001328287.1| phosphoglucosamine mutase [Sinorhizobium medicae WSM419]
 gi|166990427|sp|A6UCS2|GLMM_SINMW RecName: Full=Phosphoglucosamine mutase
 gi|150029335|gb|ABR61452.1| phosphoglucosamine mutase [Sinorhizobium medicae WSM419]
          Length = 451

 Score =  297 bits (760), Expect = 2e-78,   Method: Composition-based stats.
 Identities = 287/443 (64%), Positives = 357/443 (80%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           MKR++FGTDGIRG+SN FP+TP+  MR+GIAVG +FR      RVVIGKDTRLSGYMLEN
Sbjct: 1   MKRKYFGTDGIRGQSNIFPMTPDLAMRVGIAVGTIFRNGAHRHRVVIGKDTRLSGYMLEN 60

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           ++VAGFTAAG+D F+LGPIP+P VAMLTRSLRAD+GVMISASHN ++DNGIKLFGPDGYK
Sbjct: 61  AMVAGFTAAGLDVFLLGPIPTPGVAMLTRSLRADIGVMISASHNAFRDNGIKLFGPDGYK 120

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +S DIE++IE LL+ D+T  L+  + IG AKRVDG   RYIE  KRTLPRDVTL GLRI 
Sbjct: 121 LSDDIEEKIEELLDQDMTRQLAKPEDIGRAKRVDGDIYRYIEQAKRTLPRDVTLTGLRIA 180

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           +DCANGA+YKVAP   WELGA+VV IG +PNG+NINL+CGST+  +LQ+KVHEVRADIGI
Sbjct: 181 IDCANGAAYKVAPSALWELGAEVVPIGTEPNGVNINLECGSTHPAALQKKVHEVRADIGI 240

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           ALDGD DRV+I+DE+G +++GDQ+MA+IA  W +  +L+G GI  TVMSN+GLER++   
Sbjct: 241 ALDGDADRVLIIDEEGQVIDGDQLMAVIADSWAADGMLKGGGIAATVMSNLGLERYLQAR 300

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
            L L RT+VGDRY++E M+ +G NVGGEQSGHI+LSD+G+TGDGLVAALQ+L  +K+  K
Sbjct: 301 RLKLHRTKVGDRYVVEQMRQDGLNVGGEQSGHIVLSDFGTTGDGLVAALQILAVVKRQGK 360

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
            VS IC  FE  PQ L++V +     L  + + QAIADAE++L    RL++R SGTE LI
Sbjct: 361 TVSEICRRFEPVPQVLKNVRISAGKPLEDAGVKQAIADAEAQLAKNGRLLIRPSGTEPLI 420

Query: 421 RIMAEGDDLSRIKRIVDDLAKVI 443
           R+MAEGDD  +++RIVD+L  VI
Sbjct: 421 RVMAEGDDRGKVERIVDELVSVI 443


>gi|15966487|ref|NP_386840.1| putative phosphosugar isomerase protein [Sinorhizobium meliloti
           1021]
 gi|307300476|ref|ZP_07580256.1| phosphoglucosamine mutase [Sinorhizobium meliloti BL225C]
 gi|307318341|ref|ZP_07597776.1| phosphoglucosamine mutase [Sinorhizobium meliloti AK83]
 gi|81633969|sp|Q92M99|GLMM_RHIME RecName: Full=Phosphoglucosamine mutase
 gi|15075758|emb|CAC47313.1| Phosphoglucosamine mutase [Sinorhizobium meliloti 1021]
 gi|306896023|gb|EFN26774.1| phosphoglucosamine mutase [Sinorhizobium meliloti AK83]
 gi|306904642|gb|EFN35226.1| phosphoglucosamine mutase [Sinorhizobium meliloti BL225C]
          Length = 450

 Score =  297 bits (760), Expect = 2e-78,   Method: Composition-based stats.
 Identities = 290/443 (65%), Positives = 359/443 (81%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           MKRR+FGTDGIRG+SN FP+TP+  MR+GIAVG +FR      RVVIGKDTRLSGYMLEN
Sbjct: 1   MKRRYFGTDGIRGQSNIFPMTPDLAMRVGIAVGTIFRNGAHRHRVVIGKDTRLSGYMLEN 60

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           ++VAGFTAAG+D F+LGPIP+P VAMLTRSLRAD+GVMISASHN ++DNGIKLFGPDGYK
Sbjct: 61  AMVAGFTAAGLDVFLLGPIPTPGVAMLTRSLRADIGVMISASHNAFRDNGIKLFGPDGYK 120

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +S DIE +IE LLE D++  L+  + IG AKRVDG   RYIE  KRTLPRDVTL+GLRI 
Sbjct: 121 LSDDIEQKIEDLLEQDMSGQLAKPEDIGRAKRVDGDIYRYIEQAKRTLPRDVTLKGLRIA 180

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           +DCANGA+YKVAP   WELGA+VV IG +PNG+NINL+CGST+  +LQ+KVHEVRADIGI
Sbjct: 181 IDCANGAAYKVAPSALWELGAEVVTIGTEPNGVNINLECGSTHPAALQKKVHEVRADIGI 240

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           ALDGD DRV+IVDE+GA+++GDQ+MA+IA  W +  +L+G GI  TVMSN+GLER++   
Sbjct: 241 ALDGDADRVLIVDEEGAVIDGDQLMAVIADSWAADGMLKGGGIAATVMSNLGLERYLQAR 300

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
            L L RT+VGDRY++E M+ +G NVGGEQSGHI+LSD+G+TGDGLVAALQ+L  +K+  K
Sbjct: 301 RLKLHRTKVGDRYVVEQMRQDGLNVGGEQSGHIVLSDFGTTGDGLVAALQILAVVKRQGK 360

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
            VS IC  FE  PQ L++V V     L  +++ QAIA+AE++L    RL++R SGTE LI
Sbjct: 361 TVSEICRRFEPVPQVLKNVRVSAGKPLEDAAVQQAIAEAEAQLAKNGRLLIRPSGTEPLI 420

Query: 421 RIMAEGDDLSRIKRIVDDLAKVI 443
           R+MAEGDD  +++RIVD+L  VI
Sbjct: 421 RVMAEGDDRGQVERIVDELVNVI 443


>gi|241206179|ref|YP_002977275.1| phosphoglucosamine mutase [Rhizobium leguminosarum bv. trifolii
           WSM1325]
 gi|240860069|gb|ACS57736.1| phosphoglucosamine mutase [Rhizobium leguminosarum bv. trifolii
           WSM1325]
          Length = 450

 Score =  296 bits (758), Expect = 4e-78,   Method: Composition-based stats.
 Identities = 306/446 (68%), Positives = 365/446 (81%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           MKRR+FGTDGIRG+SN FP+TP+  MR+GIA G +FR      RVVIGKDTRLSGYMLEN
Sbjct: 1   MKRRYFGTDGIRGQSNVFPMTPDLAMRVGIAAGTIFRRGNHRHRVVIGKDTRLSGYMLEN 60

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           ++VAGFTAAG+DAFILGPIP+PAVAMLTRSLRAD+GVMISASHNPY+DNGIKLFGPDGYK
Sbjct: 61  AMVAGFTAAGLDAFILGPIPTPAVAMLTRSLRADLGVMISASHNPYEDNGIKLFGPDGYK 120

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +S DIE  IE LLE DL + L+  D IG AKRVDGVHDRYIEH KRTLPRDVTLQGLRI 
Sbjct: 121 LSDDIEAEIEDLLEKDLNAQLAKSDDIGRAKRVDGVHDRYIEHAKRTLPRDVTLQGLRIA 180

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           +DCANGA+YKVAP V WELGA+VV IG++PNG NINL+CGST+ ++LQ+KV EVRADIGI
Sbjct: 181 IDCANGAAYKVAPAVLWELGAEVVTIGNEPNGTNINLNCGSTSPVALQKKVDEVRADIGI 240

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           ALDGD DRVIIVDE G+IV+GDQ+MA+IA  W     LRGNGIV TVMSN+GLERF+   
Sbjct: 241 ALDGDADRVIIVDENGSIVDGDQLMAVIAESWAESQQLRGNGIVATVMSNLGLERFLDDK 300

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           GL L RT+VGDRY++E+M+ + +NVGGEQSGHI+LSDYG+TGDGLVAALQ+L  +K+  +
Sbjct: 301 GLGLARTKVGDRYVVEHMRQHNYNVGGEQSGHIVLSDYGTTGDGLVAALQILAAVKRTGR 360

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
            VS +C  FE  PQ LR+V +     L    + +AIADAE+EL    RL++R SGTE LI
Sbjct: 361 TVSEVCRRFEPVPQLLRNVRISGGKPLEDIQVQKAIADAEAELARNGRLVIRPSGTEPLI 420

Query: 421 RIMAEGDDLSRIKRIVDDLAKVIPMI 446
           R+MAEGDD ++I+RIV++L   I  +
Sbjct: 421 RVMAEGDDRAQIERIVNELIGTISNV 446


>gi|116253704|ref|YP_769542.1| phosphoglucosamine mutase [Rhizobium leguminosarum bv. viciae 3841]
 gi|158564209|sp|Q1MC77|GLMM_RHIL3 RecName: Full=Phosphoglucosamine mutase
 gi|115258352|emb|CAK09454.1| putative phosphoglucosamine mutase [Rhizobium leguminosarum bv.
           viciae 3841]
          Length = 450

 Score =  296 bits (756), Expect = 6e-78,   Method: Composition-based stats.
 Identities = 306/446 (68%), Positives = 365/446 (81%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           MKRR+FGTDGIRG+SN FP+TP+  MR+GIA G +FR      RVVIGKDTRLSGYMLEN
Sbjct: 1   MKRRYFGTDGIRGQSNVFPMTPDLAMRVGIAAGTIFRRGNHRHRVVIGKDTRLSGYMLEN 60

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           ++VAGFTAAG+DAFILGPIP+PAVAMLTRSLRAD+GVMISASHNPY+DNGIKLFGPDGYK
Sbjct: 61  AMVAGFTAAGLDAFILGPIPTPAVAMLTRSLRADLGVMISASHNPYEDNGIKLFGPDGYK 120

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +S DIE  IE LLE DL + L+  D IG AKRVDGVHDRYIEH KRTLPRDVTLQGLRI 
Sbjct: 121 LSDDIEAEIEDLLERDLNAQLAKSDDIGRAKRVDGVHDRYIEHAKRTLPRDVTLQGLRIA 180

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           +DCANGA+YKVAP V WELGA+VV IG++PNG NINL+CGST+ ++LQ+KV EVRADIGI
Sbjct: 181 IDCANGAAYKVAPAVLWELGAEVVTIGNEPNGTNINLNCGSTSPVALQKKVDEVRADIGI 240

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           ALDGD DRVIIVDE G+IV+GDQ+MA+IA  W     LRGNGIV TVMSN+GLERF+   
Sbjct: 241 ALDGDADRVIIVDENGSIVDGDQLMAVIAESWAESQQLRGNGIVATVMSNLGLERFLDDK 300

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           GL L RT+VGDRY++E+M+ + +NVGGEQSGHI+LSDYG+TGDGLVAALQ+L  +K+  +
Sbjct: 301 GLGLARTKVGDRYVVEHMRQHNYNVGGEQSGHIVLSDYGTTGDGLVAALQILAAVKRTGR 360

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
            VS +C  FE  PQ LR+V +     L    + +AIADAE+EL    RL++R SGTE LI
Sbjct: 361 TVSEVCRRFEPVPQLLRNVRISGGKPLEDIQVQKAIADAEAELARNGRLVIRPSGTEPLI 420

Query: 421 RIMAEGDDLSRIKRIVDDLAKVIPMI 446
           R+MAEGDD ++I+RIV++L   I  +
Sbjct: 421 RVMAEGDDRAQIERIVNELIGTISNV 446


>gi|227823303|ref|YP_002827275.1| phosphoglucosamine mutase [Sinorhizobium fredii NGR234]
 gi|227342304|gb|ACP26522.1| phosphoglucomutase/phosphomannomutase family protein MrsA
           [Sinorhizobium fredii NGR234]
          Length = 476

 Score =  295 bits (754), Expect = 1e-77,   Method: Composition-based stats.
 Identities = 287/443 (64%), Positives = 358/443 (80%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           MKR++FGTDGIRG+SN FP+T +  MR+G+AVG +FR      RVVIGKDTRLSGYMLEN
Sbjct: 27  MKRKYFGTDGIRGQSNIFPMTADLAMRVGVAVGTIFRNGAHRHRVVIGKDTRLSGYMLEN 86

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           ++VAGFTAAG+D F+LGPIP+P VAMLTRSLRAD+GVMISASHNP++DNGIKLFGPDGYK
Sbjct: 87  AMVAGFTAAGLDVFLLGPIPTPGVAMLTRSLRADIGVMISASHNPFRDNGIKLFGPDGYK 146

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +S DIE +IE L++ D++  L+  + IG AKRVDG   RYIE  KRTLPRDVTL+GLRI 
Sbjct: 147 LSDDIEQKIEELIDQDMSGQLAKPEDIGRAKRVDGDIYRYIEQAKRTLPRDVTLKGLRIA 206

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           +DCANGA+YKVAP   WELGA+VV IG +PNG+NINL+CGST+  +LQ+KVHEVRADIGI
Sbjct: 207 IDCANGAAYKVAPLALWELGAEVVSIGTEPNGVNINLECGSTHPEALQKKVHEVRADIGI 266

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           ALDGD DRV+IVDEKG +++GDQ+MA+IA  W +  +L+G GI  TVMSN+GLER++   
Sbjct: 267 ALDGDADRVLIVDEKGTVIDGDQLMAVIADSWAADGMLQGGGIAATVMSNLGLERYLQAR 326

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
            L L RT+VGDRY++E M+ +G NVGGEQSGHI+LSD+G+TGDGLVAALQ+L  +K+  +
Sbjct: 327 RLKLHRTKVGDRYVVEQMRQDGLNVGGEQSGHIVLSDFGTTGDGLVAALQILAVVKRQGR 386

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
            VS +C  FE  PQ L++V V     L   ++ QAIADAE+EL    RL++R SGTE LI
Sbjct: 387 AVSEVCRRFEPVPQVLKNVRVSAGKPLEHEAVRQAIADAEAELAKGGRLLIRPSGTEPLI 446

Query: 421 RIMAEGDDLSRIKRIVDDLAKVI 443
           R+MAEGDD S+++RIVD+L  VI
Sbjct: 447 RVMAEGDDRSKVERIVDELVTVI 469


>gi|158705924|sp|Q11DI7|GLMM_MESSB RecName: Full=Phosphoglucosamine mutase
          Length = 451

 Score =  292 bits (746), Expect = 9e-77,   Method: Composition-based stats.
 Identities = 274/441 (62%), Positives = 349/441 (79%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M +++FGTDGIRG++N FP+T    MR+G+A G  F+      RVV+GKDTRLSGYM+EN
Sbjct: 1   MSKQYFGTDGIRGRANRFPMTAEVAMRVGMAAGLSFQNGSHRHRVVLGKDTRLSGYMIEN 60

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           ++VAGF AAGMD F+LGPIP+PAVAML RSLRAD+GVMISASHNPY DNGIKLFGPDGYK
Sbjct: 61  AMVAGFCAAGMDVFLLGPIPTPAVAMLVRSLRADIGVMISASHNPYHDNGIKLFGPDGYK 120

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +S +IE+RIE +L+ D+   L+  +S+G AKRVDGVHDRYIE  KRTLPRD++L GLR+V
Sbjct: 121 LSDEIENRIEAMLDRDVELALADSESLGRAKRVDGVHDRYIEFAKRTLPRDMSLSGLRVV 180

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           +DCANGA+YKVAP   WELGA+VV I   PNG N+N +CGST+ +SL +KVHEVRADIGI
Sbjct: 181 IDCANGAAYKVAPAALWELGAEVVPIYVDPNGFNVNEECGSTHPMSLAKKVHEVRADIGI 240

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           ALDGD DRV+IVDE G I++GDQIMALIA  W  +  L G GIV TVMSN+GLERF+ G 
Sbjct: 241 ALDGDADRVVIVDENGTIIDGDQIMALIAESWHENEKLIGGGIVATVMSNLGLERFLRGR 300

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           GL L RT+VGDRY++E+M+ +G N+GGEQSGH++LSD+ ++GDGLV ALQVL +IK+ +K
Sbjct: 301 GLELHRTKVGDRYVVEHMREHGLNIGGEQSGHVVLSDFSTSGDGLVTALQVLAHIKRLNK 360

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
           P S +C  FE  PQ L++V +     L ++S+  AIADA+++L    RL++R SGTE LI
Sbjct: 361 PASEVCRKFEPVPQVLKNVRISGGKPLEAASVKAAIADAQAQLGDTGRLVIRPSGTEPLI 420

Query: 421 RIMAEGDDLSRIKRIVDDLAK 441
           R+MAEGDD   ++++VD +  
Sbjct: 421 RVMAEGDDPELVRKMVDSIVD 441


>gi|110635495|ref|YP_675703.1| phosphoglucosamine mutase [Mesorhizobium sp. BNC1]
 gi|110286479|gb|ABG64538.1| phosphoglucosamine mutase [Chelativorans sp. BNC1]
          Length = 465

 Score =  292 bits (746), Expect = 9e-77,   Method: Composition-based stats.
 Identities = 274/441 (62%), Positives = 349/441 (79%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M +++FGTDGIRG++N FP+T    MR+G+A G  F+      RVV+GKDTRLSGYM+EN
Sbjct: 15  MSKQYFGTDGIRGRANRFPMTAEVAMRVGMAAGLSFQNGSHRHRVVLGKDTRLSGYMIEN 74

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           ++VAGF AAGMD F+LGPIP+PAVAML RSLRAD+GVMISASHNPY DNGIKLFGPDGYK
Sbjct: 75  AMVAGFCAAGMDVFLLGPIPTPAVAMLVRSLRADIGVMISASHNPYHDNGIKLFGPDGYK 134

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +S +IE+RIE +L+ D+   L+  +S+G AKRVDGVHDRYIE  KRTLPRD++L GLR+V
Sbjct: 135 LSDEIENRIEAMLDRDVELALADSESLGRAKRVDGVHDRYIEFAKRTLPRDMSLSGLRVV 194

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           +DCANGA+YKVAP   WELGA+VV I   PNG N+N +CGST+ +SL +KVHEVRADIGI
Sbjct: 195 IDCANGAAYKVAPAALWELGAEVVPIYVDPNGFNVNEECGSTHPMSLAKKVHEVRADIGI 254

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           ALDGD DRV+IVDE G I++GDQIMALIA  W  +  L G GIV TVMSN+GLERF+ G 
Sbjct: 255 ALDGDADRVVIVDENGTIIDGDQIMALIAESWHENEKLIGGGIVATVMSNLGLERFLRGR 314

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           GL L RT+VGDRY++E+M+ +G N+GGEQSGH++LSD+ ++GDGLV ALQVL +IK+ +K
Sbjct: 315 GLELHRTKVGDRYVVEHMREHGLNIGGEQSGHVVLSDFSTSGDGLVTALQVLAHIKRLNK 374

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
           P S +C  FE  PQ L++V +     L ++S+  AIADA+++L    RL++R SGTE LI
Sbjct: 375 PASEVCRKFEPVPQVLKNVRISGGKPLEAASVKAAIADAQAQLGDTGRLVIRPSGTEPLI 434

Query: 421 RIMAEGDDLSRIKRIVDDLAK 441
           R+MAEGDD   ++++VD +  
Sbjct: 435 RVMAEGDDPELVRKMVDSIVD 455


>gi|222086968|ref|YP_002545502.1| phosphoglucosamine mutase [Agrobacterium radiobacter K84]
 gi|254798007|sp|B9J9H0|GLMM_AGRRK RecName: Full=Phosphoglucosamine mutase
 gi|221724416|gb|ACM27572.1| phosphoglucosamine mutase [Agrobacterium radiobacter K84]
          Length = 450

 Score =  291 bits (744), Expect = 1e-76,   Method: Composition-based stats.
 Identities = 303/448 (67%), Positives = 369/448 (82%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           MKRR+FGTDGIRG+SN +P+TP+  MR+GIA G +F       RVVIGKDTRLSGYMLEN
Sbjct: 1   MKRRYFGTDGIRGQSNIYPMTPDLAMRVGIAAGTIFHRGSHRHRVVIGKDTRLSGYMLEN 60

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           ++VAGFTAAG+DAF+LGPIP+PAVAMLTRSLRAD+GVMISASHNPY+DNGIKLFGPDGYK
Sbjct: 61  AMVAGFTAAGVDAFVLGPIPTPAVAMLTRSLRADIGVMISASHNPYEDNGIKLFGPDGYK 120

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +S D+E +IE LLE D+T++L+  ++IG AKRVDGVHDRYIEH KRTLPRDVTLQGLRI 
Sbjct: 121 LSDDLEMKIEDLLEKDMTAHLAKSENIGRAKRVDGVHDRYIEHAKRTLPRDVTLQGLRIA 180

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           +DCANGA+YKVAP V WELGA+VV IG++PNG NINL+CGST+ ++LQ+KV EVRADIGI
Sbjct: 181 IDCANGAAYKVAPAVLWELGAEVVTIGNEPNGTNINLNCGSTSPVALQKKVDEVRADIGI 240

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           ALDGD DRVIIVDE G I++GDQ+MA+IA  W  +  LRGNGIV TVMSN+GLERF+   
Sbjct: 241 ALDGDADRVIIVDETGTIIDGDQLMAVIAESWAENQSLRGNGIVATVMSNLGLERFLEDR 300

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           G++L RT VGDR+++E+M+ + FNVGGEQSGHI+LSDYG+TGDGLVAALQ+L  +K+  K
Sbjct: 301 GMALARTAVGDRHVVEHMRQHNFNVGGEQSGHIVLSDYGTTGDGLVAALQILAVVKRTGK 360

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
           PVS +C  FE  PQ LR+V +     L  + + +AIADAESEL    RL++R SGTE LI
Sbjct: 361 PVSEVCRRFEPVPQLLRNVRISGGKPLEDNQVRKAIADAESELARNGRLVIRPSGTEPLI 420

Query: 421 RIMAEGDDLSRIKRIVDDLAKVIPMIDS 448
           R+MAEGDD  +I+RIV  L  VI  + +
Sbjct: 421 RVMAEGDDRGQIERIVGGLIDVISSVRN 448


>gi|172044121|sp|A6WY87|GLMM_OCHA4 RecName: Full=Phosphoglucosamine mutase
          Length = 451

 Score =  291 bits (743), Expect = 2e-76,   Method: Composition-based stats.
 Identities = 272/444 (61%), Positives = 349/444 (78%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M R++FGTDGIRG++N+FP+TP   M++G+AVG++FR K +  RVVIGKDTR SGYMLEN
Sbjct: 1   MTRKYFGTDGIRGQANSFPMTPEVAMKVGMAVGHIFRRKGQTSRVVIGKDTRRSGYMLEN 60

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +LVAGFTAAGMD F+LGPIP+PAVAML RSLRAD+GVMISASHNP+ DNGIKLFGPDG+K
Sbjct: 61  ALVAGFTAAGMDVFLLGPIPTPAVAMLCRSLRADIGVMISASHNPFYDNGIKLFGPDGFK 120

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +S +IE +IE +++ DLT YL+ +  +G AKRVDG   RYIE  KRTLPR++ L GLRIV
Sbjct: 121 LSDEIELKIEAMIDGDLTPYLASHGDVGRAKRVDGDIYRYIEFAKRTLPRNIDLNGLRIV 180

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           VDCANGA YKVAP   WELGA+V+ I ++PNGININ DCGST+ + L +KVHEVRAD+GI
Sbjct: 181 VDCANGAGYKVAPAALWELGAEVITINNEPNGININEDCGSTHPIGLMKKVHEVRADVGI 240

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           ALDGD DRV++VDE G +++GDQ+MA+IA  W +   L G GIV TVMSN+GLERF+A  
Sbjct: 241 ALDGDADRVLLVDENGTVIDGDQLMAVIAESWAASDRLEGGGIVATVMSNLGLERFLADR 300

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
            L+L RT+VGDRY++E+M+ +GFNVGGEQSGHI+LSDY +TGDGL++ALQ+L   ++  K
Sbjct: 301 HLTLARTKVGDRYVVEHMREHGFNVGGEQSGHIVLSDYATTGDGLISALQILAVAQEQGK 360

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
           P+S IC  F+  PQ L++V       L +  +  AI +A   L    RL++R SGTE LI
Sbjct: 361 PISEICRKFDPVPQLLKNVRTSGGKPLENKRVKSAIDEATERLGVQGRLVIRPSGTEPLI 420

Query: 421 RIMAEGDDLSRIKRIVDDLAKVIP 444
           R+MAEGDD   ++++V+D+  VI 
Sbjct: 421 RVMAEGDDRGLVEKVVNDIIDVIS 444


>gi|153008555|ref|YP_001369770.1| phosphoglucosamine mutase [Ochrobactrum anthropi ATCC 49188]
 gi|151560443|gb|ABS13941.1| phosphoglucosamine mutase [Ochrobactrum anthropi ATCC 49188]
          Length = 459

 Score =  291 bits (743), Expect = 2e-76,   Method: Composition-based stats.
 Identities = 272/444 (61%), Positives = 349/444 (78%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M R++FGTDGIRG++N+FP+TP   M++G+AVG++FR K +  RVVIGKDTR SGYMLEN
Sbjct: 9   MTRKYFGTDGIRGQANSFPMTPEVAMKVGMAVGHIFRRKGQTSRVVIGKDTRRSGYMLEN 68

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +LVAGFTAAGMD F+LGPIP+PAVAML RSLRAD+GVMISASHNP+ DNGIKLFGPDG+K
Sbjct: 69  ALVAGFTAAGMDVFLLGPIPTPAVAMLCRSLRADIGVMISASHNPFYDNGIKLFGPDGFK 128

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +S +IE +IE +++ DLT YL+ +  +G AKRVDG   RYIE  KRTLPR++ L GLRIV
Sbjct: 129 LSDEIELKIEAMIDGDLTPYLASHGDVGRAKRVDGDIYRYIEFAKRTLPRNIDLNGLRIV 188

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           VDCANGA YKVAP   WELGA+V+ I ++PNGININ DCGST+ + L +KVHEVRAD+GI
Sbjct: 189 VDCANGAGYKVAPAALWELGAEVITINNEPNGININEDCGSTHPIGLMKKVHEVRADVGI 248

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           ALDGD DRV++VDE G +++GDQ+MA+IA  W +   L G GIV TVMSN+GLERF+A  
Sbjct: 249 ALDGDADRVLLVDENGTVIDGDQLMAVIAESWAASDRLEGGGIVATVMSNLGLERFLADR 308

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
            L+L RT+VGDRY++E+M+ +GFNVGGEQSGHI+LSDY +TGDGL++ALQ+L   ++  K
Sbjct: 309 HLTLARTKVGDRYVVEHMREHGFNVGGEQSGHIVLSDYATTGDGLISALQILAVAQEQGK 368

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
           P+S IC  F+  PQ L++V       L +  +  AI +A   L    RL++R SGTE LI
Sbjct: 369 PISEICRKFDPVPQLLKNVRTSGGKPLENKRVKSAIDEATERLGVQGRLVIRPSGTEPLI 428

Query: 421 RIMAEGDDLSRIKRIVDDLAKVIP 444
           R+MAEGDD   ++++V+D+  VI 
Sbjct: 429 RVMAEGDDRGLVEKVVNDIIDVIS 452


>gi|261219280|ref|ZP_05933561.1| phosphoglucosamine mutase [Brucella ceti M13/05/1]
 gi|261315942|ref|ZP_05955139.1| phosphoglucosamine mutase [Brucella pinnipedialis M163/99/10]
 gi|261316196|ref|ZP_05955393.1| phosphoglucosamine mutase [Brucella pinnipedialis B2/94]
 gi|261322341|ref|ZP_05961538.1| phosphoglucosamine mutase [Brucella ceti M644/93/1]
 gi|261757344|ref|ZP_06001053.1| phosphoglucosamine mutase [Brucella sp. F5/99]
 gi|265987259|ref|ZP_06099816.1| phosphoglucosamine mutase [Brucella pinnipedialis M292/94/1]
 gi|260924369|gb|EEX90937.1| phosphoglucosamine mutase [Brucella ceti M13/05/1]
 gi|261295031|gb|EEX98527.1| phosphoglucosamine mutase [Brucella ceti M644/93/1]
 gi|261295419|gb|EEX98915.1| phosphoglucosamine mutase [Brucella pinnipedialis B2/94]
 gi|261304968|gb|EEY08465.1| phosphoglucosamine mutase [Brucella pinnipedialis M163/99/10]
 gi|261737328|gb|EEY25324.1| phosphoglucosamine mutase [Brucella sp. F5/99]
 gi|264659456|gb|EEZ29717.1| phosphoglucosamine mutase [Brucella pinnipedialis M292/94/1]
          Length = 451

 Score =  290 bits (742), Expect = 3e-76,   Method: Composition-based stats.
 Identities = 271/444 (61%), Positives = 353/444 (79%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M R+FFGTDGIRG++N+FP+TP   M++G+AVGY+FR K +  RVVIGKDTR SGYMLEN
Sbjct: 1   MTRKFFGTDGIRGQANSFPMTPEIAMKVGMAVGYIFRRKGQASRVVIGKDTRRSGYMLEN 60

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +LVAGFTAAGMD F+LGPIP+PAVAML RSLRAD+GVMISASHNP+ DNGIKLFGPDG+K
Sbjct: 61  ALVAGFTAAGMDVFLLGPIPTPAVAMLCRSLRADIGVMISASHNPFYDNGIKLFGPDGFK 120

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +S  IE +IE ++E D+T +L+ +  +G AKRVDG   RYIE  KRTLPR+++L GLR+V
Sbjct: 121 LSDQIELQIEAMIEGDMTPFLASHGDVGRAKRVDGDIYRYIEFAKRTLPRNISLNGLRVV 180

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           VDCANGA YKVAP   WELGA+V+ I ++PNGININ DCGST+ + L +KVHEVRAD+GI
Sbjct: 181 VDCANGAVYKVAPAALWELGAEVITINNEPNGININEDCGSTHPIGLMKKVHEVRADVGI 240

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           ALDGD DRV++VDE G +++GDQ+MA+IA  W + + L G GIV TVMSN+GLERF+A  
Sbjct: 241 ALDGDADRVLLVDENGTVIDGDQLMAVIAESWAASNRLEGGGIVATVMSNLGLERFLADR 300

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
            L+L RT+VGDRY++E+M+ +GFNVGGEQSGHI+LSD+ +TGDGL++ALQ+L   ++ +K
Sbjct: 301 NLTLARTKVGDRYVVEHMREHGFNVGGEQSGHIVLSDFATTGDGLISALQILAVAQEQNK 360

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
           P+S +C  F+  PQ L++V       L +  +  AI +A+  L G  RL++R SGTE LI
Sbjct: 361 PISDVCRKFQPVPQLLKNVRTTGGKPLENKRVKSAIDEAKERLGGQGRLVIRPSGTEPLI 420

Query: 421 RIMAEGDDLSRIKRIVDDLAKVIP 444
           R+MAEGDD   ++++V+D+  VI 
Sbjct: 421 RVMAEGDDRGLVEKVVNDIIDVIS 444


>gi|254708442|ref|ZP_05170270.1| phosphoglucosamine mutase [Brucella pinnipedialis M163/99/10]
 gi|254708705|ref|ZP_05170516.1| phosphoglucosamine mutase [Brucella pinnipedialis B2/94]
 gi|254714552|ref|ZP_05176363.1| phosphoglucosamine mutase [Brucella ceti M644/93/1]
 gi|254717449|ref|ZP_05179260.1| phosphoglucosamine mutase [Brucella ceti M13/05/1]
 gi|256030231|ref|ZP_05443845.1| phosphoglucosamine mutase [Brucella pinnipedialis M292/94/1]
 gi|260167906|ref|ZP_05754717.1| phosphoglucosamine mutase [Brucella sp. F5/99]
          Length = 459

 Score =  290 bits (742), Expect = 3e-76,   Method: Composition-based stats.
 Identities = 271/444 (61%), Positives = 353/444 (79%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M R+FFGTDGIRG++N+FP+TP   M++G+AVGY+FR K +  RVVIGKDTR SGYMLEN
Sbjct: 9   MTRKFFGTDGIRGQANSFPMTPEIAMKVGMAVGYIFRRKGQASRVVIGKDTRRSGYMLEN 68

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +LVAGFTAAGMD F+LGPIP+PAVAML RSLRAD+GVMISASHNP+ DNGIKLFGPDG+K
Sbjct: 69  ALVAGFTAAGMDVFLLGPIPTPAVAMLCRSLRADIGVMISASHNPFYDNGIKLFGPDGFK 128

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +S  IE +IE ++E D+T +L+ +  +G AKRVDG   RYIE  KRTLPR+++L GLR+V
Sbjct: 129 LSDQIELQIEAMIEGDMTPFLASHGDVGRAKRVDGDIYRYIEFAKRTLPRNISLNGLRVV 188

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           VDCANGA YKVAP   WELGA+V+ I ++PNGININ DCGST+ + L +KVHEVRAD+GI
Sbjct: 189 VDCANGAVYKVAPAALWELGAEVITINNEPNGININEDCGSTHPIGLMKKVHEVRADVGI 248

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           ALDGD DRV++VDE G +++GDQ+MA+IA  W + + L G GIV TVMSN+GLERF+A  
Sbjct: 249 ALDGDADRVLLVDENGTVIDGDQLMAVIAESWAASNRLEGGGIVATVMSNLGLERFLADR 308

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
            L+L RT+VGDRY++E+M+ +GFNVGGEQSGHI+LSD+ +TGDGL++ALQ+L   ++ +K
Sbjct: 309 NLTLARTKVGDRYVVEHMREHGFNVGGEQSGHIVLSDFATTGDGLISALQILAVAQEQNK 368

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
           P+S +C  F+  PQ L++V       L +  +  AI +A+  L G  RL++R SGTE LI
Sbjct: 369 PISDVCRKFQPVPQLLKNVRTTGGKPLENKRVKSAIDEAKERLGGQGRLVIRPSGTEPLI 428

Query: 421 RIMAEGDDLSRIKRIVDDLAKVIP 444
           R+MAEGDD   ++++V+D+  VI 
Sbjct: 429 RVMAEGDDRGLVEKVVNDIIDVIS 452


>gi|225628259|ref|ZP_03786293.1| phosphoglucosamine mutase [Brucella ceti str. Cudo]
 gi|225616105|gb|EEH13153.1| phosphoglucosamine mutase [Brucella ceti str. Cudo]
          Length = 475

 Score =  290 bits (742), Expect = 3e-76,   Method: Composition-based stats.
 Identities = 271/444 (61%), Positives = 353/444 (79%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M R+FFGTDGIRG++N+FP+TP   M++G+AVGY+FR K +  RVVIGKDTR SGYMLEN
Sbjct: 25  MTRKFFGTDGIRGQANSFPMTPEIAMKVGMAVGYIFRRKGQASRVVIGKDTRRSGYMLEN 84

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +LVAGFTAAGMD F+LGPIP+PAVAML RSLRAD+GVMISASHNP+ DNGIKLFGPDG+K
Sbjct: 85  ALVAGFTAAGMDVFLLGPIPTPAVAMLCRSLRADIGVMISASHNPFYDNGIKLFGPDGFK 144

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +S  IE +IE ++E D+T +L+ +  +G AKRVDG   RYIE  KRTLPR+++L GLR+V
Sbjct: 145 LSDQIELQIEAMIEGDMTPFLASHGDVGRAKRVDGDIYRYIEFAKRTLPRNISLNGLRVV 204

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           VDCANGA YKVAP   WELGA+V+ I ++PNGININ DCGST+ + L +KVHEVRAD+GI
Sbjct: 205 VDCANGAVYKVAPAALWELGAEVITINNEPNGININEDCGSTHPIGLMKKVHEVRADVGI 264

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           ALDGD DRV++VDE G +++GDQ+MA+IA  W + + L G GIV TVMSN+GLERF+A  
Sbjct: 265 ALDGDADRVLLVDENGTVIDGDQLMAVIAESWAASNRLEGGGIVATVMSNLGLERFLADR 324

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
            L+L RT+VGDRY++E+M+ +GFNVGGEQSGHI+LSD+ +TGDGL++ALQ+L   ++ +K
Sbjct: 325 NLTLARTKVGDRYVVEHMREHGFNVGGEQSGHIVLSDFATTGDGLISALQILAVAQEQNK 384

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
           P+S +C  F+  PQ L++V       L +  +  AI +A+  L G  RL++R SGTE LI
Sbjct: 385 PISDVCRKFQPVPQLLKNVRTTGGKPLENKRVKSAIDEAKERLGGQGRLVIRPSGTEPLI 444

Query: 421 RIMAEGDDLSRIKRIVDDLAKVIP 444
           R+MAEGDD   ++++V+D+  VI 
Sbjct: 445 RVMAEGDDRGLVEKVVNDIIDVIS 468


>gi|161619620|ref|YP_001593507.1| phosphoglucosamine mutase [Brucella canis ATCC 23365]
 gi|163845270|ref|YP_001622925.1| phosphoglucosamine mutase [Brucella suis ATCC 23445]
 gi|254703469|ref|ZP_05165297.1| phosphoglucosamine mutase [Brucella suis bv. 3 str. 686]
 gi|254719693|ref|ZP_05181504.1| phosphoglucosamine mutase [Brucella sp. 83/13]
 gi|256061728|ref|ZP_05451865.1| phosphoglucosamine mutase [Brucella neotomae 5K33]
 gi|306837848|ref|ZP_07470710.1| phosphoglucosamine mutase [Brucella sp. NF 2653]
 gi|161336431|gb|ABX62736.1| phosphoglucosamine mutase [Brucella canis ATCC 23365]
 gi|163675993|gb|ABY40103.1| phosphoglucosamine mutase [Brucella suis ATCC 23445]
 gi|306407087|gb|EFM63304.1| phosphoglucosamine mutase [Brucella sp. NF 2653]
          Length = 459

 Score =  290 bits (742), Expect = 3e-76,   Method: Composition-based stats.
 Identities = 271/444 (61%), Positives = 353/444 (79%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M R+FFGTDGIRG++N+FP+TP   M++G+AVGY+FR K +  RVVIGKDTR SGYMLEN
Sbjct: 9   MTRKFFGTDGIRGQANSFPMTPEIAMKVGMAVGYIFRRKGQASRVVIGKDTRRSGYMLEN 68

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +LVAGFTAAGMD F+LGPIP+PAVAML RSLRAD+GVMISASHNP+ DNGIKLFGPDG+K
Sbjct: 69  ALVAGFTAAGMDVFLLGPIPTPAVAMLCRSLRADIGVMISASHNPFYDNGIKLFGPDGFK 128

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +S  IE +IE ++E D+T +L+ +  +G AKRVDG   RYIE  KRTLPR+++L GLR+V
Sbjct: 129 LSDQIELQIEAMIEGDMTPFLASHGDVGRAKRVDGDIYRYIEFAKRTLPRNISLNGLRVV 188

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           VDCANGA YKVAP   WELGA+V+ I ++PNGININ DCGST+ + L +KVHEVRAD+GI
Sbjct: 189 VDCANGAGYKVAPAALWELGAEVITINNEPNGININEDCGSTHPIGLMKKVHEVRADVGI 248

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           ALDGD DRV++VDE G +++GDQ+MA+IA  W + + L G GIV TVMSN+GLERF+A  
Sbjct: 249 ALDGDADRVLLVDENGTVIDGDQLMAVIAESWAASNRLEGGGIVATVMSNLGLERFLADR 308

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
            L+L RT+VGDRY++E+M+ +GFNVGGEQSGHI+LSD+ +TGDGL++ALQ+L   ++ +K
Sbjct: 309 NLTLARTKVGDRYVVEHMREHGFNVGGEQSGHIVLSDFATTGDGLISALQILAVAQEQNK 368

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
           P+S +C  F+  PQ L++V       L +  +  AI +A+  L G  RL++R SGTE LI
Sbjct: 369 PISDVCRKFQPVPQLLKNVRTTGGKPLENKRVKSAIDEAKERLGGQGRLVIRPSGTEPLI 428

Query: 421 RIMAEGDDLSRIKRIVDDLAKVIP 444
           R+MAEGDD   ++++V+D+  VI 
Sbjct: 429 RVMAEGDDRGLVEKVVNDIIDVIS 452


>gi|23502548|ref|NP_698675.1| phosphoglucosamine mutase [Brucella suis 1330]
 gi|148559167|ref|YP_001259544.1| phosphoglucosamine mutase [Brucella ovis ATCC 25840]
 gi|256370099|ref|YP_003107610.1| phosphoglucosamine mutase [Brucella microti CCM 4915]
 gi|260568777|ref|ZP_05839245.1| phosphoglucosamine mutase [Brucella suis bv. 4 str. 40]
 gi|261325732|ref|ZP_05964929.1| phosphoglucosamine mutase [Brucella neotomae 5K33]
 gi|261754099|ref|ZP_05997808.1| phosphoglucosamine mutase [Brucella suis bv. 3 str. 686]
 gi|265984708|ref|ZP_06097443.1| phosphoglucosamine mutase [Brucella sp. 83/13]
 gi|81752147|sp|Q8FZ13|GLMM_BRUSU RecName: Full=Phosphoglucosamine mutase
 gi|158705795|sp|A5VS47|GLMM_BRUO2 RecName: Full=Phosphoglucosamine mutase
 gi|205830880|sp|A9WWG7|GLMM_BRUSI RecName: Full=Phosphoglucosamine mutase
 gi|205830881|sp|A9M7I9|GLMM_BRUC2 RecName: Full=Phosphoglucosamine mutase
 gi|23348548|gb|AAN30590.1| phosphoglucosamine mutase [Brucella suis 1330]
 gi|148370424|gb|ABQ60403.1| phosphoglucosamine mutase [Brucella ovis ATCC 25840]
 gi|256000262|gb|ACU48661.1| phosphoglucosamine mutase [Brucella microti CCM 4915]
 gi|260154161|gb|EEW89243.1| phosphoglucosamine mutase [Brucella suis bv. 4 str. 40]
 gi|261301712|gb|EEY05209.1| phosphoglucosamine mutase [Brucella neotomae 5K33]
 gi|261743852|gb|EEY31778.1| phosphoglucosamine mutase [Brucella suis bv. 3 str. 686]
 gi|264663300|gb|EEZ33561.1| phosphoglucosamine mutase [Brucella sp. 83/13]
          Length = 451

 Score =  290 bits (742), Expect = 3e-76,   Method: Composition-based stats.
 Identities = 271/444 (61%), Positives = 353/444 (79%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M R+FFGTDGIRG++N+FP+TP   M++G+AVGY+FR K +  RVVIGKDTR SGYMLEN
Sbjct: 1   MTRKFFGTDGIRGQANSFPMTPEIAMKVGMAVGYIFRRKGQASRVVIGKDTRRSGYMLEN 60

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +LVAGFTAAGMD F+LGPIP+PAVAML RSLRAD+GVMISASHNP+ DNGIKLFGPDG+K
Sbjct: 61  ALVAGFTAAGMDVFLLGPIPTPAVAMLCRSLRADIGVMISASHNPFYDNGIKLFGPDGFK 120

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +S  IE +IE ++E D+T +L+ +  +G AKRVDG   RYIE  KRTLPR+++L GLR+V
Sbjct: 121 LSDQIELQIEAMIEGDMTPFLASHGDVGRAKRVDGDIYRYIEFAKRTLPRNISLNGLRVV 180

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           VDCANGA YKVAP   WELGA+V+ I ++PNGININ DCGST+ + L +KVHEVRAD+GI
Sbjct: 181 VDCANGAGYKVAPAALWELGAEVITINNEPNGININEDCGSTHPIGLMKKVHEVRADVGI 240

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           ALDGD DRV++VDE G +++GDQ+MA+IA  W + + L G GIV TVMSN+GLERF+A  
Sbjct: 241 ALDGDADRVLLVDENGTVIDGDQLMAVIAESWAASNRLEGGGIVATVMSNLGLERFLADR 300

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
            L+L RT+VGDRY++E+M+ +GFNVGGEQSGHI+LSD+ +TGDGL++ALQ+L   ++ +K
Sbjct: 301 NLTLARTKVGDRYVVEHMREHGFNVGGEQSGHIVLSDFATTGDGLISALQILAVAQEQNK 360

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
           P+S +C  F+  PQ L++V       L +  +  AI +A+  L G  RL++R SGTE LI
Sbjct: 361 PISDVCRKFQPVPQLLKNVRTTGGKPLENKRVKSAIDEAKERLGGQGRLVIRPSGTEPLI 420

Query: 421 RIMAEGDDLSRIKRIVDDLAKVIP 444
           R+MAEGDD   ++++V+D+  VI 
Sbjct: 421 RVMAEGDDRGLVEKVVNDIIDVIS 444


>gi|260467073|ref|ZP_05813253.1| phosphoglucosamine mutase [Mesorhizobium opportunistum WSM2075]
 gi|259029182|gb|EEW30478.1| phosphoglucosamine mutase [Mesorhizobium opportunistum WSM2075]
          Length = 450

 Score =  290 bits (742), Expect = 3e-76,   Method: Composition-based stats.
 Identities = 277/445 (62%), Positives = 343/445 (77%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M   +FGTDGIRG++N FP+T    MR+G+A G  F+      RVV+GKDTRLSGYM+EN
Sbjct: 1   MAENYFGTDGIRGRANKFPMTAEIAMRVGMAAGLSFQRGNHRHRVVLGKDTRLSGYMIEN 60

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           ++VAG  AAGMD F+LGPIP+PAVAML RSLRAD+GVMISASHNPY DNGIKLFGPDGYK
Sbjct: 61  AMVAGLCAAGMDVFLLGPIPTPAVAMLVRSLRADIGVMISASHNPYYDNGIKLFGPDGYK 120

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +S +IE+RIE++L+ D+   L+  D +G AKRVDGVHDRYIE  KRTLPR ++L GLRIV
Sbjct: 121 LSDEIEERIESMLDKDIELALADSDGLGRAKRVDGVHDRYIEFAKRTLPRSMSLSGLRIV 180

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           VDCANGA+YKVAPE  WELGA+VV I  +PNG NIN +CGST+ + LQ+KVHEVRADIGI
Sbjct: 181 VDCANGAAYKVAPEALWELGAEVVAINVEPNGFNINKECGSTHPVGLQKKVHEVRADIGI 240

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           ALDGD DRV+IVDE GAIV+GDQIMALIA  W     L G G+V+TVMSN+GLERF+  +
Sbjct: 241 ALDGDADRVVIVDENGAIVDGDQIMALIAESWHQSGRLAGGGVVSTVMSNLGLERFLGDM 300

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
            L L RT+VGDRY++E+M+ +G NVGGEQSGHI+LSD+ +TGDGLV+ALQVL  IK+  +
Sbjct: 301 KLQLHRTKVGDRYVVEHMRAHGLNVGGEQSGHIVLSDFSTTGDGLVSALQVLACIKRQGR 360

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
           PVS +   FE  PQ L++V +     L  + +  AI DA   L    RL++R SGTE LI
Sbjct: 361 PVSELSKKFEPVPQLLKNVRIAGGKPLEEAPVKAAIEDARHRLGKAGRLVIRPSGTEPLI 420

Query: 421 RIMAEGDDLSRIKRIVDDLAKVIPM 445
           R+MAEGDD   ++ +V+D+ +VI  
Sbjct: 421 RVMAEGDDPQLVEAVVNDIVEVISE 445


>gi|319899360|ref|YP_004159457.1| phosphoglucomutase/phosphomannomutasefamily protein MrsA
           [Bartonella clarridgeiae 73]
 gi|319403328|emb|CBI76887.1| phosphoglucomutase/phosphomannomutasefamily protein MrsA
           [Bartonella clarridgeiae 73]
          Length = 455

 Score =  290 bits (741), Expect = 4e-76,   Method: Composition-based stats.
 Identities = 275/448 (61%), Positives = 350/448 (78%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M R++FGTDGIRG++N FP+TP+F M+IG+AVG LFR K++  RVVIGKDTRLSGYMLEN
Sbjct: 1   MARKYFGTDGIRGRANFFPMTPDFAMKIGMAVGVLFRTKEQSHRVVIGKDTRLSGYMLEN 60

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +LV+G TAAGMDAF+LGP+P+PAVAML RSLRAD+GVMISASHNP+ DNGIKLFGPDG+K
Sbjct: 61  ALVSGLTAAGMDAFLLGPVPTPAVAMLCRSLRADLGVMISASHNPFYDNGIKLFGPDGFK 120

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +S +IE++IE L+E DL+  L+    IG AKRV+G   RYIE+ KRTLPRDV L  LRIV
Sbjct: 121 LSDEIENKIEQLIETDLSHSLAEPAEIGRAKRVEGDIYRYIEYAKRTLPRDVRLDSLRIV 180

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           VDCANGA+YK AP   WELGA+V  I ++P G+NIN  CGST++ SL+RKVHEVRAD+GI
Sbjct: 181 VDCANGATYKAAPRALWELGAEVFAINNEPMGLNINQKCGSTDLTSLKRKVHEVRADVGI 240

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           ALDGDGDRV++VDEK   ++GDQI+A+IA  W     LR  G+VTT+MSN+GLERF+   
Sbjct: 241 ALDGDGDRVLMVDEKAQTIDGDQIIAVIAEHWYKTERLRSKGVVTTIMSNLGLERFLNSK 300

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           GL L RT VGDRY+++ M+  G+NVGGE SGHI+LSD+G+TGDGLVAALQ+L  +++   
Sbjct: 301 GLDLIRTNVGDRYVVDAMRQKGYNVGGESSGHIVLSDFGTTGDGLVAALQILACMQENQY 360

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
            +S +C  FE  PQ L+++++KD +IL  S +  AI  A+  L    RL++R SGTE LI
Sbjct: 361 SMSYLCQRFEVVPQVLKNIAIKDKNILQKSKVKTAIDHAQKRLGKEGRLVIRPSGTEPLI 420

Query: 421 RIMAEGDDLSRIKRIVDDLAKVIPMIDS 448
           RIM EGDD   I+ IV +++ V+   DS
Sbjct: 421 RIMVEGDDQKVIEEIVAEISDVLVQHDS 448


>gi|261750846|ref|ZP_05994555.1| phosphoglucosamine mutase [Brucella suis bv. 5 str. 513]
 gi|261740599|gb|EEY28525.1| phosphoglucosamine mutase [Brucella suis bv. 5 str. 513]
          Length = 451

 Score =  290 bits (741), Expect = 4e-76,   Method: Composition-based stats.
 Identities = 271/444 (61%), Positives = 353/444 (79%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M R+FFGTDGIRG++N+FP+TP   M++G+AVGY+FR K +  RVVIGKDTR SGYMLEN
Sbjct: 1   MTRKFFGTDGIRGQANSFPMTPEIAMKVGMAVGYIFRRKGQASRVVIGKDTRRSGYMLEN 60

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +LVAGFTAAGMD F+LGPIP+PAVAML RSLRAD+GVMISASHNP+ DNGIKLFGPDG+K
Sbjct: 61  ALVAGFTAAGMDVFLLGPIPTPAVAMLCRSLRADIGVMISASHNPFYDNGIKLFGPDGFK 120

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +S  IE +IE ++E D+T +L+ +  +G AKRVDG   RYIE  KRTLPR+++L GLR+V
Sbjct: 121 LSDQIELQIEAMIEGDMTPFLASHGDVGRAKRVDGDIYRYIEFAKRTLPRNISLNGLRVV 180

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           VDCANGA YKVAP   WELGA+V+ I ++PNGININ DCGST+ + L +KVHEVRAD+GI
Sbjct: 181 VDCANGAGYKVAPAALWELGAEVITINNEPNGININEDCGSTHPIGLMKKVHEVRADVGI 240

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           ALDGD DRV++VDE G +++GDQ+MA+IA  W + + L G GIV TVMSN+GLERF+A  
Sbjct: 241 ALDGDADRVLLVDENGTVIDGDQLMAVIAESWAASNRLEGGGIVATVMSNLGLERFLADR 300

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
            L+L RT+VGDRY++E+M+ +GFNVGGEQSGHI+LSD+ +TGDGL++ALQ+L   ++ +K
Sbjct: 301 NLTLARTKVGDRYVVEHMREHGFNVGGEQSGHIVLSDFATTGDGLISALQILAVAQEQNK 360

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
           P+S +C  F+  PQ L++V       L +  +  AI +A+  L G  RL++R SGTE LI
Sbjct: 361 PISDVCRKFQPVPQLLKNVRTTGGKPLENKRVKSAINEAKERLGGQGRLVIRPSGTEPLI 420

Query: 421 RIMAEGDDLSRIKRIVDDLAKVIP 444
           R+MAEGDD   ++++V+D+  VI 
Sbjct: 421 RVMAEGDDRGLVEKVVNDIIDVIS 444


>gi|254700352|ref|ZP_05162180.1| phosphoglucosamine mutase [Brucella suis bv. 5 str. 513]
          Length = 459

 Score =  290 bits (741), Expect = 4e-76,   Method: Composition-based stats.
 Identities = 271/444 (61%), Positives = 353/444 (79%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M R+FFGTDGIRG++N+FP+TP   M++G+AVGY+FR K +  RVVIGKDTR SGYMLEN
Sbjct: 9   MTRKFFGTDGIRGQANSFPMTPEIAMKVGMAVGYIFRRKGQASRVVIGKDTRRSGYMLEN 68

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +LVAGFTAAGMD F+LGPIP+PAVAML RSLRAD+GVMISASHNP+ DNGIKLFGPDG+K
Sbjct: 69  ALVAGFTAAGMDVFLLGPIPTPAVAMLCRSLRADIGVMISASHNPFYDNGIKLFGPDGFK 128

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +S  IE +IE ++E D+T +L+ +  +G AKRVDG   RYIE  KRTLPR+++L GLR+V
Sbjct: 129 LSDQIELQIEAMIEGDMTPFLASHGDVGRAKRVDGDIYRYIEFAKRTLPRNISLNGLRVV 188

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           VDCANGA YKVAP   WELGA+V+ I ++PNGININ DCGST+ + L +KVHEVRAD+GI
Sbjct: 189 VDCANGAGYKVAPAALWELGAEVITINNEPNGININEDCGSTHPIGLMKKVHEVRADVGI 248

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           ALDGD DRV++VDE G +++GDQ+MA+IA  W + + L G GIV TVMSN+GLERF+A  
Sbjct: 249 ALDGDADRVLLVDENGTVIDGDQLMAVIAESWAASNRLEGGGIVATVMSNLGLERFLADR 308

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
            L+L RT+VGDRY++E+M+ +GFNVGGEQSGHI+LSD+ +TGDGL++ALQ+L   ++ +K
Sbjct: 309 NLTLARTKVGDRYVVEHMREHGFNVGGEQSGHIVLSDFATTGDGLISALQILAVAQEQNK 368

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
           P+S +C  F+  PQ L++V       L +  +  AI +A+  L G  RL++R SGTE LI
Sbjct: 369 PISDVCRKFQPVPQLLKNVRTTGGKPLENKRVKSAINEAKERLGGQGRLVIRPSGTEPLI 428

Query: 421 RIMAEGDDLSRIKRIVDDLAKVIP 444
           R+MAEGDD   ++++V+D+  VI 
Sbjct: 429 RVMAEGDDRGLVEKVVNDIIDVIS 452


>gi|254473100|ref|ZP_05086498.1| phosphoglucosamine mutase [Pseudovibrio sp. JE062]
 gi|211957821|gb|EEA93023.1| phosphoglucosamine mutase [Pseudovibrio sp. JE062]
          Length = 449

 Score =  289 bits (740), Expect = 4e-76,   Method: Composition-based stats.
 Identities = 259/448 (57%), Positives = 338/448 (75%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M R++FGTDG+RG +N +P+T    +++G+A G +FR  K   RVVIGKDTRLSGYM EN
Sbjct: 1   MSRKYFGTDGMRGTANKWPMTAEVALKVGMAAGEVFRRGKYRHRVVIGKDTRLSGYMFEN 60

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +LVAGFTA GMD F+LGP+P+PAVAMLTRSLRAD+GVMISASHNP++DNGIK FGPDG+K
Sbjct: 61  ALVAGFTAMGMDVFVLGPMPTPAVAMLTRSLRADIGVMISASHNPFEDNGIKFFGPDGFK 120

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +S ++E +IE L++ D++  L   +++G A R+D + DRYIE  KRTLPRD+ L G+RIV
Sbjct: 121 LSDEVELQIERLIDSDMSRNLPAPETLGRATRIDSMKDRYIEFAKRTLPRDLNLNGMRIV 180

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           +DCANGA+YKVAPE+ WELGA+V  +G  P+G NIN DCGST   +L +KVHEVRADIGI
Sbjct: 181 IDCANGAAYKVAPEILWELGAEVFPLGVDPDGFNINKDCGSTAPEALAKKVHEVRADIGI 240

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           ALDGD DRVIIVDE   +V+GDQ+MA+IA  W +   L   GIV TVMSN+GLER++ G+
Sbjct: 241 ALDGDADRVIIVDENSKVVDGDQLMAVIAESWKAAGRLSAPGIVATVMSNLGLERYLKGI 300

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           GLSL+RT+VGDRY++E M+  GFNVGGEQSGHI++SD+G+TGDGLVAALQ+L  +K+ +K
Sbjct: 301 GLSLERTKVGDRYVVERMREGGFNVGGEQSGHIVMSDFGTTGDGLVAALQILACVKKMNK 360

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
           PVS +C+ F   PQ L++V       L   ++   I   E +L    RL++RASGTE LI
Sbjct: 361 PVSEVCNRFVPVPQILKNVRYGSGKPLEDKAVKAVIKAGEEKLGKQGRLVIRASGTEPLI 420

Query: 421 RIMAEGDDLSRIKRIVDDLAKVIPMIDS 448
           R+M E DD   +  +VD +   +    +
Sbjct: 421 RVMGEADDAKLLNEVVDSIVDAVKKAAA 448


>gi|306841409|ref|ZP_07474111.1| phosphoglucosamine mutase [Brucella sp. BO2]
 gi|306844683|ref|ZP_07477268.1| phosphoglucosamine mutase [Brucella sp. BO1]
 gi|306274855|gb|EFM56625.1| phosphoglucosamine mutase [Brucella sp. BO1]
 gi|306288515|gb|EFM59867.1| phosphoglucosamine mutase [Brucella sp. BO2]
          Length = 459

 Score =  289 bits (740), Expect = 5e-76,   Method: Composition-based stats.
 Identities = 270/444 (60%), Positives = 352/444 (79%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M R+FFGTDGIRG++N+FP+TP   M++G+AVGY+FR K +  RVVIGKDTR SGYMLEN
Sbjct: 9   MTRKFFGTDGIRGQANSFPMTPEIAMKVGMAVGYIFRRKGQASRVVIGKDTRRSGYMLEN 68

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +LVAGFTAAGM+ F+LGPIP+PAVAML RSLRAD+GVMISASHNP+ DNGIKLFGPDG+K
Sbjct: 69  ALVAGFTAAGMEVFLLGPIPTPAVAMLCRSLRADIGVMISASHNPFYDNGIKLFGPDGFK 128

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +S  IE +IE ++E D+T +L+ +  +G AKRVDG   RYIE  KRTLPR+++L GLR+V
Sbjct: 129 LSDQIELQIEAMIEGDMTPFLASHGDVGRAKRVDGDIYRYIEFAKRTLPRNISLNGLRVV 188

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           VDCANGA YKVAP   WELGA+V+ I ++PNGININ DCGST+ + L +KVHEVRAD+GI
Sbjct: 189 VDCANGAGYKVAPAALWELGAEVITINNEPNGININEDCGSTHPIGLMKKVHEVRADVGI 248

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           ALDGD DRV++VDE G +++GDQ+MA+IA  W   + L G GIV TVMSN+GLERF+A  
Sbjct: 249 ALDGDADRVLLVDENGTVIDGDQLMAVIAESWAESNRLEGGGIVATVMSNLGLERFLADR 308

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
            L+L RT+VGDRY++E+M+ +GFNVGGEQSGHI+LSD+ +TGDGL++ALQ+L   ++ +K
Sbjct: 309 NLTLARTKVGDRYVVEHMREHGFNVGGEQSGHIVLSDFATTGDGLISALQILAVAQEQNK 368

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
           P+S +C  F+  PQ L++V       L +  +  AI +A+  L G  RL++R SGTE LI
Sbjct: 369 PISDVCRKFQPVPQLLKNVRTTGGKPLENKRVKSAIDEAKERLGGQGRLVIRPSGTEPLI 428

Query: 421 RIMAEGDDLSRIKRIVDDLAKVIP 444
           R+MAEGDD   ++++V+D+  VI 
Sbjct: 429 RVMAEGDDRGLVEKVVNDIIDVIS 452


>gi|13473323|ref|NP_104890.1| phosphoglucosamine mutase [Mesorhizobium loti MAFF303099]
 gi|81779257|sp|Q98F91|GLMM_RHILO RecName: Full=Phosphoglucosamine mutase
 gi|14024072|dbj|BAB50676.1| phosphoglucomutase/phosphomannomutase family protein; MrsA
           [Mesorhizobium loti MAFF303099]
          Length = 450

 Score =  289 bits (740), Expect = 5e-76,   Method: Composition-based stats.
 Identities = 276/445 (62%), Positives = 343/445 (77%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M   +FGTDGIRG++N FP+T    MR+G+A G  F+      RVV+GKDTRLSGYM+EN
Sbjct: 1   MAGNYFGTDGIRGRANKFPMTAEIAMRVGMAAGLSFQRGSHRHRVVLGKDTRLSGYMIEN 60

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           ++VAG  AAGMD F+LGPIP+PAVAML RSLRAD+GVMISASHNPY DNGIKLFGPDGYK
Sbjct: 61  AMVAGLCAAGMDVFLLGPIPTPAVAMLVRSLRADIGVMISASHNPYYDNGIKLFGPDGYK 120

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +S +IE+RIE++L+ D+   L+  D +G AKRVDGVHDRYIE  KRTLPR ++L GLRIV
Sbjct: 121 LSDEIEERIESMLDKDVELTLADSDGLGRAKRVDGVHDRYIEFAKRTLPRSMSLSGLRIV 180

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           VDCANGA+YKVAPE  WELGA+VV I  +PNG NIN +CGST+   LQ+KVHEVRADIGI
Sbjct: 181 VDCANGAAYKVAPEALWELGAEVVAINIEPNGFNINKECGSTHPAGLQKKVHEVRADIGI 240

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           ALDGD DRV+IVDE GAIV+GDQIMA+IA  W     L G G+V+TVMSN+GLERF+  +
Sbjct: 241 ALDGDADRVVIVDENGAIVDGDQIMAMIAESWHQSGRLAGGGVVSTVMSNLGLERFLGDM 300

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
            L L RT+VGDRY++E+M+ +G NVGGEQSGHI+LSD+ +TGDGLV+ALQVL  IK+  +
Sbjct: 301 KLQLHRTKVGDRYVVEHMRAHGLNVGGEQSGHIVLSDFSTTGDGLVSALQVLACIKRQGR 360

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
           PVS +   FE  PQ L++V +     L  + +  AI DA + L    RL++R SGTE LI
Sbjct: 361 PVSELSKKFEPVPQLLKNVRIAGGKPLEEAPVKAAIEDARNRLGKAGRLVIRPSGTEPLI 420

Query: 421 RIMAEGDDLSRIKRIVDDLAKVIPM 445
           R+MAEGDD   ++ +V+D+ +VI  
Sbjct: 421 RVMAEGDDPQLVEAVVNDIVEVISE 445


>gi|294850943|ref|ZP_06791619.1| phosphoglucosamine mutase [Brucella sp. NVSL 07-0026]
 gi|294821586|gb|EFG38582.1| phosphoglucosamine mutase [Brucella sp. NVSL 07-0026]
          Length = 451

 Score =  289 bits (739), Expect = 6e-76,   Method: Composition-based stats.
 Identities = 270/444 (60%), Positives = 352/444 (79%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M R+FFGTDGIRG++N+FP+TP   M++G+AVGY+FR K +  RVVIGKDTR SGYMLEN
Sbjct: 1   MTRKFFGTDGIRGQANSFPMTPEIAMKVGMAVGYIFRRKGQASRVVIGKDTRRSGYMLEN 60

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +LVAGFTAAGMD F+LGPIP+PAVAML RSLRAD+GVMISASHNP+ DNGIKLFGPDG+K
Sbjct: 61  ALVAGFTAAGMDVFLLGPIPTPAVAMLCRSLRADIGVMISASHNPFYDNGIKLFGPDGFK 120

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +S  IE +IE ++E D+T +L+ +  +G AKRVDG   RYIE  KRTLPR+++L  LR+V
Sbjct: 121 LSDQIELQIEAMIEGDMTPFLASHGDVGRAKRVDGDIYRYIEFAKRTLPRNISLNRLRVV 180

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           VDCANGA YKVAP   WELGA+V+ I ++PNGININ DCGST+ + L +KVHEVRAD+GI
Sbjct: 181 VDCANGAGYKVAPAALWELGAEVITINNEPNGININEDCGSTHPIGLMKKVHEVRADVGI 240

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           ALDGD DRV++VDE G +++GDQ+MA+IA  W + + L G GIV TVMSN+GLERF+A  
Sbjct: 241 ALDGDADRVLLVDENGTVIDGDQLMAVIAESWAASNRLEGGGIVATVMSNLGLERFLADR 300

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
            L+L RT+VGDRY++E+M+ +GFNVGGEQSGHI+LSD+ +TGDGL++ALQ+L   ++ +K
Sbjct: 301 NLTLARTKVGDRYVVEHMREHGFNVGGEQSGHIVLSDFATTGDGLISALQILAVAQEQNK 360

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
           P+S +C  F+  PQ L++V       L +  +  AI +A+  L G  RL++R SGTE LI
Sbjct: 361 PISDVCRKFQPVPQLLKNVRTTGGKPLENKRVKSAIDEAKERLGGQGRLVIRPSGTEPLI 420

Query: 421 RIMAEGDDLSRIKRIVDDLAKVIP 444
           R+MAEGDD   ++++V+D+  VI 
Sbjct: 421 RVMAEGDDRGLVEKVVNDIIDVIS 444


>gi|222149668|ref|YP_002550625.1| phosphoglucosamine mutase [Agrobacterium vitis S4]
 gi|254798008|sp|B9JRY5|GLMM_AGRVS RecName: Full=Phosphoglucosamine mutase
 gi|221736650|gb|ACM37613.1| phosphoglucosamine mutase [Agrobacterium vitis S4]
          Length = 450

 Score =  289 bits (739), Expect = 7e-76,   Method: Composition-based stats.
 Identities = 296/445 (66%), Positives = 358/445 (80%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M RR+FGTDGIRG+SN FP+TP+  M++GIAVG + R      RVVIGKDTRLSGYMLE 
Sbjct: 1   MTRRYFGTDGIRGQSNVFPMTPDLAMKVGIAVGTILRRGHHRHRVVIGKDTRLSGYMLET 60

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +LVAGFTAAG+D F+LGPIP+PAVAMLTRSLRAD+GVM+SASHNP+ DNGIKLFGPDGYK
Sbjct: 61  ALVAGFTAAGLDVFLLGPIPTPAVAMLTRSLRADIGVMVSASHNPFADNGIKLFGPDGYK 120

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +S ++E  IE LL  +    L+  + IG AKRVDG   RYIE VKRTLPRDVTL GLRI 
Sbjct: 121 LSDELEAEIEALLNQEAPLPLARAEDIGRAKRVDGDIYRYIEFVKRTLPRDVTLSGLRIA 180

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           +DCANGA+YKVAP   WELGA+VV IG++PNG+NINL+CGST+  +LQ+KVHEVRADIGI
Sbjct: 181 IDCANGAAYKVAPTALWELGAEVVTIGNEPNGLNINLECGSTHPAALQKKVHEVRADIGI 240

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           ALDGD DRVIIVDE GAIV+GDQ+MA+IA  W +   L+G GIV TVMSN+GLERF+ G 
Sbjct: 241 ALDGDADRVIIVDETGAIVDGDQLMAVIAESWANDQTLKGGGIVATVMSNLGLERFLGGK 300

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           GL+L RT+VGDR+++E+M+ N +N+GGEQSGHI+LSD+G+TGDGLVAALQ+L  +K+  K
Sbjct: 301 GLTLARTKVGDRHVVEHMRQNHYNIGGEQSGHIVLSDFGTTGDGLVAALQILAAVKRTGK 360

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
            VS ICH F+  PQ LR+V +     L  S + QAIADAESEL    RL++R SGTE LI
Sbjct: 361 TVSQICHRFDPVPQLLRNVRISGGKPLEDSFVRQAIADAESELARNGRLVIRPSGTEPLI 420

Query: 421 RIMAEGDDLSRIKRIVDDLAKVIPM 445
           R+MAEGDD S+I+RIV+DL  VI  
Sbjct: 421 RVMAEGDDRSQIERIVNDLIGVIAN 445


>gi|163758785|ref|ZP_02165872.1| putative phosphoglucosamine mutase [Hoeflea phototrophica DFL-43]
 gi|162284075|gb|EDQ34359.1| putative phosphoglucosamine mutase [Hoeflea phototrophica DFL-43]
          Length = 450

 Score =  287 bits (735), Expect = 2e-75,   Method: Composition-based stats.
 Identities = 296/445 (66%), Positives = 364/445 (81%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M RR+FGTDGIRG++N  P+TP+  MR+GIAVG LFR      RVVIGKDTRLSGYM+EN
Sbjct: 1   MSRRYFGTDGIRGQANKSPMTPDIAMRVGIAVGNLFRRGDHRHRVVIGKDTRLSGYMIEN 60

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +LVAGFTAAG+D F+LGPIP+PAVAMLTRSLRAD+GVMISASHNPYQDNGIKLFGPDG+K
Sbjct: 61  ALVAGFTAAGLDVFLLGPIPTPAVAMLTRSLRADIGVMISASHNPYQDNGIKLFGPDGFK 120

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +S ++E RIE LL+DD+   L+  D+IG AKR+DGVHDRYIE  KRTLP+D+TL GLR+V
Sbjct: 121 LSDELESRIEDLLDDDIHLQLARPDAIGRAKRIDGVHDRYIEFAKRTLPKDITLAGLRVV 180

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           VDCANGA YKVAP   WELGADV+ IG++PNG NINL+CGST+ ++L RKVHEVRADIGI
Sbjct: 181 VDCANGAGYKVAPAALWELGADVIAIGEEPNGTNINLNCGSTHPVALSRKVHEVRADIGI 240

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           ALDGD DRV+IVDE G++++GDQ+MA+IA  W +  +LRG+GIV TVMSN+GLERF+  +
Sbjct: 241 ALDGDADRVLIVDENGSVIDGDQLMAVIAESWAADQMLRGDGIVATVMSNLGLERFLDDI 300

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           GLSL RT+VGDRY++E+M+ NGFNVGGEQSGHI+LSD+ +TGDGLVAALQV+  +++  +
Sbjct: 301 GLSLARTKVGDRYVVEHMRKNGFNVGGEQSGHIVLSDFATTGDGLVAALQVMACVQRMGR 360

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
           PVS +C  FE  PQ L++V     + LN S +  AI DAES L    RL++R SGTE LI
Sbjct: 361 PVSEVCRRFEPVPQVLKNVRHSGGNPLNDSRVKAAITDAESTLGNKARLVIRPSGTEPLI 420

Query: 421 RIMAEGDDLSRIKRIVDDLAKVIPM 445
           R+MAEGDD S+I+ +VD L  VI  
Sbjct: 421 RVMAEGDDRSQIETVVDQLISVISA 445


>gi|253997065|ref|YP_003049129.1| phosphoglucosamine mutase [Methylotenera mobilis JLW8]
 gi|253983744|gb|ACT48602.1| phosphoglucosamine mutase [Methylotenera mobilis JLW8]
          Length = 451

 Score =  287 bits (734), Expect = 2e-75,   Method: Composition-based stats.
 Identities = 206/454 (45%), Positives = 297/454 (65%), Gaps = 9/454 (1%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFR------GKKKHRRVVIGKDTRLS 54
           M +++FGTDGIRG+     ITP F+MR+G A G +         K  H  V+IGKDTR+S
Sbjct: 1   MSKKYFGTDGIRGRVGDALITPEFVMRLGYAAGRVLTSIDSHLAKGAHPAVLIGKDTRIS 60

Query: 55  GYMLENSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLF 114
           GYMLE +L AG +AAG+D  + GP+P+P VA LTR+LRA  G++ISASHNPY DNGIK F
Sbjct: 61  GYMLEAALEAGLSAAGVDVLLTGPMPTPGVAYLTRALRAQAGIVISASHNPYYDNGIKFF 120

Query: 115 GPDGYKVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTL 174
              G K+  D+E  IE  L++ +   +     +G A+R+D    RY+E  K T P  + L
Sbjct: 121 SSLGTKLPDDVEHAIEAALDEPM--QVMESAKLGKARRIDDAAGRYVEFCKSTFPNHLDL 178

Query: 175 QGLRIVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEV 234
           +GL+IV+DCA+GA+Y VAP VF ELGA++VVIG+ P+G+NIN   GST+  +LQ  V E 
Sbjct: 179 RGLKIVLDCAHGATYHVAPPVFHELGAEIVVIGNHPDGLNINEQVGSTHPQALQNAVVEH 238

Query: 235 RADIGIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLE 294
           +AD+G+A DGDGDRV++VD  G +++GDQ++ +IA        L+G  + T  M+N+ LE
Sbjct: 239 QADLGVAFDGDGDRVMMVDHSGRLLDGDQLLYIIAAARQQAGALQGGVVGTL-MTNLALE 297

Query: 295 RFIAGLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRY 354
             +A + +   R +VGDRY++E +  N + +GGE SGHI+  D  S+GDG++AALQVL  
Sbjct: 298 HKLAAMSIPFARAKVGDRYVLELLNQNNWQLGGENSGHILTLDKHSSGDGIIAALQVLHA 357

Query: 355 IKQYDKPVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRAS 414
           + Q  K +S +      YPQ L +V+ K    LN+S I  A+  AE+EL+   R+++RAS
Sbjct: 358 VIQSGKTLSELGADLTLYPQVLINVTTKQKVDLNNSLIKAAVQQAEAELKDSGRVLLRAS 417

Query: 415 GTESLIRIMAEGDDLSRIKRIVDDLAKVIPMIDS 448
           GTE  IR+M EG++ S++  +   +A V+  + +
Sbjct: 418 GTEPKIRVMVEGENQSQVSTLAQSIADVVQRVAA 451


>gi|261214659|ref|ZP_05928940.1| phosphoglucosamine mutase [Brucella abortus bv. 3 str. Tulya]
 gi|260916266|gb|EEX83127.1| phosphoglucosamine mutase [Brucella abortus bv. 3 str. Tulya]
          Length = 451

 Score =  287 bits (734), Expect = 3e-75,   Method: Composition-based stats.
 Identities = 269/444 (60%), Positives = 351/444 (79%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M R+FFGTDGIRG++N+FP+TP   M++G+AVGY+FR K +  R VIGKDTR SGYMLE 
Sbjct: 1   MTRKFFGTDGIRGQANSFPMTPEIAMKVGMAVGYIFRRKGQASRAVIGKDTRRSGYMLEK 60

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +LVAGFTAAGMD F+LGPIP+PAVAML RSLRAD+GVMISASHNP+ DNGIKLFGPDG+K
Sbjct: 61  ALVAGFTAAGMDVFLLGPIPTPAVAMLCRSLRADIGVMISASHNPFYDNGIKLFGPDGFK 120

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +S  IE +IE ++E D+T +L+ +  +G AKRVDG   RYIE  KRTLPR+++L GLR+V
Sbjct: 121 LSDQIELQIEAMIEGDMTPFLASHGDVGRAKRVDGDIYRYIEFAKRTLPRNISLNGLRVV 180

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           VDCANGA YKVAP   WELGA+V+ I ++PNGININ DCGST+ + L +KVHEVRAD+GI
Sbjct: 181 VDCANGAGYKVAPAALWELGAEVITINNEPNGININEDCGSTHPIGLMKKVHEVRADVGI 240

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           ALDGD DRV++VDE G +++GDQ+MA+IA  W + + L G GIV TVMSN+GLERF+A  
Sbjct: 241 ALDGDADRVLLVDENGTVIDGDQLMAVIAESWAASNRLEGGGIVATVMSNLGLERFLADR 300

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
            L+L RT+VGDRY++E+M+ +GFNVGGEQSGHI+LSD+ +TGDGL++ALQ+L   ++ +K
Sbjct: 301 NLTLARTKVGDRYVVEHMREHGFNVGGEQSGHIVLSDFATTGDGLISALQILAVAQEQNK 360

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
           P+S +C  F+  PQ L++V       L +  +  AI +A+  L G  RL++R SGTE LI
Sbjct: 361 PISDVCRKFQPVPQLLKNVRTTGGKPLENKRVKSAIDEAKERLGGQGRLVIRPSGTEPLI 420

Query: 421 RIMAEGDDLSRIKRIVDDLAKVIP 444
           R+MAEGDD   ++++V+D+  VI 
Sbjct: 421 RVMAEGDDRGLVEKVVNDIIDVIS 444


>gi|254694351|ref|ZP_05156179.1| Phosphoglucosamine mutase [Brucella abortus bv. 3 str. Tulya]
          Length = 459

 Score =  287 bits (734), Expect = 3e-75,   Method: Composition-based stats.
 Identities = 269/444 (60%), Positives = 351/444 (79%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M R+FFGTDGIRG++N+FP+TP   M++G+AVGY+FR K +  R VIGKDTR SGYMLE 
Sbjct: 9   MTRKFFGTDGIRGQANSFPMTPEIAMKVGMAVGYIFRRKGQASRAVIGKDTRRSGYMLEK 68

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +LVAGFTAAGMD F+LGPIP+PAVAML RSLRAD+GVMISASHNP+ DNGIKLFGPDG+K
Sbjct: 69  ALVAGFTAAGMDVFLLGPIPTPAVAMLCRSLRADIGVMISASHNPFYDNGIKLFGPDGFK 128

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +S  IE +IE ++E D+T +L+ +  +G AKRVDG   RYIE  KRTLPR+++L GLR+V
Sbjct: 129 LSDQIELQIEAMIEGDMTPFLASHGDVGRAKRVDGDIYRYIEFAKRTLPRNISLNGLRVV 188

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           VDCANGA YKVAP   WELGA+V+ I ++PNGININ DCGST+ + L +KVHEVRAD+GI
Sbjct: 189 VDCANGAGYKVAPAALWELGAEVITINNEPNGININEDCGSTHPIGLMKKVHEVRADVGI 248

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           ALDGD DRV++VDE G +++GDQ+MA+IA  W + + L G GIV TVMSN+GLERF+A  
Sbjct: 249 ALDGDADRVLLVDENGTVIDGDQLMAVIAESWAASNRLEGGGIVATVMSNLGLERFLADR 308

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
            L+L RT+VGDRY++E+M+ +GFNVGGEQSGHI+LSD+ +TGDGL++ALQ+L   ++ +K
Sbjct: 309 NLTLARTKVGDRYVVEHMREHGFNVGGEQSGHIVLSDFATTGDGLISALQILAVAQEQNK 368

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
           P+S +C  F+  PQ L++V       L +  +  AI +A+  L G  RL++R SGTE LI
Sbjct: 369 PISDVCRKFQPVPQLLKNVRTTGGKPLENKRVKSAIDEAKERLGGQGRLVIRPSGTEPLI 428

Query: 421 RIMAEGDDLSRIKRIVDDLAKVIP 444
           R+MAEGDD   ++++V+D+  VI 
Sbjct: 429 RVMAEGDDRGLVEKVVNDIIDVIS 452


>gi|326409704|gb|ADZ66769.1| phosphoglucosamine mutase [Brucella melitensis M28]
          Length = 460

 Score =  287 bits (733), Expect = 3e-75,   Method: Composition-based stats.
 Identities = 269/444 (60%), Positives = 351/444 (79%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M R+FFGTDGIRG++N+FP+TP   M++G+AVGY+FR K +  R VIGKDTR SGYMLEN
Sbjct: 10  MTRKFFGTDGIRGQANSFPMTPEIAMKVGMAVGYIFRRKGQASRAVIGKDTRRSGYMLEN 69

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +LVAGFTAAGMD F+LGPIP+PAVAML RSLRAD+GVMISASHNP+ DNGIKLFGPDG+K
Sbjct: 70  ALVAGFTAAGMDVFLLGPIPTPAVAMLCRSLRADIGVMISASHNPFYDNGIKLFGPDGFK 129

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +S  IE +IE ++E D+T +L+ +  +G AKRVDG   RYIE  KRTLPR+++L GLR+V
Sbjct: 130 LSDQIELQIEAMIEGDMTPFLASHGDVGRAKRVDGDIYRYIEFAKRTLPRNISLNGLRVV 189

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           VDCANGA YKVAP   WELGA+V+ I ++PNGININ DCGST+ + L +KVH VRAD+GI
Sbjct: 190 VDCANGAGYKVAPAALWELGAEVITINNEPNGININEDCGSTHPIGLMKKVHGVRADVGI 249

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           ALDGD DRV++VDE G +++GDQ+MA+IA  W + + L G GIV TVMSN+GLERF+A  
Sbjct: 250 ALDGDADRVLLVDENGTVIDGDQLMAVIAESWAASNRLEGGGIVATVMSNLGLERFLADR 309

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
            L+L RT+VGDRY++E+M+ +GFNVGGEQSGHI+LSD+ +TGDGL++ALQ+L   ++ +K
Sbjct: 310 NLTLARTKVGDRYVVEHMREHGFNVGGEQSGHIVLSDFATTGDGLISALQILAVAQEQNK 369

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
           P+S +C  F+  PQ L++V       L +  +  AI +A+  L G  RL++R SGTE LI
Sbjct: 370 PISDVCRKFQPVPQLLKNVRTTGGKPLENKRVKSAIDEAKERLGGQGRLVIRPSGTEPLI 429

Query: 421 RIMAEGDDLSRIKRIVDDLAKVIP 444
           R+MAEGDD   ++++V+D+  VI 
Sbjct: 430 RVMAEGDDRGLVEKVVNDIIDVIS 453


>gi|225853146|ref|YP_002733379.1| phosphoglucosamine mutase [Brucella melitensis ATCC 23457]
 gi|256045301|ref|ZP_05448195.1| phosphoglucosamine mutase [Brucella melitensis bv. 1 str. Rev.1]
 gi|256114259|ref|ZP_05455004.1| phosphoglucosamine mutase [Brucella melitensis bv. 3 str. Ether]
 gi|225641511|gb|ACO01425.1| phosphoglucosamine mutase [Brucella melitensis ATCC 23457]
          Length = 459

 Score =  287 bits (733), Expect = 3e-75,   Method: Composition-based stats.
 Identities = 269/444 (60%), Positives = 351/444 (79%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M R+FFGTDGIRG++N+FP+TP   M++G+AVGY+FR K +  R VIGKDTR SGYMLEN
Sbjct: 9   MTRKFFGTDGIRGQANSFPMTPEIAMKVGMAVGYIFRRKGQASRAVIGKDTRRSGYMLEN 68

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +LVAGFTAAGMD F+LGPIP+PAVAML RSLRAD+GVMISASHNP+ DNGIKLFGPDG+K
Sbjct: 69  ALVAGFTAAGMDVFLLGPIPTPAVAMLCRSLRADIGVMISASHNPFYDNGIKLFGPDGFK 128

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +S  IE +IE ++E D+T +L+ +  +G AKRVDG   RYIE  KRTLPR+++L GLR+V
Sbjct: 129 LSDQIELQIEAMIEGDMTPFLASHGDVGRAKRVDGDIYRYIEFAKRTLPRNISLNGLRVV 188

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           VDCANGA YKVAP   WELGA+V+ I ++PNGININ DCGST+ + L +KVH VRAD+GI
Sbjct: 189 VDCANGAGYKVAPAALWELGAEVITINNEPNGININEDCGSTHPIGLMKKVHGVRADVGI 248

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           ALDGD DRV++VDE G +++GDQ+MA+IA  W + + L G GIV TVMSN+GLERF+A  
Sbjct: 249 ALDGDADRVLLVDENGTVIDGDQLMAVIAESWAASNRLEGGGIVATVMSNLGLERFLADR 308

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
            L+L RT+VGDRY++E+M+ +GFNVGGEQSGHI+LSD+ +TGDGL++ALQ+L   ++ +K
Sbjct: 309 NLTLARTKVGDRYVVEHMREHGFNVGGEQSGHIVLSDFATTGDGLISALQILAVAQEQNK 368

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
           P+S +C  F+  PQ L++V       L +  +  AI +A+  L G  RL++R SGTE LI
Sbjct: 369 PISDVCRKFQPVPQLLKNVRTTGGKPLENKRVKSAIDEAKERLGGQGRLVIRPSGTEPLI 428

Query: 421 RIMAEGDDLSRIKRIVDDLAKVIP 444
           R+MAEGDD   ++++V+D+  VI 
Sbjct: 429 RVMAEGDDRGLVEKVVNDIIDVIS 452


>gi|17986627|ref|NP_539261.1| phosphoglucosamine mutase [Brucella melitensis bv. 1 str. 16M]
 gi|17982241|gb|AAL51525.1| phosphoglucosamine mutase / phosphoacetylglucosamine mutase /
           phosphomannomutase [Brucella melitensis bv. 1 str. 16M]
          Length = 475

 Score =  287 bits (733), Expect = 3e-75,   Method: Composition-based stats.
 Identities = 269/444 (60%), Positives = 351/444 (79%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M R+FFGTDGIRG++N+FP+TP   M++G+AVGY+FR K +  R VIGKDTR SGYMLEN
Sbjct: 25  MTRKFFGTDGIRGQANSFPMTPEIAMKVGMAVGYIFRRKGQASRAVIGKDTRRSGYMLEN 84

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +LVAGFTAAGMD F+LGPIP+PAVAML RSLRAD+GVMISASHNP+ DNGIKLFGPDG+K
Sbjct: 85  ALVAGFTAAGMDVFLLGPIPTPAVAMLCRSLRADIGVMISASHNPFYDNGIKLFGPDGFK 144

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +S  IE +IE ++E D+T +L+ +  +G AKRVDG   RYIE  KRTLPR+++L GLR+V
Sbjct: 145 LSDQIELQIEAMIEGDMTPFLASHGDVGRAKRVDGDIYRYIEFAKRTLPRNISLNGLRVV 204

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           VDCANGA YKVAP   WELGA+V+ I ++PNGININ DCGST+ + L +KVH VRAD+GI
Sbjct: 205 VDCANGAGYKVAPAALWELGAEVITINNEPNGININEDCGSTHPIGLMKKVHGVRADVGI 264

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           ALDGD DRV++VDE G +++GDQ+MA+IA  W + + L G GIV TVMSN+GLERF+A  
Sbjct: 265 ALDGDADRVLLVDENGTVIDGDQLMAVIAESWAASNRLEGGGIVATVMSNLGLERFLADR 324

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
            L+L RT+VGDRY++E+M+ +GFNVGGEQSGHI+LSD+ +TGDGL++ALQ+L   ++ +K
Sbjct: 325 NLTLARTKVGDRYVVEHMREHGFNVGGEQSGHIVLSDFATTGDGLISALQILAVAQEQNK 384

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
           P+S +C  F+  PQ L++V       L +  +  AI +A+  L G  RL++R SGTE LI
Sbjct: 385 PISDVCRKFQPVPQLLKNVRTTGGKPLENKRVKSAIDEAKERLGGQGRLVIRPSGTEPLI 444

Query: 421 RIMAEGDDLSRIKRIVDDLAKVIP 444
           R+MAEGDD   ++++V+D+  VI 
Sbjct: 445 RVMAEGDDRGLVEKVVNDIIDVIS 468


>gi|265991726|ref|ZP_06104283.1| phosphoglucosamine mutase [Brucella melitensis bv. 1 str. Rev.1]
 gi|265995563|ref|ZP_06108120.1| phosphoglucosamine mutase [Brucella melitensis bv. 3 str. Ether]
 gi|265999344|ref|ZP_05465894.2| phosphoglucosamine mutase [Brucella melitensis bv. 2 str. 63/9]
 gi|84029238|sp|Q8YIU8|GLMM_BRUME RecName: Full=Phosphoglucosamine mutase
 gi|262766847|gb|EEZ12465.1| phosphoglucosamine mutase [Brucella melitensis bv. 3 str. Ether]
 gi|263002682|gb|EEZ15085.1| phosphoglucosamine mutase [Brucella melitensis bv. 1 str. Rev.1]
 gi|263093361|gb|EEZ17430.1| phosphoglucosamine mutase [Brucella melitensis bv. 2 str. 63/9]
 gi|326539411|gb|ADZ87626.1| phosphoglucosamine mutase [Brucella melitensis M5-90]
          Length = 451

 Score =  287 bits (733), Expect = 3e-75,   Method: Composition-based stats.
 Identities = 269/444 (60%), Positives = 351/444 (79%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M R+FFGTDGIRG++N+FP+TP   M++G+AVGY+FR K +  R VIGKDTR SGYMLEN
Sbjct: 1   MTRKFFGTDGIRGQANSFPMTPEIAMKVGMAVGYIFRRKGQASRAVIGKDTRRSGYMLEN 60

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +LVAGFTAAGMD F+LGPIP+PAVAML RSLRAD+GVMISASHNP+ DNGIKLFGPDG+K
Sbjct: 61  ALVAGFTAAGMDVFLLGPIPTPAVAMLCRSLRADIGVMISASHNPFYDNGIKLFGPDGFK 120

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +S  IE +IE ++E D+T +L+ +  +G AKRVDG   RYIE  KRTLPR+++L GLR+V
Sbjct: 121 LSDQIELQIEAMIEGDMTPFLASHGDVGRAKRVDGDIYRYIEFAKRTLPRNISLNGLRVV 180

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           VDCANGA YKVAP   WELGA+V+ I ++PNGININ DCGST+ + L +KVH VRAD+GI
Sbjct: 181 VDCANGAGYKVAPAALWELGAEVITINNEPNGININEDCGSTHPIGLMKKVHGVRADVGI 240

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           ALDGD DRV++VDE G +++GDQ+MA+IA  W + + L G GIV TVMSN+GLERF+A  
Sbjct: 241 ALDGDADRVLLVDENGTVIDGDQLMAVIAESWAASNRLEGGGIVATVMSNLGLERFLADR 300

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
            L+L RT+VGDRY++E+M+ +GFNVGGEQSGHI+LSD+ +TGDGL++ALQ+L   ++ +K
Sbjct: 301 NLTLARTKVGDRYVVEHMREHGFNVGGEQSGHIVLSDFATTGDGLISALQILAVAQEQNK 360

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
           P+S +C  F+  PQ L++V       L +  +  AI +A+  L G  RL++R SGTE LI
Sbjct: 361 PISDVCRKFQPVPQLLKNVRTTGGKPLENKRVKSAIDEAKERLGGQGRLVIRPSGTEPLI 420

Query: 421 RIMAEGDDLSRIKRIVDDLAKVIP 444
           R+MAEGDD   ++++V+D+  VI 
Sbjct: 421 RVMAEGDDRGLVEKVVNDIIDVIS 444


>gi|237816068|ref|ZP_04595064.1| phosphoglucosamine mutase [Brucella abortus str. 2308 A]
 gi|237788731|gb|EEP62943.1| phosphoglucosamine mutase [Brucella abortus str. 2308 A]
          Length = 475

 Score =  286 bits (732), Expect = 3e-75,   Method: Composition-based stats.
 Identities = 268/444 (60%), Positives = 351/444 (79%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M R+FFGTDGIRG++N+FP+TP   M++G+AVGY+FR K +  R V+GKDTR SGYMLE 
Sbjct: 25  MTRKFFGTDGIRGQANSFPMTPEIAMKVGMAVGYIFRRKGQASRAVVGKDTRRSGYMLEK 84

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +LVAGFTAAGMD F+LGPIP+PAVAML RSLRAD+GVMISASHNP+ DNGIKLFGPDG+K
Sbjct: 85  ALVAGFTAAGMDVFLLGPIPTPAVAMLCRSLRADIGVMISASHNPFYDNGIKLFGPDGFK 144

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +S  IE +IE ++E D+T +L+ +  +G AKRVDG   RYIE  KRTLPR+++L GLR+V
Sbjct: 145 LSDQIELQIEAMIEGDMTPFLASHGDVGRAKRVDGDIYRYIEFAKRTLPRNISLNGLRVV 204

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           VDCANGA YKVAP   WELGA+V+ I ++PNGININ DCGST+ + L +KVHEVRAD+GI
Sbjct: 205 VDCANGAGYKVAPAALWELGAEVITINNEPNGININEDCGSTHPIGLMKKVHEVRADVGI 264

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           ALDGD DRV++VDE G +++GDQ+MA+IA  W + + L G GIV TVMSN+GLERF+A  
Sbjct: 265 ALDGDADRVLLVDENGTVIDGDQLMAVIAESWAASNRLEGGGIVATVMSNLGLERFLADR 324

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
            L+L RT+VGDRY++E+M+ +GFNVGGEQSGHI+LSD+ +TGDGL++ALQ+L   ++ +K
Sbjct: 325 NLTLARTKVGDRYVVEHMREHGFNVGGEQSGHIVLSDFATTGDGLISALQILAVAQEQNK 384

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
           P+S +C  F+  PQ L++V       L +  +  AI +A+  L G  RL++R SGTE LI
Sbjct: 385 PISDVCRKFQPVPQLLKNVRTTGGKPLENKRVKSAIDEAKERLGGQGRLVIRPSGTEPLI 444

Query: 421 RIMAEGDDLSRIKRIVDDLAKVIP 444
           R+MAEGDD   ++++V+D+  VI 
Sbjct: 445 RVMAEGDDRGLVEKVVNDIIDVIS 468


>gi|189024782|ref|YP_001935550.1| phosphoglucosamine mutase [Brucella abortus S19]
 gi|254689859|ref|ZP_05153113.1| Phosphoglucosamine mutase [Brucella abortus bv. 6 str. 870]
 gi|254730894|ref|ZP_05189472.1| Phosphoglucosamine mutase [Brucella abortus bv. 4 str. 292]
 gi|256258113|ref|ZP_05463649.1| Phosphoglucosamine mutase [Brucella abortus bv. 9 str. C68]
 gi|297248961|ref|ZP_06932669.1| phosphoglucosamine mutase [Brucella abortus bv. 5 str. B3196]
 gi|189020354|gb|ACD73076.1| Phosphoglucosamine mutase [Brucella abortus S19]
 gi|297174094|gb|EFH33451.1| phosphoglucosamine mutase [Brucella abortus bv. 5 str. B3196]
          Length = 459

 Score =  286 bits (732), Expect = 3e-75,   Method: Composition-based stats.
 Identities = 268/444 (60%), Positives = 351/444 (79%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M R+FFGTDGIRG++N+FP+TP   M++G+AVGY+FR K +  R V+GKDTR SGYMLE 
Sbjct: 9   MTRKFFGTDGIRGQANSFPMTPEIAMKVGMAVGYIFRRKGQASRAVVGKDTRRSGYMLEK 68

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +LVAGFTAAGMD F+LGPIP+PAVAML RSLRAD+GVMISASHNP+ DNGIKLFGPDG+K
Sbjct: 69  ALVAGFTAAGMDVFLLGPIPTPAVAMLCRSLRADIGVMISASHNPFYDNGIKLFGPDGFK 128

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +S  IE +IE ++E D+T +L+ +  +G AKRVDG   RYIE  KRTLPR+++L GLR+V
Sbjct: 129 LSDQIELQIEAMIEGDMTPFLASHGDVGRAKRVDGDIYRYIEFAKRTLPRNISLNGLRVV 188

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           VDCANGA YKVAP   WELGA+V+ I ++PNGININ DCGST+ + L +KVHEVRAD+GI
Sbjct: 189 VDCANGAGYKVAPAALWELGAEVITINNEPNGININEDCGSTHPIGLMKKVHEVRADVGI 248

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           ALDGD DRV++VDE G +++GDQ+MA+IA  W + + L G GIV TVMSN+GLERF+A  
Sbjct: 249 ALDGDADRVLLVDENGTVIDGDQLMAVIAESWAASNRLEGGGIVATVMSNLGLERFLADR 308

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
            L+L RT+VGDRY++E+M+ +GFNVGGEQSGHI+LSD+ +TGDGL++ALQ+L   ++ +K
Sbjct: 309 NLTLARTKVGDRYVVEHMREHGFNVGGEQSGHIVLSDFATTGDGLISALQILAVAQEQNK 368

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
           P+S +C  F+  PQ L++V       L +  +  AI +A+  L G  RL++R SGTE LI
Sbjct: 369 PISDVCRKFQPVPQLLKNVRTTGGKPLENKRVKSAIDEAKERLGGQGRLVIRPSGTEPLI 428

Query: 421 RIMAEGDDLSRIKRIVDDLAKVIP 444
           R+MAEGDD   ++++V+D+  VI 
Sbjct: 429 RVMAEGDDRGLVEKVVNDIIDVIS 452


>gi|62290562|ref|YP_222355.1| phosphoglucosamine mutase [Brucella abortus bv. 1 str. 9-941]
 gi|82700478|ref|YP_415052.1| phosphoglucosamine mutase [Brucella melitensis biovar Abortus 2308]
 gi|260547193|ref|ZP_05822931.1| phosphoglucosamine mutase [Brucella abortus NCTC 8038]
 gi|260755390|ref|ZP_05867738.1| phosphoglucosamine mutase [Brucella abortus bv. 6 str. 870]
 gi|260758611|ref|ZP_05870959.1| phosphoglucosamine mutase [Brucella abortus bv. 4 str. 292]
 gi|260884406|ref|ZP_05896020.1| phosphoglucosamine mutase [Brucella abortus bv. 9 str. C68]
 gi|75496350|sp|Q57BJ0|GLMM_BRUAB RecName: Full=Phosphoglucosamine mutase
 gi|123547190|sp|Q2YQH8|GLMM_BRUA2 RecName: Full=Phosphoglucosamine mutase
 gi|62196694|gb|AAX74994.1| GlmM, phosphoglucosamine mutase [Brucella abortus bv. 1 str. 9-941]
 gi|82616579|emb|CAJ11658.1| Phosphoglucomutase/phosphomannomutase:Phosphoglucomutase/phosphoman
           nomutase C
           terminal:Phosphoglucomutase/phosphomannomutase [Brucella
           melitensis biovar Abortus 2308]
 gi|260095558|gb|EEW79436.1| phosphoglucosamine mutase [Brucella abortus NCTC 8038]
 gi|260668929|gb|EEX55869.1| phosphoglucosamine mutase [Brucella abortus bv. 4 str. 292]
 gi|260675498|gb|EEX62319.1| phosphoglucosamine mutase [Brucella abortus bv. 6 str. 870]
 gi|260873934|gb|EEX81003.1| phosphoglucosamine mutase [Brucella abortus bv. 9 str. C68]
          Length = 451

 Score =  286 bits (732), Expect = 3e-75,   Method: Composition-based stats.
 Identities = 268/444 (60%), Positives = 351/444 (79%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M R+FFGTDGIRG++N+FP+TP   M++G+AVGY+FR K +  R V+GKDTR SGYMLE 
Sbjct: 1   MTRKFFGTDGIRGQANSFPMTPEIAMKVGMAVGYIFRRKGQASRAVVGKDTRRSGYMLEK 60

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +LVAGFTAAGMD F+LGPIP+PAVAML RSLRAD+GVMISASHNP+ DNGIKLFGPDG+K
Sbjct: 61  ALVAGFTAAGMDVFLLGPIPTPAVAMLCRSLRADIGVMISASHNPFYDNGIKLFGPDGFK 120

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +S  IE +IE ++E D+T +L+ +  +G AKRVDG   RYIE  KRTLPR+++L GLR+V
Sbjct: 121 LSDQIELQIEAMIEGDMTPFLASHGDVGRAKRVDGDIYRYIEFAKRTLPRNISLNGLRVV 180

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           VDCANGA YKVAP   WELGA+V+ I ++PNGININ DCGST+ + L +KVHEVRAD+GI
Sbjct: 181 VDCANGAGYKVAPAALWELGAEVITINNEPNGININEDCGSTHPIGLMKKVHEVRADVGI 240

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           ALDGD DRV++VDE G +++GDQ+MA+IA  W + + L G GIV TVMSN+GLERF+A  
Sbjct: 241 ALDGDADRVLLVDENGTVIDGDQLMAVIAESWAASNRLEGGGIVATVMSNLGLERFLADR 300

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
            L+L RT+VGDRY++E+M+ +GFNVGGEQSGHI+LSD+ +TGDGL++ALQ+L   ++ +K
Sbjct: 301 NLTLARTKVGDRYVVEHMREHGFNVGGEQSGHIVLSDFATTGDGLISALQILAVAQEQNK 360

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
           P+S +C  F+  PQ L++V       L +  +  AI +A+  L G  RL++R SGTE LI
Sbjct: 361 PISDVCRKFQPVPQLLKNVRTTGGKPLENKRVKSAIDEAKERLGGQGRLVIRPSGTEPLI 420

Query: 421 RIMAEGDDLSRIKRIVDDLAKVIP 444
           R+MAEGDD   ++++V+D+  VI 
Sbjct: 421 RVMAEGDDRGLVEKVVNDIIDVIS 444


>gi|297539171|ref|YP_003674940.1| phosphoglucosamine mutase [Methylotenera sp. 301]
 gi|297258518|gb|ADI30363.1| phosphoglucosamine mutase [Methylotenera sp. 301]
          Length = 451

 Score =  286 bits (732), Expect = 4e-75,   Method: Composition-based stats.
 Identities = 210/454 (46%), Positives = 297/454 (65%), Gaps = 9/454 (1%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFR------GKKKHRRVVIGKDTRLS 54
           M +++FGTDGIRGK    PITP+F+MR+G A G +         K  H  V+IGKDTR+S
Sbjct: 1   MSKKYFGTDGIRGKVGEHPITPDFVMRLGYAAGKVLTSVNNNLAKGAHPAVLIGKDTRIS 60

Query: 55  GYMLENSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLF 114
           GYMLE +L AG +AAG+D  + GP+P+PAVA LTR+LRA  G++ISASHNP+ DNGIK F
Sbjct: 61  GYMLEAALEAGLSAAGVDVLLTGPMPTPAVAYLTRALRAQAGIVISASHNPFYDNGIKFF 120

Query: 115 GPDGYKVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTL 174
             +G K+  DIE  IE  LE  +   +     +G A+R+D    RYIE  K T P D+ L
Sbjct: 121 SSEGAKLPDDIEHAIEAELEKPM--QVMESAKLGKARRIDDAAGRYIEFCKSTFPNDLDL 178

Query: 175 QGLRIVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEV 234
           +GL+IV+DCA+GA+Y VAP VF ELGA++V IG+KP+G+NIN   GST+  +LQ+ V E 
Sbjct: 179 RGLKIVLDCAHGATYHVAPNVFHELGAEIVCIGNKPDGLNINEQVGSTHPQALQKAVLEY 238

Query: 235 RADIGIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLE 294
           +AD+GIA DGDGDRV++VD +G +++GDQ++ +IA    +   L G    T  M+N+ LE
Sbjct: 239 QADLGIAFDGDGDRVMMVDAQGNLLDGDQLLYIIAIGLHAVGGLNGGIAGTL-MTNLALE 297

Query: 295 RFIAGLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRY 354
                  +   R +VGDRY++E +  N + +GGE SGHI+  D  ++GD ++AALQVL  
Sbjct: 298 HAFDKHQIPFARAKVGDRYVLELLNENNWKLGGENSGHILTLDKHTSGDAIIAALQVLHV 357

Query: 355 IKQYDKPVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRAS 414
           +KQ  K ++ +      YPQ L +V+ K    L    I  A+  AE+EL G  R+++RAS
Sbjct: 358 LKQSGKTLTQMNAELVLYPQVLINVTTKTKLNLEIPQIQNAVKKAENELNGAGRVLLRAS 417

Query: 415 GTESLIRIMAEGDDLSRIKRIVDDLAKVIPMIDS 448
           GTE  IR+M EG D   ++++ +++A+V+    S
Sbjct: 418 GTEPKIRVMVEGQDNFLVQKLAEEIAEVVRAAAS 451


>gi|154252578|ref|YP_001413402.1| phosphoglucosamine mutase [Parvibaculum lavamentivorans DS-1]
 gi|171769605|sp|A7HV12|GLMM_PARL1 RecName: Full=Phosphoglucosamine mutase
 gi|154156528|gb|ABS63745.1| phosphoglucosamine mutase [Parvibaculum lavamentivorans DS-1]
          Length = 448

 Score =  286 bits (732), Expect = 4e-75,   Method: Composition-based stats.
 Identities = 259/444 (58%), Positives = 329/444 (74%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M R++FGTDGIRG +NT  +T    +R+G+A G +FR  +   RVVIGKDTRLSGYMLE 
Sbjct: 1   MPRKYFGTDGIRGTANTGHMTAETALRVGMAAGRVFRRGEHRHRVVIGKDTRLSGYMLEP 60

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +L AGFT+ GMD F+ GP+P+PAVAMLTRSLRAD+GVMISASHN ++DNGIKLFGPDG+K
Sbjct: 61  ALTAGFTSMGMDVFLFGPLPTPAVAMLTRSLRADLGVMISASHNSFEDNGIKLFGPDGFK 120

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +S ++E  IE  +++ L   L+    +G AKR++    RYIEHVK T P+  TL+GLRIV
Sbjct: 121 LSDEVELAIEHHMDNGLADNLAGSRGLGRAKRIEDAQARYIEHVKHTFPKQQTLEGLRIV 180

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           +DCANGA+YKVAPEV WELGA+VV +G +PNG NIN DCGST    +   V E RADIGI
Sbjct: 181 IDCANGAAYKVAPEVLWELGAEVVTVGTEPNGFNINEDCGSTAPERMCAAVLERRADIGI 240

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           ALDGD DRVII DE+G +++GDQIM L+AR W     L   GIV TVMSN+GLER++  L
Sbjct: 241 ALDGDADRVIIADERGKVIDGDQIMGLVARHWKEMGTLSAPGIVATVMSNLGLERYLGSL 300

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           GL L RT+VGDRY++E+M+ +G+NVGGEQSGHI+L D+ +TGDGL+AALQVL  +K  DK
Sbjct: 301 GLDLVRTQVGDRYVVEHMREHGYNVGGEQSGHIVLKDFSTTGDGLIAALQVLAVLKAGDK 360

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
           PVS ICH F+  PQ L+++  K    L    + +AI + ES L    RL++R SGTE LI
Sbjct: 361 PVSEICHLFDPLPQLLKNIRFKRGEPLKDKDVQEAIREGESRLGKTGRLVIRKSGTEPLI 420

Query: 421 RIMAEGDDLSRIKRIVDDLAKVIP 444
           R+M EGDD   +  +V+D+A VI 
Sbjct: 421 RVMGEGDDEKLVTSVVNDIAAVIE 444


>gi|319407715|emb|CBI81363.1| phosphoglucomutase/phosphomannomutasefamily protein MrsA
           [Bartonella sp. 1-1C]
          Length = 451

 Score =  286 bits (732), Expect = 4e-75,   Method: Composition-based stats.
 Identities = 272/448 (60%), Positives = 349/448 (77%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M R++FGTDGIRGK+N FP+TP+F M+IG+AVG LFR K++  RVVIGKDTRLSGYMLEN
Sbjct: 1   MARKYFGTDGIRGKANLFPMTPDFAMKIGMAVGVLFRTKEQSHRVVIGKDTRLSGYMLEN 60

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +LV+G TAAGMD F+LGP+P+PAVAML RSLRAD+GVMISASHNP+ DNGIKLFGPDG+K
Sbjct: 61  ALVSGLTAAGMDVFLLGPVPTPAVAMLCRSLRADLGVMISASHNPFYDNGIKLFGPDGFK 120

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +S +IE +IE L+E DL   L+    IG AKRV+G   RYIE+ KRTLPRDV L  LRIV
Sbjct: 121 LSDEIEIKIEQLVEKDLLHSLAEASEIGRAKRVEGDIYRYIEYAKRTLPRDVRLDSLRIV 180

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           VDCANGA+YK AP   WELGA+V  I ++P G+NIN  CGST++ SL+RKVHEVRAD+GI
Sbjct: 181 VDCANGATYKAAPRALWELGAEVFAINNEPTGLNINQKCGSTDLTSLKRKVHEVRADVGI 240

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           ALDGDGDRVI+VDEK   ++GDQI+A+IA  W     L+ NG+V ++MSN+GLERF+   
Sbjct: 241 ALDGDGDRVIMVDEKAQTIDGDQIIAVIAEHWYKTERLQRNGVVASIMSNLGLERFLNNK 300

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           GL L RT VGDRY+++ M+  G+NVGGE SGHI+LSD+G+TGDGLVAALQ+L  +++   
Sbjct: 301 GLELIRTNVGDRYVVDAMRQKGYNVGGEASGHIVLSDFGTTGDGLVAALQILACMQESQV 360

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
           P+S +C  FE  PQ L+++++K+  IL ++ +  AI  A+  L    RL++R SGTE LI
Sbjct: 361 PMSQLCQRFESVPQILKNIAIKNKKILQNTKVKTAINQAQKRLGKEVRLVIRPSGTEPLI 420

Query: 421 RIMAEGDDLSRIKRIVDDLAKVIPMIDS 448
           R+MAEGDD   I+ +V +++ V+   DS
Sbjct: 421 RVMAEGDDQKVIEEVVAEISTVLVQHDS 448


>gi|253999577|ref|YP_003051640.1| phosphoglucosamine mutase [Methylovorus sp. SIP3-4]
 gi|253986256|gb|ACT51113.1| phosphoglucosamine mutase [Methylovorus sp. SIP3-4]
          Length = 452

 Score =  286 bits (731), Expect = 5e-75,   Method: Composition-based stats.
 Identities = 213/452 (47%), Positives = 302/452 (66%), Gaps = 10/452 (2%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRG------KKKHRRVVIGKDTRLS 54
           M R++FGTDGIRG+    PITP+F+MR+G A G +  G      K  H  V+IGKDTR+S
Sbjct: 1   MTRKYFGTDGIRGRVGDAPITPDFVMRLGYAAGRVLTGLDSHLAKDAHPTVLIGKDTRIS 60

Query: 55  GYMLENSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLF 114
           GYMLE++L AG +AAG+D  + GP+P+PAVA LTR+LRA  G++ISASHNP++DNGIK F
Sbjct: 61  GYMLESALQAGLSAAGVDVLLTGPMPTPAVAYLTRALRAQAGIVISASHNPFEDNGIKFF 120

Query: 115 GPDGYKVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTL 174
             +G K+  ++E  IE  L+  L   +     +G AKR+     RYIE  K T P  + L
Sbjct: 121 SAEGTKLPDEVELAIEAALDQPL--QVMPSAGLGKAKRITDAAGRYIEFCKSTFPAALDL 178

Query: 175 QGLRIVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEV 234
           +GLRIV+DCANGA+Y VAP VF ELGA++V IG +P+G+NINLDCGST+  +L R V E 
Sbjct: 179 RGLRIVLDCANGATYHVAPPVFHELGAEIVTIGYQPDGLNINLDCGSTHPQALCRAVIEH 238

Query: 235 RADIGIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLE 294
           +AD+GIA DGDGDRV++VD +G +++GDQ++ +IA            G+V T+M+N+ LE
Sbjct: 239 KADLGIAFDGDGDRVVMVDSQGRLLDGDQLLYIIA-MQRKQRGRLEGGVVGTLMTNLALE 297

Query: 295 RFIAGLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRY 354
             +A   +   R +VGDRY++E +    + +GGE SGHI+  D  S+GDG++AALQVL  
Sbjct: 298 HALAKADIPFLRAKVGDRYVLELLNEQDWQLGGENSGHILCLDKHSSGDGIIAALQVLHA 357

Query: 355 IKQYDKPVSTICHCFEEYPQFLRSVSVKDTSILNSS-SIVQAIADAESELRGIDRLIVRA 413
           ++     + T+      YPQ L +V V     L +  +I QA+ADAE +L+G  R+++R 
Sbjct: 358 MRTAGCSLDTLGAGLTLYPQVLINVKVAGKVDLAAQPAIQQAVADAEQKLQGRGRVLLRP 417

Query: 414 SGTESLIRIMAEGDDLSRIKRIVDDLAKVIPM 445
           SGTE  IR+M EG+D + ++R+ + +A V+  
Sbjct: 418 SGTEPKIRVMVEGEDGALVQRLAEQIATVVQA 449


>gi|313201612|ref|YP_004040270.1| phosphoglucosamine mutase [Methylovorus sp. MP688]
 gi|312440928|gb|ADQ85034.1| phosphoglucosamine mutase [Methylovorus sp. MP688]
          Length = 452

 Score =  286 bits (730), Expect = 7e-75,   Method: Composition-based stats.
 Identities = 213/452 (47%), Positives = 302/452 (66%), Gaps = 10/452 (2%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRG------KKKHRRVVIGKDTRLS 54
           M R++FGTDGIRG+    PITP+F+MR+G A G +  G      K  H  V+IGKDTR+S
Sbjct: 1   MTRKYFGTDGIRGRVGDAPITPDFVMRLGYAAGRVLTGLDSHLAKDAHPTVLIGKDTRIS 60

Query: 55  GYMLENSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLF 114
           GYMLE++L AG +AAG+D  + GP+P+PAVA LTR+LRA  G++ISASHNP++DNGIK F
Sbjct: 61  GYMLESALQAGLSAAGVDVLLTGPMPTPAVAYLTRALRAQAGIVISASHNPFEDNGIKFF 120

Query: 115 GPDGYKVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTL 174
             +G K+  ++E  IE  L+  L   +     +G AKR+     RYIE  K T P  + L
Sbjct: 121 SAEGTKLPDEVELAIEAALDQPL--QVMPSAGLGKAKRITDAAGRYIEFCKSTFPAALDL 178

Query: 175 QGLRIVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEV 234
           +GLRIV+DCANGA+Y VAP VF ELGA++V IG +P+G+NINLDCGST+  +L R V E 
Sbjct: 179 RGLRIVLDCANGATYHVAPPVFHELGAEIVTIGYQPDGLNINLDCGSTHPQALCRAVIEH 238

Query: 235 RADIGIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLE 294
           +AD+GIA DGDGDRV++VD +G +++GDQ++ +IA            G+V T+M+N+ LE
Sbjct: 239 KADLGIAFDGDGDRVVMVDSQGRLLDGDQLLYIIA-MQRKQRGRLDGGVVGTLMTNLALE 297

Query: 295 RFIAGLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRY 354
             +A   +   R +VGDRY++E +    + +GGE SGHI+  D  S+GDG++AALQVL  
Sbjct: 298 HALAKADIPFLRAKVGDRYVLELLNEQDWQLGGENSGHILCLDKHSSGDGIIAALQVLHA 357

Query: 355 IKQYDKPVSTICHCFEEYPQFLRSVSVKDTSILNSS-SIVQAIADAESELRGIDRLIVRA 413
           ++     + T+      YPQ L +V V     L +  +I QA+ADAE +L+G  R+++R 
Sbjct: 358 MRTAGCSLDTLGAGLTLYPQVLINVKVAGKVDLAAQPAIQQAVADAEQQLQGRGRVLLRP 417

Query: 414 SGTESLIRIMAEGDDLSRIKRIVDDLAKVIPM 445
           SGTE  IR+M EG+D + ++R+ + +A V+  
Sbjct: 418 SGTEPKIRVMVEGEDGALVQRLAEQIATVVQA 449


>gi|265998774|ref|ZP_06111331.1| phosphoglucosamine mutase [Brucella ceti M490/95/1]
 gi|262553463|gb|EEZ09232.1| phosphoglucosamine mutase [Brucella ceti M490/95/1]
          Length = 455

 Score =  284 bits (727), Expect = 1e-74,   Method: Composition-based stats.
 Identities = 271/448 (60%), Positives = 353/448 (78%), Gaps = 4/448 (0%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M R+FFGTDGIRG++N+FP+TP   M++G+AVGY+FR K +  RVVIGKDTR SGYMLEN
Sbjct: 1   MTRKFFGTDGIRGQANSFPMTPEIAMKVGMAVGYIFRRKGQASRVVIGKDTRRSGYMLEN 60

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +LVAGFTAAGMD F+LGPIP+PAVAML RSLRAD+GVMISASHNP+ DNGIKLFGPDG+K
Sbjct: 61  ALVAGFTAAGMDVFLLGPIPTPAVAMLCRSLRADIGVMISASHNPFYDNGIKLFGPDGFK 120

Query: 121 VST----DIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQG 176
           +S      IE +IE ++E D+T +L+ +  +G AKRVDG   RYIE  KRTLPR+++L G
Sbjct: 121 LSDQIELQIELQIEAMIEGDMTPFLASHGDVGRAKRVDGDIYRYIEFAKRTLPRNISLNG 180

Query: 177 LRIVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRA 236
           LR+VVDCANGA YKVAP   WELGA+V+ I ++PNGININ DCGST+ + L +KVHEVRA
Sbjct: 181 LRVVVDCANGAVYKVAPAALWELGAEVITINNEPNGININEDCGSTHPIGLMKKVHEVRA 240

Query: 237 DIGIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERF 296
           D+GIALDGD DRV++VDE G +++GDQ+MA+IA  W + + L G GIV TVMSN+GLERF
Sbjct: 241 DVGIALDGDADRVLLVDENGTVIDGDQLMAVIAESWAASNRLEGGGIVATVMSNLGLERF 300

Query: 297 IAGLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIK 356
           +A   L+L RT+VGDRY++E+M+ +GFNVGGEQSGHI+LSD+ +TGDGL++ALQ+L   +
Sbjct: 301 LADRNLTLARTKVGDRYVVEHMREHGFNVGGEQSGHIVLSDFATTGDGLISALQILAVAQ 360

Query: 357 QYDKPVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGT 416
           + +KP+S +C  F+  PQ L++V       L +  +  AI +A+  L G  RL++R SGT
Sbjct: 361 EQNKPISDVCRKFQPVPQLLKNVRTTGGKPLENKRVKSAIDEAKERLGGQGRLVIRPSGT 420

Query: 417 ESLIRIMAEGDDLSRIKRIVDDLAKVIP 444
           E LIR+MAEGDD   ++++V+D+  VI 
Sbjct: 421 EPLIRVMAEGDDRGLVEKVVNDIIDVIS 448


>gi|256160406|ref|ZP_05458095.1| phosphoglucosamine mutase [Brucella ceti M490/95/1]
 gi|256255612|ref|ZP_05461148.1| phosphoglucosamine mutase [Brucella ceti B1/94]
 gi|261222815|ref|ZP_05937096.1| phosphoglucosamine mutase [Brucella ceti B1/94]
 gi|260921399|gb|EEX88052.1| phosphoglucosamine mutase [Brucella ceti B1/94]
          Length = 463

 Score =  284 bits (727), Expect = 1e-74,   Method: Composition-based stats.
 Identities = 271/448 (60%), Positives = 353/448 (78%), Gaps = 4/448 (0%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M R+FFGTDGIRG++N+FP+TP   M++G+AVGY+FR K +  RVVIGKDTR SGYMLEN
Sbjct: 9   MTRKFFGTDGIRGQANSFPMTPEIAMKVGMAVGYIFRRKGQASRVVIGKDTRRSGYMLEN 68

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +LVAGFTAAGMD F+LGPIP+PAVAML RSLRAD+GVMISASHNP+ DNGIKLFGPDG+K
Sbjct: 69  ALVAGFTAAGMDVFLLGPIPTPAVAMLCRSLRADIGVMISASHNPFYDNGIKLFGPDGFK 128

Query: 121 VST----DIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQG 176
           +S      IE +IE ++E D+T +L+ +  +G AKRVDG   RYIE  KRTLPR+++L G
Sbjct: 129 LSDQIELQIELQIEAMIEGDMTPFLASHGDVGRAKRVDGDIYRYIEFAKRTLPRNISLNG 188

Query: 177 LRIVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRA 236
           LR+VVDCANGA YKVAP   WELGA+V+ I ++PNGININ DCGST+ + L +KVHEVRA
Sbjct: 189 LRVVVDCANGAVYKVAPAALWELGAEVITINNEPNGININEDCGSTHPIGLMKKVHEVRA 248

Query: 237 DIGIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERF 296
           D+GIALDGD DRV++VDE G +++GDQ+MA+IA  W + + L G GIV TVMSN+GLERF
Sbjct: 249 DVGIALDGDADRVLLVDENGTVIDGDQLMAVIAESWAASNRLEGGGIVATVMSNLGLERF 308

Query: 297 IAGLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIK 356
           +A   L+L RT+VGDRY++E+M+ +GFNVGGEQSGHI+LSD+ +TGDGL++ALQ+L   +
Sbjct: 309 LADRNLTLARTKVGDRYVVEHMREHGFNVGGEQSGHIVLSDFATTGDGLISALQILAVAQ 368

Query: 357 QYDKPVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGT 416
           + +KP+S +C  F+  PQ L++V       L +  +  AI +A+  L G  RL++R SGT
Sbjct: 369 EQNKPISDVCRKFQPVPQLLKNVRTTGGKPLENKRVKSAIDEAKERLGGQGRLVIRPSGT 428

Query: 417 ESLIRIMAEGDDLSRIKRIVDDLAKVIP 444
           E LIR+MAEGDD   ++++V+D+  VI 
Sbjct: 429 EPLIRVMAEGDDRGLVEKVVNDIIDVIS 456


>gi|159185870|ref|NP_356911.2| phosphoglucomutase/phosphomannomutase [Agrobacterium tumefaciens
           str. C58]
 gi|84029233|sp|Q8U9L9|GLMM_AGRT5 RecName: Full=Phosphoglucosamine mutase
 gi|159141004|gb|AAK89696.2| phosphoglucomutase/phosphomannomutase [Agrobacterium tumefaciens
           str. C58]
          Length = 450

 Score =  284 bits (725), Expect = 2e-74,   Method: Composition-based stats.
 Identities = 298/448 (66%), Positives = 362/448 (80%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M RR+FGTDGIRG+SN FP+TP+  MR+GIAVG +FR      RVVIGKDTRLSGYMLEN
Sbjct: 1   MARRYFGTDGIRGQSNVFPMTPDLAMRVGIAVGTIFRRGHHRHRVVIGKDTRLSGYMLEN 60

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +LVAGFTAAG+D F+LGPIP+PAVAMLTRSLRAD+GVMISASHNP+ DNGIKLFGPDGYK
Sbjct: 61  ALVAGFTAAGLDVFLLGPIPTPAVAMLTRSLRADIGVMISASHNPFSDNGIKLFGPDGYK 120

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +S ++E  IE LL+ D+ + L+    IG AKRVDG   RYIE VKRTLPRDVTL GLRI 
Sbjct: 121 LSDELELEIEDLLDKDIYAQLAKPAEIGRAKRVDGDIYRYIEFVKRTLPRDVTLSGLRIA 180

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           +DCANGA+YKVAP   WELGA+VV IG++PNGININL+CGST+  +LQ+K+HEVRADIGI
Sbjct: 181 IDCANGAAYKVAPAALWELGAEVVTIGNEPNGININLECGSTHPEALQKKLHEVRADIGI 240

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           ALDGD DRVIIVDE+G IV+GDQ+MA+IA  W + + LRG GIV TVMSN+GLERF+   
Sbjct: 241 ALDGDADRVIIVDERGEIVDGDQLMAVIADSWAADNTLRGGGIVATVMSNLGLERFLGDK 300

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           GL+L RT+VGDRY++E+M+N+ FNVGGEQSGHI+LSDYG+TGDGLVAALQVL  +K+   
Sbjct: 301 GLTLARTKVGDRYVVEHMRNHNFNVGGEQSGHIVLSDYGTTGDGLVAALQVLAKVKRSGL 360

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
            VS +C  FE  PQ L++V +     L +  ++QAIADAES L    RL++R SGTE LI
Sbjct: 361 TVSEVCRKFEPVPQLLKNVRISGGKPLENPIVLQAIADAESALANNGRLVIRPSGTEPLI 420

Query: 421 RIMAEGDDLSRIKRIVDDLAKVIPMIDS 448
           R+MAEGDD +++++IV+DL  VI    S
Sbjct: 421 RVMAEGDDSAKVEKIVNDLVGVISSARS 448


>gi|319781034|ref|YP_004140510.1| phosphoglucosamine mutase [Mesorhizobium ciceri biovar biserrulae
           WSM1271]
 gi|317166922|gb|ADV10460.1| phosphoglucosamine mutase [Mesorhizobium ciceri biovar biserrulae
           WSM1271]
          Length = 450

 Score =  284 bits (725), Expect = 3e-74,   Method: Composition-based stats.
 Identities = 276/445 (62%), Positives = 341/445 (76%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M   +FGTDGIRG++N FP+T    MR+G+A G  F+      RVV+GKDTRLSGYM+EN
Sbjct: 1   MAGNYFGTDGIRGRANKFPMTAEIAMRVGMAAGLSFQRGSHRHRVVLGKDTRLSGYMIEN 60

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           ++VAG  AAGMD F+LGPIP+PAVAML RSLRAD+GVMISASHNPY DNGIKLFGPDGYK
Sbjct: 61  AMVAGLCAAGMDVFLLGPIPTPAVAMLVRSLRADIGVMISASHNPYYDNGIKLFGPDGYK 120

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +S +IE+RIE++L+ D+   L+  D +G AKRVDGVHDRYIE  KRTLPR ++L GLRIV
Sbjct: 121 LSDEIEERIESMLDRDIELALADSDGLGRAKRVDGVHDRYIEFAKRTLPRSMSLAGLRIV 180

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           VDCANGA+YKVAPE  WELGA+VV I  +PNG NIN +CGST+   LQ+KVHEVRADIGI
Sbjct: 181 VDCANGAAYKVAPEALWELGAEVVAINVEPNGFNINKECGSTHPAGLQKKVHEVRADIGI 240

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           ALDGD DRV+IVDE GAIV+GDQIMALIA  W     L G G+V+TVMSN+GLERF+  +
Sbjct: 241 ALDGDADRVVIVDENGAIVDGDQIMALIAESWHQSGRLAGGGVVSTVMSNLGLERFLGDM 300

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
            L L RT+VGDRY++E+M+ +G NVGGEQSGHI+LSD+ +TGDGLV+ALQVL  IK+  +
Sbjct: 301 KLQLHRTKVGDRYVVEHMRAHGLNVGGEQSGHIVLSDFSTTGDGLVSALQVLACIKRQGR 360

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
           PVS +   FE  PQ L++V +     L  + +  AI DA S L    RL++R SGTE LI
Sbjct: 361 PVSELSKKFEPVPQLLKNVHISGGKPLEEAPVKAAIEDARSRLGKTGRLVIRPSGTEPLI 420

Query: 421 RIMAEGDDLSRIKRIVDDLAKVIPM 445
           R+MAEGDD   ++ +V+ +  +I  
Sbjct: 421 RVMAEGDDPQLVESVVNGIVDIISE 445


>gi|163869121|ref|YP_001610360.1| phosphoglucosamine mutase [Bartonella tribocorum CIP 105476]
 gi|189040776|sp|A9IYI0|GLMM_BART1 RecName: Full=Phosphoglucosamine mutase
 gi|161018807|emb|CAK02365.1| phosphoglucomutase/phosphomannomutasefamily protein MrsA
           [Bartonella tribocorum CIP 105476]
          Length = 453

 Score =  283 bits (724), Expect = 3e-74,   Method: Composition-based stats.
 Identities = 274/443 (61%), Positives = 350/443 (79%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M +++FGTDGIRGK+N+FP+TP+F M++G+AVG LFR + + RRVVIGKDTRLSGYMLEN
Sbjct: 1   MVQKYFGTDGIRGKANSFPMTPDFAMKVGMAVGVLFRSQHQSRRVVIGKDTRLSGYMLEN 60

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +LV+G TAAGMD F+LGP+P+PAVAML RSLRAD+GVMISASHNP+ DNGIKLFGPDG+K
Sbjct: 61  ALVSGLTAAGMDVFLLGPVPTPAVAMLCRSLRADLGVMISASHNPFYDNGIKLFGPDGFK 120

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +S D+E +IE L++ DL+  L+    IG AKRV+G   RYIE+ KRTLPRDV L  +RIV
Sbjct: 121 LSDDMEAKIEQLIDTDLSKSLASSAEIGSAKRVEGDIYRYIEYAKRTLPRDVRLDAVRIV 180

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           VDCANGA+YK AP   WELGA+V  I D+PNG NIN  CGST++ SL+RKVHEVRAD+GI
Sbjct: 181 VDCANGAAYKAAPRALWELGAEVFAIHDEPNGTNINQKCGSTDLSSLKRKVHEVRADVGI 240

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           ALDGDGDRV+IVDEK   V+GDQ++A+IA  W     LR NG+VTT+MSN+GLERF+ G 
Sbjct: 241 ALDGDGDRVLIVDEKAQTVDGDQLIAVIAENWHKMGRLRCNGVVTTIMSNLGLERFLNGK 300

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           GL L RT+VGDRY+++ M+  G+NVGGE SGHI+LSD+G+TGDGLVAALQ+L  +K+   
Sbjct: 301 GLDLIRTKVGDRYVVDAMRQKGYNVGGEASGHIVLSDFGTTGDGLVAALQILACMKESQN 360

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
           P+S +C  FE  PQ L++V++K+ ++L  + +  AI  AE  L    RL++RASGTE +I
Sbjct: 361 PMSQLCQRFEPVPQILKNVTIKNKNVLKKNPVKTAIDQAEKRLGKEARLVIRASGTEPVI 420

Query: 421 RIMAEGDDLSRIKRIVDDLAKVI 443
           R+MAEGD    +  +V +L  VI
Sbjct: 421 RLMAEGDAREVLDTVVTELMDVI 443


>gi|332716438|ref|YP_004443904.1| phosphoglucomutase/phosphomannomutasefamily protein MrsA
           [Agrobacterium sp. H13-3]
 gi|325063123|gb|ADY66813.1| phosphoglucomutase/phosphomannomutasefamily protein MrsA
           [Agrobacterium sp. H13-3]
          Length = 450

 Score =  283 bits (724), Expect = 4e-74,   Method: Composition-based stats.
 Identities = 300/443 (67%), Positives = 360/443 (81%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M RR+FGTDGIRG+SN FP+TP+  MR+GIAVG +FR      RVVIGKDTRLSGYMLEN
Sbjct: 1   MARRYFGTDGIRGQSNVFPMTPDLAMRVGIAVGTIFRRGHHRHRVVIGKDTRLSGYMLEN 60

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +LVAGFTAAG+D F+LGPIP+PAVAMLTRSLRAD+GVMISASHNP+ DNGIKLFGPDGYK
Sbjct: 61  ALVAGFTAAGLDVFLLGPIPTPAVAMLTRSLRADIGVMISASHNPFSDNGIKLFGPDGYK 120

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +S ++E  IE LL+ DL + L+    IG AKRVDG   RYIE VKRTLPRDVTL GLRI 
Sbjct: 121 LSDELELEIEDLLDKDLYAQLAKPSEIGRAKRVDGDIYRYIEFVKRTLPRDVTLSGLRIA 180

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           +DCANGA+YKVAP   WELGA+VV IG++PNGININL+CGST+  +LQ+KVHEVRADIGI
Sbjct: 181 IDCANGAAYKVAPAALWELGAEVVTIGNEPNGININLECGSTHPEALQKKVHEVRADIGI 240

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           ALDGD DRVIIVDE+G IV+GDQ+MA+IA  W S + LRG GIV TVMSN+GLERF+   
Sbjct: 241 ALDGDADRVIIVDERGEIVDGDQLMAVIADSWASDNTLRGGGIVATVMSNLGLERFLGDK 300

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           GL+L RT+VGDRY++E+M+N+ FNVGGEQSGHI+LSDYG+TGDGLVAALQVL  +K+   
Sbjct: 301 GLTLARTKVGDRYVVEHMRNHNFNVGGEQSGHIVLSDYGTTGDGLVAALQVLAKVKRSGL 360

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
            VS +C  FE  PQ L++V +     L +  + QAIADAES L    RL++R SGTE LI
Sbjct: 361 TVSEVCRKFEPVPQLLKNVRISGGKPLENPIVQQAIADAESALANNGRLVIRPSGTEPLI 420

Query: 421 RIMAEGDDLSRIKRIVDDLAKVI 443
           R+MAEGDD +++++IV+DL  VI
Sbjct: 421 RVMAEGDDSAKVEQIVNDLVGVI 443


>gi|254503536|ref|ZP_05115687.1| phosphoglucosamine mutase [Labrenzia alexandrii DFL-11]
 gi|222439607|gb|EEE46286.1| phosphoglucosamine mutase [Labrenzia alexandrii DFL-11]
          Length = 447

 Score =  283 bits (723), Expect = 4e-74,   Method: Composition-based stats.
 Identities = 277/442 (62%), Positives = 354/442 (80%)

Query: 3   RRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSL 62
           R+FFGTDGIRG++N +P+T    ++IG+A G +F+      RVVIGKDTRLSGYMLEN+L
Sbjct: 2   RKFFGTDGIRGQANAYPMTAEMALKIGMAAGLVFKNGGHRHRVVIGKDTRLSGYMLENAL 61

Query: 63  VAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVS 122
           VAGFT+ GMD F+LGP+P+PAVAMLTRSLR D+GVMISASHNP+QDNGIK FGPDG+K+S
Sbjct: 62  VAGFTSVGMDVFLLGPLPTPAVAMLTRSLRTDLGVMISASHNPFQDNGIKFFGPDGFKLS 121

Query: 123 TDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVVD 182
            +IE  IETL+E DLT +L+    +G AKR+DG  +RYIE  KRTLPR ++L+GLR+VVD
Sbjct: 122 DEIEKSIETLVESDLTPHLANAQELGRAKRIDGAQERYIETAKRTLPRKMSLEGLRVVVD 181

Query: 183 CANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIAL 242
           CANGA+YKVAP+  +ELGADV+ +G  P+G NIN DCGST+  +L +KVHEVRADIGIAL
Sbjct: 182 CANGAAYKVAPDALFELGADVIRMGVSPDGFNINKDCGSTSTDALSKKVHEVRADIGIAL 241

Query: 243 DGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLGL 302
           DGD DRVIIVDE G +V+GDQ+MA++A+ W ++  L GNGIV TVMSN+GLER++  LGL
Sbjct: 242 DGDADRVIIVDENGTVVDGDQLMAVVAQSWQANGRLAGNGIVATVMSNLGLERYLGDLGL 301

Query: 303 SLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKPV 362
            L+RT+VGDRY++E+M+ NGFNVGGEQSGHI+LSD+ +TGDGL+AALQ++  IKQ DKPV
Sbjct: 302 GLERTKVGDRYVVEHMRANGFNVGGEQSGHIVLSDFATTGDGLIAALQIMACIKQQDKPV 361

Query: 363 STICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLIRI 422
           S +C  FE  PQ L++V  K  + L  S +  AI D E+ L    RL++RASGTE LIR+
Sbjct: 362 SEVCRRFEPVPQILKNVRYKGGAPLQHSEVKSAIEDGEARLGTSGRLVIRASGTEPLIRV 421

Query: 423 MAEGDDLSRIKRIVDDLAKVIP 444
           MAEGDD   +K++V+D+A V+ 
Sbjct: 422 MAEGDDADLVKQVVNDIAGVVA 443


>gi|319409311|emb|CBI82955.1| phosphoglucomutase/phosphomannomutasefamily protein MrsA
           [Bartonella schoenbuchensis R1]
          Length = 449

 Score =  283 bits (723), Expect = 5e-74,   Method: Composition-based stats.
 Identities = 272/443 (61%), Positives = 346/443 (78%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M +++FGTDGIRGK+N FP+TP+F M++G+AVG LFR + +  RVVIGKDTRLSGYMLEN
Sbjct: 1   MAQKYFGTDGIRGKANCFPMTPDFAMKVGMAVGVLFRSQGQPCRVVIGKDTRLSGYMLEN 60

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +LV+GFTAAGM+AF+LGP+P+PAVAML RSLRAD+GVMISASHNPY DNGIKLFGPDG+K
Sbjct: 61  ALVSGFTAAGMEAFLLGPVPTPAVAMLCRSLRADIGVMISASHNPYYDNGIKLFGPDGFK 120

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +S  IE +IE LLE DL+  L+    IG AKRV+G   RYIE+ KRTLPRDV L  LRIV
Sbjct: 121 LSDKIEAKIEQLLEKDLSHSLANCAEIGRAKRVEGDIYRYIEYAKRTLPRDVRLDSLRIV 180

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           VDCANGA+YK AP   WELGA+V+ I ++PNG NIN +CGST++ SL+ KVHEVRAD+GI
Sbjct: 181 VDCANGAAYKAAPLALWELGAEVIAINNEPNGFNINQECGSTDLTSLKEKVHEVRADVGI 240

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           ALDGDGDRV++VDEK   V+GDQ++A++A  W     L+ NG+VTT+M+N+GLERF+   
Sbjct: 241 ALDGDGDRVLMVDEKAQTVDGDQLIAVLAEHWHKTERLQRNGVVTTIMANLGLERFLNAK 300

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           GL L RT+VGDRY++E M+  G+NVGGE  GHI+LSD+G+TGDGLV ALQ+L  +K+   
Sbjct: 301 GLDLVRTKVGDRYVVEAMREKGYNVGGENCGHIVLSDFGTTGDGLVVALQILACMKESQL 360

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
            +S +C  FE  PQ L+++++KD ++LN S +  AI      L    RL++RASGTE LI
Sbjct: 361 SMSELCKRFEPVPQILKNITIKDKNVLNKSPVKAAIDQVTEGLGKETRLVIRASGTEPLI 420

Query: 421 RIMAEGDDLSRIKRIVDDLAKVI 443
           R+M EGDD   I+ I  D+A VI
Sbjct: 421 RVMVEGDDTKAIETIAADIADVI 443


>gi|319406241|emb|CBI79878.1| phosphoglucomutase/phosphomannomutasefamily protein MrsA
           [Bartonella sp. AR 15-3]
          Length = 453

 Score =  282 bits (722), Expect = 5e-74,   Method: Composition-based stats.
 Identities = 278/443 (62%), Positives = 349/443 (78%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M R++FGTDGIRGK+N FP+TP+F M+IG+AVG LFR K++  RVVIGKDTRLSGYMLEN
Sbjct: 1   MVRKYFGTDGIRGKANLFPMTPDFAMKIGMAVGVLFRTKEQSHRVVIGKDTRLSGYMLEN 60

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +LV+G TAAGMDAF+LGP+P+PAVAML RSLRAD+GVMISASHNP+ DNGIKLFGPDG+K
Sbjct: 61  ALVSGLTAAGMDAFLLGPVPTPAVAMLCRSLRADLGVMISASHNPFYDNGIKLFGPDGFK 120

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +S +IE +IE L+E DL   L+    IG AKRV+G   RYIE+ KRTLPRDV L  LRIV
Sbjct: 121 LSDEIEIKIEQLVETDLLHSLAESSEIGRAKRVEGDIYRYIEYAKRTLPRDVRLDSLRIV 180

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           VDCANGA+YK AP   WELGA+V  I ++P G NIN  CGST++ SL+RKVHEVRAD+GI
Sbjct: 181 VDCANGATYKAAPRALWELGAEVFAINNEPTGFNINQKCGSTDLTSLKRKVHEVRADVGI 240

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           ALDGDGDRVI+V+EK   V+GDQI+A+IA  W     L+ NG+VTT+MSN+GLERF+   
Sbjct: 241 ALDGDGDRVIMVNEKAQTVDGDQIIAVIAEHWYETQRLQNNGVVTTIMSNLGLERFLNSK 300

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           GL L RT VGDRY+++ M   G+NVGGE SGHI+LSD+G+TGDGLVAALQ+L  ++Q   
Sbjct: 301 GLDLIRTNVGDRYVVDAMCQKGYNVGGESSGHIVLSDFGTTGDGLVAALQILACMQQKQY 360

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
           P+S +C CFE  PQ L+++++K+ +IL  S +  AI  A+  L    RL+VR+SGTE LI
Sbjct: 361 PMSHLCQCFESVPQILKNIAIKNKNILQKSKVKTAIDRAQKRLGKDARLVVRSSGTEPLI 420

Query: 421 RIMAEGDDLSRIKRIVDDLAKVI 443
           RIMAEGD+   I+ IV +++ V+
Sbjct: 421 RIMAEGDNQEVIEEIVAEISDVL 443


>gi|240851212|ref|YP_002972615.1| phosphoglucomutase/phosphomannomutase family protein MrsA
           [Bartonella grahamii as4aup]
 gi|240268335|gb|ACS51923.1| phosphoglucomutase/phosphomannomutase family protein MrsA
           [Bartonella grahamii as4aup]
          Length = 457

 Score =  282 bits (721), Expect = 8e-74,   Method: Composition-based stats.
 Identities = 275/443 (62%), Positives = 350/443 (79%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M +++FGTDGIRGK+N+FP+TP+F M++G+AVG LFR + + RRVVIGKDTRLSGYMLEN
Sbjct: 1   MVQKYFGTDGIRGKANSFPMTPDFAMKVGMAVGVLFRSQHQSRRVVIGKDTRLSGYMLEN 60

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +LV+G TAAGM+AF+LGP+P+PAVAML RSLRAD+GVMISASHNP+ DNGIKLFGPDG+K
Sbjct: 61  ALVSGLTAAGMEAFLLGPVPTPAVAMLCRSLRADLGVMISASHNPFYDNGIKLFGPDGFK 120

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +S D+E +IE L++ DL+  L+    IG+AKRV+G   RYIE+ KRTLPRDV L  LRIV
Sbjct: 121 LSDDMEAKIEQLIDTDLSKSLASSAEIGYAKRVEGDIYRYIEYAKRTLPRDVRLDALRIV 180

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           VDCANGA+YK AP   WELGA+V  I D+PNG NIN  CGST++ SL+RKVHEVRAD+GI
Sbjct: 181 VDCANGAAYKAAPRALWELGAEVFAIHDEPNGTNINQKCGSTDLSSLKRKVHEVRADVGI 240

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           ALDGDGDRV+IVDEK   V+GDQ++A+IA  W     LR NG+VTT+MSN+GLERF+   
Sbjct: 241 ALDGDGDRVLIVDEKAQTVDGDQLIAVIAENWHKMGRLRCNGVVTTIMSNLGLERFLNSK 300

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           GL L RT VGDRY+++ M+  G+NVGGE SGHI+LSD+G+TGDGLVAALQ+L  +K+   
Sbjct: 301 GLHLVRTNVGDRYVVDAMRQKGYNVGGEASGHIVLSDFGTTGDGLVAALQILACMKESQS 360

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
           P+S +C  FE  PQ L++V++K+ ++L  + +  AI  AE  L    RL++RASGTE LI
Sbjct: 361 PMSQLCKRFEPVPQILKNVTIKNKNVLKKNPVKAAIDQAEKRLGKEARLVIRASGTEPLI 420

Query: 421 RIMAEGDDLSRIKRIVDDLAKVI 443
           R+MAEGD    +  +V +L  VI
Sbjct: 421 RLMAEGDAREVLDTVVTELMDVI 443


>gi|115526162|ref|YP_783073.1| phosphoglucosamine mutase [Rhodopseudomonas palustris BisA53]
 gi|122294962|sp|Q07IZ1|GLMM_RHOP5 RecName: Full=Phosphoglucosamine mutase
 gi|115520109|gb|ABJ08093.1| phosphoglucosamine mutase [Rhodopseudomonas palustris BisA53]
          Length = 450

 Score =  281 bits (719), Expect = 1e-73,   Method: Composition-based stats.
 Identities = 256/443 (57%), Positives = 336/443 (75%), Gaps = 1/443 (0%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M R++FGTDGIRG++N   ITP   M++G A G +F+  +   RVVIGKDTRLSGYM+E 
Sbjct: 1   MSRKYFGTDGIRGRAN-GLITPELAMKVGQAAGLVFQRGEYRHRVVIGKDTRLSGYMIET 59

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +LVAGFT+ GMD  +LGP+P+PAVAMLT+S+RAD+GVMISASHN ++DNGIKLFGP G+K
Sbjct: 60  ALVAGFTSVGMDVLLLGPMPTPAVAMLTKSMRADLGVMISASHNLFEDNGIKLFGPLGFK 119

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +S ++E +IE LL++ L   L+   S+G A+R+DGVHDRYIE  KRTLPRD++L GLR+V
Sbjct: 120 LSDEVERQIEQLLDECLDKRLAASASLGRARRIDGVHDRYIEFAKRTLPRDLSLDGLRVV 179

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           +DCANGA+YKV PE  WELGADV+ IG +P+G NIN +CGST   +L RKV E+RADIGI
Sbjct: 180 IDCANGAAYKVVPEALWELGADVISIGVEPDGFNINKECGSTAPEALSRKVREMRADIGI 239

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           ALDGD DRVI+VDE+G +V+GDQ++A+IA+ W     L   GIV TVMSN+GLERF+ G 
Sbjct: 240 ALDGDADRVILVDERGHVVDGDQLLAVIAQSWQEDGRLSKPGIVATVMSNLGLERFLEGH 299

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           G+ + RT VGDRY++E M   G+N+GGE SGHIILSDY +TGDG VAALQVL  +++  +
Sbjct: 300 GIEMVRTPVGDRYVLEQMMTGGYNLGGEPSGHIILSDYATTGDGFVAALQVLAVVQKLGR 359

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
           PVS +CH F+  PQ L++V  +    L+ + +  AI D E  L G  RL++R SGTE +I
Sbjct: 360 PVSEVCHKFDPLPQILKNVRFRAGKPLDDADVKSAIRDGEQRLNGHGRLLIRPSGTEPVI 419

Query: 421 RIMAEGDDLSRIKRIVDDLAKVI 443
           R+MAEGDD   ++ +VD +   +
Sbjct: 420 RVMAEGDDRDVVEEVVDSICSAL 442


>gi|121602671|ref|YP_988509.1| phosphoglucosamine mutase [Bartonella bacilliformis KC583]
 gi|158513073|sp|A1URA6|GLMM_BARBK RecName: Full=Phosphoglucosamine mutase
 gi|120614848|gb|ABM45449.1| phosphoglucosamine mutase [Bartonella bacilliformis KC583]
          Length = 450

 Score =  281 bits (719), Expect = 1e-73,   Method: Composition-based stats.
 Identities = 278/448 (62%), Positives = 347/448 (77%), Gaps = 1/448 (0%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M R++FGTDGIRGK+N FP+TP+F M++GIAVG LFR K   RRVVIGKDTRLS YMLEN
Sbjct: 1   MARKYFGTDGIRGKANIFPMTPDFAMKVGIAVGVLFRSKATSRRVVIGKDTRLSCYMLEN 60

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +LVAGFTAAGMDAF+LGPIP+PAVAML RSLRAD+GVMISASHN + DNGIKLFGPDG+K
Sbjct: 61  ALVAGFTAAGMDAFLLGPIPTPAVAMLCRSLRADIGVMISASHNAFYDNGIKLFGPDGFK 120

Query: 121 VSTDIEDRIETLLEDDLTS-YLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRI 179
           +S + E +IE LL+ D++   L+  + IG AKRV+G   RYIE+ KRTLPRDV L  LRI
Sbjct: 121 LSDEKETKIEALLDSDISELPLANCEEIGRAKRVEGDIYRYIEYAKRTLPRDVRLDALRI 180

Query: 180 VVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIG 239
           VVDCANGA+YK AP   WELGA+V+ I D+PNG NIN +CGST++ SL+ KVHEVRAD+G
Sbjct: 181 VVDCANGATYKAAPRALWELGAEVIAINDEPNGFNINQECGSTDLTSLRNKVHEVRADVG 240

Query: 240 IALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAG 299
           IALDGDGDRV++VDEKG +++GDQ++A+IA  W     L   GIVTTVMSN+GLERF++ 
Sbjct: 241 IALDGDGDRVLMVDEKGQMIDGDQLIAVIAEHWHKTGRLHHKGIVTTVMSNLGLERFLSE 300

Query: 300 LGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYD 359
            GL L RT+VGDRY+++ M+   +N+GGE SGHIILSD+ +TGDGLVAALQVL  +K+  
Sbjct: 301 KGLKLIRTDVGDRYVVDMMRQKKYNIGGESSGHIILSDFCTTGDGLVAALQVLACMKESQ 360

Query: 360 KPVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESL 419
           +P+S +C  FE  PQ L++  V + ++L  S +  A+  A   L    RL+VRASGTE +
Sbjct: 361 QPMSQLCKRFEPVPQILKNKVVHNKNVLQKSEVQAALTKASEHLGKEGRLLVRASGTEPV 420

Query: 420 IRIMAEGDDLSRIKRIVDDLAKVIPMID 447
           IR+MAEGDD   +  IVDDL  +I   D
Sbjct: 421 IRVMAEGDDRKAMTAIVDDLITLIARHD 448


>gi|119383297|ref|YP_914353.1| phosphoglucosamine mutase [Paracoccus denitrificans PD1222]
 gi|158705802|sp|A1AZG3|GLMM_PARDP RecName: Full=Phosphoglucosamine mutase
 gi|119373064|gb|ABL68657.1| phosphoglucosamine mutase [Paracoccus denitrificans PD1222]
          Length = 447

 Score =  281 bits (717), Expect = 2e-73,   Method: Composition-based stats.
 Identities = 234/447 (52%), Positives = 313/447 (70%), Gaps = 4/447 (0%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKK-HRRVVIGKDTRLSGYMLE 59
           M R+ FGTDG+RG++NT P+T    +R+G A G  FR   + H RVVIGKDTRLSGYMLE
Sbjct: 1   MSRKLFGTDGVRGRANTHPMTAEMALRLGAAAGRYFRRSGEDHHRVVIGKDTRLSGYMLE 60

Query: 60  NSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGY 119
           N+L AG T+ GM+  +LGP+P+PAV  LTRS+RADVG+MISASHNP  DNGIK FGPDG+
Sbjct: 61  NALTAGLTSTGMNVLLLGPVPTPAVGYLTRSMRADVGIMISASHNPAHDNGIKFFGPDGF 120

Query: 120 KVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRI 179
           K+S + E RIE ++  ++        +IG AKR+D    RY+E+ K T P    L+GL++
Sbjct: 121 KLSDEAEARIEAIVAGEIIPA--QPQNIGRAKRIDDGRGRYVEYAKTTFPSGQRLEGLKV 178

Query: 180 VVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIG 239
           VVDCANGA+Y+ AP+V WELGA+V+ +G  PNG NIN   GST+  +  R V E  AD+G
Sbjct: 179 VVDCANGAAYRAAPDVLWELGAEVIPLGVSPNGHNINDGLGSTHPEACARAVLEHGADMG 238

Query: 240 IALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAG 299
           I+LDGD DRV+IVDEKG + +GDQIMAL+A  W +   LRG  +V TVMSN+GLERF+ G
Sbjct: 239 ISLDGDADRVMIVDEKGQVADGDQIMALLAARWAAQGRLRGGALVATVMSNLGLERFLQG 298

Query: 300 LGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYD 359
            GL L+RT VGDRY++E M+  GFN+GGEQSGHI+++DY +TGDGL+A+LQ L  +    
Sbjct: 299 RGLRLERTAVGDRYVVERMRGAGFNLGGEQSGHIVMTDYATTGDGLIASLQFLAALSDSG 358

Query: 360 KPVSTICHCFEEYPQFLRSVSV-KDTSILNSSSIVQAIADAESELRGIDRLIVRASGTES 418
           +  S +   FE  PQ L++V        L+  S+   IA AE+ L G  R+++R SGTE 
Sbjct: 359 QRASELVAQFEPVPQLLKNVRYAVGADPLSKDSVQAEIARAEARLNGSGRVLIRKSGTEP 418

Query: 419 LIRIMAEGDDLSRIKRIVDDLAKVIPM 445
           LIR+MAE +D + ++ +V+D+   +  
Sbjct: 419 LIRVMAEAEDETVLREVVEDIVAAVEK 445


>gi|94501389|ref|ZP_01307909.1| phosphoglucosamine mutase [Oceanobacter sp. RED65]
 gi|94426502|gb|EAT11490.1| phosphoglucosamine mutase [Oceanobacter sp. RED65]
          Length = 443

 Score =  280 bits (715), Expect = 3e-73,   Method: Composition-based stats.
 Identities = 206/445 (46%), Positives = 315/445 (70%), Gaps = 5/445 (1%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M R++FGTDGIRG+    PITP F+M++G A G +F  + K R+++IGKDTR+SGYM E+
Sbjct: 1   MSRKYFGTDGIRGRVGESPITPEFVMKLGWAAGRVFASQGK-RKILIGKDTRISGYMFES 59

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +L AG +AAG+D  ILGP+P+P +A LTR+  AD G++ISASHNPY DNGIK F  DG K
Sbjct: 60  ALEAGLSAAGVDIGILGPMPTPGIAYLTRTFHADAGIVISASHNPYYDNGIKFFSADGSK 119

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +    E +IE LL+  +   +   D +G AKR++    RYIE  K T+   ++L+G+R+V
Sbjct: 120 LDDATEQQIEELLDQPME--VMNSDRLGKAKRIEDAAGRYIEFCKSTVFG-LSLKGMRVV 176

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           +DCA+GA+Y++AP VF ELGADV VIG++P+G+NIN   GST+  SLQ+KV E+RAD+G+
Sbjct: 177 LDCAHGATYQIAPAVFTELGADVFVIGNEPDGLNINNQVGSTSPKSLQQKVVELRADLGV 236

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           A DGDGDRV++VD KG +V+GD+I+ +IAR+      L+G  + T  MSN+G+E  +  +
Sbjct: 237 AFDGDGDRVVMVDHKGEVVDGDEIIYMIARQQYETDTLQGGVVGTL-MSNMGMELALKDM 295

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           G+   R +VGDRY+++ +  + +++GGE SGHI+  +  +TGDG+VAALQ L+ ++ + K
Sbjct: 296 GIPFVRAKVGDRYVLQQLAEHNWSLGGESSGHILCLNSTTTGDGIVAALQALKSLQSHGK 355

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
            +        ++PQ +++V V D SI++S+ +++A+  AE+E+ G  R+++R SGTE ++
Sbjct: 356 NLHEYKQGMSKFPQVMKNVKVVDKSIVDSAEVLKAVEQAETEMAGKGRVLLRPSGTEPVV 415

Query: 421 RIMAEGDDLSRIKRIVDDLAKVIPM 445
           R+M EG D + +  +VD L +++  
Sbjct: 416 RVMVEGQDKTLVNLLVDRLVQIVSQ 440


>gi|307944551|ref|ZP_07659891.1| phosphoglucosamine mutase [Roseibium sp. TrichSKD4]
 gi|307772300|gb|EFO31521.1| phosphoglucosamine mutase [Roseibium sp. TrichSKD4]
          Length = 447

 Score =  280 bits (715), Expect = 4e-73,   Method: Composition-based stats.
 Identities = 264/443 (59%), Positives = 346/443 (78%)

Query: 3   RRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSL 62
           R++FGTDGIRG++N  P+T    +++G+A G  F+      RVVIGKDTRLSGY +EN+L
Sbjct: 2   RKYFGTDGIRGRANVPPMTAEAALKVGMAAGLTFKNGGHKHRVVIGKDTRLSGYTIENAL 61

Query: 63  VAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVS 122
           VAGFT+ GMD F+LGP+P+PAVAMLTRSLR+DVGVMISASHNP+QDNGIK FGPDG+K+S
Sbjct: 62  VAGFTSVGMDVFLLGPMPTPAVAMLTRSLRSDVGVMISASHNPFQDNGIKFFGPDGFKLS 121

Query: 123 TDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVVD 182
            ++E +IE L++ DL SYL     +G AKR+D    RY+E  KRTLPR ++L+GLR+VVD
Sbjct: 122 DEVEMQIEKLMDSDLNSYLPDASELGRAKRIDSAQHRYVEFAKRTLPRAMSLEGLRVVVD 181

Query: 183 CANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIAL 242
           CANGA+YKVAPE  WELGA+V+ +G +PNG NIN +CGST   +L RKV EVRADIGIAL
Sbjct: 182 CANGAAYKVAPEALWELGAEVISLGVEPNGTNINKECGSTYPEALSRKVQEVRADIGIAL 241

Query: 243 DGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLGL 302
           DGD DRVIIVDE GA+++GDQ+MA+IA+ W   + L GNGIV TVMSN+GLER++  LGL
Sbjct: 242 DGDADRVIIVDENGAVIDGDQLMAVIAQFWYKRNRLAGNGIVATVMSNLGLERYLESLGL 301

Query: 303 SLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKPV 362
            L RT+VGDRY++E+M+++GFN+GGEQSGHI+LSD+ +TGDGL+AALQVL  IK  D+PV
Sbjct: 302 GLARTKVGDRYVVEHMRSHGFNIGGEQSGHIVLSDFTTTGDGLIAALQVLACIKDQDRPV 361

Query: 363 STICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLIRI 422
           S +C  F+  PQ L++V       L   S+  AI++ E+ L    RL++RASGTE LIR+
Sbjct: 362 SEVCKRFDPVPQLLKNVRYSGGKPLELDSVKAAISEGEARLGKEGRLVIRASGTEPLIRV 421

Query: 423 MAEGDDLSRIKRIVDDLAKVIPM 445
           MAEGDD + ++ +V++++ V+  
Sbjct: 422 MAEGDDAALVREVVNEISDVVAQ 444


>gi|209886276|ref|YP_002290133.1| phosphoglucosamine mutase [Oligotropha carboxidovorans OM5]
 gi|226723902|sp|B6JIL2|GLMM_OLICO RecName: Full=Phosphoglucosamine mutase
 gi|209874472|gb|ACI94268.1| phosphoglucosamine mutase [Oligotropha carboxidovorans OM5]
          Length = 448

 Score =  279 bits (714), Expect = 5e-73,   Method: Composition-based stats.
 Identities = 255/444 (57%), Positives = 342/444 (77%), Gaps = 1/444 (0%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M R++FGTDGIRG++N   ITP   +++G A G +F+  +   RVVIGKDTRLSGYM+E 
Sbjct: 1   MARKYFGTDGIRGRAN-GVITPELALKVGQAAGLVFQRGEYRHRVVIGKDTRLSGYMIET 59

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           ++VAGFT+ GMD  +LGPIP+PAVAMLT+S+RAD+GVMISASHNP+ DNGIKLFGP GYK
Sbjct: 60  AMVAGFTSVGMDVLLLGPIPTPAVAMLTKSMRADLGVMISASHNPFADNGIKLFGPSGYK 119

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +S ++E +IE L+++++   L+    +G A+R+DGVHDRYIE  KRTLPR+++L+GLR+V
Sbjct: 120 LSDEVELQIEELMDENIDRRLAQSTQLGRARRIDGVHDRYIEFAKRTLPRELSLEGLRVV 179

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           VDCANGA+YKV PE  WELGADV+ IG +P+G+NIN +CGST+  +L  KV E+RADIGI
Sbjct: 180 VDCANGAAYKVVPEALWELGADVIAIGAEPDGMNINKECGSTSPDALAHKVREMRADIGI 239

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           ALDGD DRV+++DE+G +++GDQ++A+IA+ W     L   GIVTTVMSN+GLERF+AG 
Sbjct: 240 ALDGDADRVLMIDERGHLIDGDQLLAVIAQSWKEDGRLAKPGIVTTVMSNLGLERFLAGE 299

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           GLS+ RT VGDRY++E M   G+N+GGE SGHII+SD+ +TGDG VAALQVL  +++  +
Sbjct: 300 GLSMVRTPVGDRYVLEQMMAQGYNLGGEPSGHIIMSDFTTTGDGFVAALQVLAVVQKLGR 359

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
           PVS +CH FE  PQ L++V  +    L +  +   IADAE +L G  RL+VR+SGTE +I
Sbjct: 360 PVSEVCHRFEPLPQILKNVRYRSGKPLENPKVQSTIADAEKKLNGCGRLLVRSSGTEPVI 419

Query: 421 RIMAEGDDLSRIKRIVDDLAKVIP 444
           R+M EGDD  R++  VD +   + 
Sbjct: 420 RVMGEGDDRDRVEEAVDMIVAALS 443


>gi|144897908|emb|CAM74772.1| Phosphoglucosamine mutase [Magnetospirillum gryphiswaldense MSR-1]
          Length = 450

 Score =  279 bits (714), Expect = 5e-73,   Method: Composition-based stats.
 Identities = 246/447 (55%), Positives = 317/447 (70%), Gaps = 2/447 (0%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M R+ FGTDGIRG +N  P+T    +++G+A G  F   +    VVIGKDTRLSGY+LE 
Sbjct: 1   MTRKLFGTDGIRGTANIDPMTAEMALKLGMAAGRHFTRGEHRHMVVIGKDTRLSGYLLEP 60

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +L AGF A GMD  +LGP+P+PAVAMLTRSLRAD+GVMISASHN YQDNGIKLFGPDG+K
Sbjct: 61  ALTAGFIAVGMDVVLLGPLPTPAVAMLTRSLRADLGVMISASHNAYQDNGIKLFGPDGFK 120

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +S + E  IE  + + L +Y    D +G AKR+D    RYIE+ K + PR + L GL+IV
Sbjct: 121 LSDEDEIEIEHKMFNGLEAYRVGSDHLGKAKRLDDAVGRYIEYAKSSFPRGLRLDGLKIV 180

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           VDCANGA+YKVAP V WELGA+V+ +   P+G NIN DCGS +  +LQ +V    A +GI
Sbjct: 181 VDCANGAAYKVAPTVLWELGAEVIPLAVSPDGFNINKDCGSLHTQTLQTQVVAHGAHLGI 240

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           ALDGD DR+++ DEKG +++GDQ+M LI         L G GIV TVMSN+GLE+ +AG 
Sbjct: 241 ALDGDADRLVLCDEKGTVIDGDQVMGLIGLTLAKSGKLTGGGIVATVMSNMGLEKHLAGH 300

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           GL L RT VGDRY++E M+ +GFNVGGEQSGHIILSD+ +TGDGLVAALQVL  + + DK
Sbjct: 301 GLHLHRTNVGDRYVLERMRRDGFNVGGEQSGHIILSDHSTTGDGLVAALQVLAALVEADK 360

Query: 361 PVSTICHCFEEYPQFLRSVSV--KDTSILNSSSIVQAIADAESELRGIDRLIVRASGTES 418
           P S + H F+ +PQ L++V V  K  ++L    +  AIA  E+ L G  R+++R SGTE 
Sbjct: 361 PASQVLHLFDPFPQVLKNVRVAGKPDAVLALDGVQAAIAAGEARLNGTGRVLIRKSGTEP 420

Query: 419 LIRIMAEGDDLSRIKRIVDDLAKVIPM 445
           LIR+MAEG+D + +  +VDD+   I  
Sbjct: 421 LIRVMAEGEDKALVDTVVDDIVATISA 447


>gi|114707943|ref|ZP_01440835.1| phosphoglucomutase/phosphomannomutase family protein MrsA
           [Fulvimarina pelagi HTCC2506]
 gi|114536572|gb|EAU39704.1| phosphoglucomutase/phosphomannomutase family protein MrsA
           [Fulvimarina pelagi HTCC2506]
          Length = 448

 Score =  279 bits (713), Expect = 6e-73,   Method: Composition-based stats.
 Identities = 266/448 (59%), Positives = 336/448 (75%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M RR+FGTDGIRGK+N FP+TP   +R+G+A G +F   +   RVVIGKDTR S YMLEN
Sbjct: 1   MARRYFGTDGIRGKANRFPMTPEVALRVGMAAGLVFHRGEHRHRVVIGKDTRRSSYMLEN 60

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           ++VAGFTAAGMD F+LGP+P+PAVAMLTRSLRAD+GVMISASHNP++DNGIKLFGPDGYK
Sbjct: 61  AMVAGFTAAGMDVFLLGPMPTPAVAMLTRSLRADIGVMISASHNPFEDNGIKLFGPDGYK 120

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +S  IE +IE LLE+DLT+ +     +G A R+DGVHDRYIE  KRTLPR+++  GLRI 
Sbjct: 121 LSDQIETQIEALLEEDLTNRMPTGAGMGRATRIDGVHDRYIEFAKRTLPREISFDGLRIA 180

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           +DCANGA Y VAP+V WELG DVV IG  P+G NIN DCGST+  +L  KV+EVRADIGI
Sbjct: 181 IDCANGAGYDVAPKVLWELGGDVVEIGTSPDGTNINRDCGSTSPNALIAKVNEVRADIGI 240

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           ALDGD DRV++VDE+G IV+GDQ+MA+IA  W     L   GIV T+MSN+GLERF+   
Sbjct: 241 ALDGDADRVLVVDERGEIVDGDQLMAVIAESWNDDGRLAAGGIVATIMSNLGLERFLEAQ 300

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
            L L RT+VGDRY++E+M+ +G+NVGGEQSGHI+LSDYG+TGDGL++ALQVL  +KQ   
Sbjct: 301 NLLLARTKVGDRYVVEHMREHGYNVGGEQSGHIVLSDYGTTGDGLISALQVLAVVKQRGG 360

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
            VS +C  F+  PQFL++V       L    +   I    + L    RL++R SGTE LI
Sbjct: 361 KVSDVCRRFQPVPQFLKNVRFGGGMPLEKDEVKTVIETGRNRLGNSGRLVIRPSGTEPLI 420

Query: 421 RIMAEGDDLSRIKRIVDDLAKVIPMIDS 448
           R+MAEGDD   ++ +VD++   +  + +
Sbjct: 421 RVMAEGDDPQMVEDVVDNICDALRAVAA 448


>gi|329847304|ref|ZP_08262332.1| phosphoglucosamine mutase [Asticcacaulis biprosthecum C19]
 gi|328842367|gb|EGF91936.1| phosphoglucosamine mutase [Asticcacaulis biprosthecum C19]
          Length = 447

 Score =  279 bits (713), Expect = 7e-73,   Method: Composition-based stats.
 Identities = 248/447 (55%), Positives = 332/447 (74%), Gaps = 2/447 (0%)

Query: 1   MK-RRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRR-VVIGKDTRLSGYML 58
           M  R++FGTDGIRG++NTFP+T     R+G+A G +F      R  VVIGKDTRLSGYM+
Sbjct: 1   MSTRKYFGTDGIRGRANTFPMTAEVAYRVGMAAGKMFMSNADRRHLVVIGKDTRLSGYMI 60

Query: 59  ENSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDG 118
           E +LVAGFT+ GMD  + GP+P+P VA++TRS+RAD+GVMISASHN + DNGIKLFGPDG
Sbjct: 61  EPALVAGFTSVGMDVRLFGPLPTPGVALMTRSMRADLGVMISASHNAFMDNGIKLFGPDG 120

Query: 119 YKVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLR 178
           YK+S ++E  IE  ++ D+   ++    +G  +R+D    RYIE VK + PR +TL GLR
Sbjct: 121 YKLSDEVELEIEARMDGDILQGVAEPHKLGRVQRLDDAQARYIEIVKASFPRHLTLNGLR 180

Query: 179 IVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADI 238
           IV+DCA+GA+YKVAP   +ELGA+V+ IG  P+G+NIN  CGST+  ++  KV E+RAD+
Sbjct: 181 IVIDCAHGAAYKVAPLALYELGAEVICIGVSPDGLNINEKCGSTHTDAMAVKVKEMRADL 240

Query: 239 GIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIA 298
           GIALDGD DRV+I DE G +V+GDQIMA++A       LL+G G+V TVMSN+GLERF+A
Sbjct: 241 GIALDGDADRVVICDENGKVVDGDQIMAIVAGHLADKGLLKGGGVVATVMSNLGLERFLA 300

Query: 299 GLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQY 358
           G GL+L+RT+VGDRY+ME M+  GFN+GGEQSGH+IL+D+ +TGDGL+AALQVL  + + 
Sbjct: 301 GKGLTLERTKVGDRYVMERMREGGFNLGGEQSGHVILTDHATTGDGLMAALQVLAVLVER 360

Query: 359 DKPVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTES 418
            KP+S + H F+  PQ L++V     S LNS ++ QAI + E  L+G  R++VR SGTE 
Sbjct: 361 GKPMSKLGHQFDTVPQILKNVRFTGVSPLNSEAVKQAIREGEEMLKGSGRVLVRPSGTEP 420

Query: 419 LIRIMAEGDDLSRIKRIVDDLAKVIPM 445
           LIR+MAEGDD  ++K  V+ +A+ I  
Sbjct: 421 LIRVMAEGDDEKQVKAAVNMIAEAIKA 447


>gi|114771726|ref|ZP_01449130.1| phosphoglucosamine mutase [alpha proteobacterium HTCC2255]
 gi|114547798|gb|EAU50688.1| phosphoglucosamine mutase [alpha proteobacterium HTCC2255]
          Length = 446

 Score =  279 bits (713), Expect = 7e-73,   Method: Composition-based stats.
 Identities = 226/446 (50%), Positives = 312/446 (69%), Gaps = 2/446 (0%)

Query: 2   KRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENS 61
           KR++FGTDG+RG +N FP+TP+  +++G A G  FR  +K  RVVIGKDTR S YM EN+
Sbjct: 3   KRKYFGTDGVRGLANAFPMTPDIALKLGAAAGRHFRKDQKQHRVVIGKDTRRSSYMFENA 62

Query: 62  LVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKV 121
           L AGFT+ GMD ++LGP+P+PAV +LTRS+RADVGVMISASHN Y DNGIK FGP+G+K+
Sbjct: 63  LTAGFTSTGMDVYLLGPVPTPAVGVLTRSMRADVGVMISASHNSYLDNGIKFFGPEGFKL 122

Query: 122 STDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVV 181
           S  +E  IE LL+D++    +   +IG AKR+D    RY+E  K   PR   L GL++VV
Sbjct: 123 SDKVELEIEKLLDDEIE--YAASQNIGMAKRIDDALGRYMEFAKSAFPRKKLLNGLKVVV 180

Query: 182 DCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIA 241
           DCANGA+YK AP V WELGA+V+ IG  P+G NIN DCGST+  +  + V E  AD+GI 
Sbjct: 181 DCANGAAYKAAPIVLWELGAEVISIGVNPDGYNINKDCGSTHPQNAAKAVLEHNADVGIC 240

Query: 242 LDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLG 301
           LDGD DR+I++D KG I +GDQ+M LIA +W S   L  N +V TVMSN+GLER++  L 
Sbjct: 241 LDGDADRLILIDNKGNIADGDQLMGLIASQWSSKGNLANNTLVATVMSNMGLERYLNTLD 300

Query: 302 LSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKP 361
           + L RT VGDRY++E M+  G+N+GGEQSGHI+++DY +TGDGL+AALQ L  + +    
Sbjct: 301 IKLLRTNVGDRYVVEAMRKFGYNLGGEQSGHIVMTDYATTGDGLMAALQFLNALVESKCT 360

Query: 362 VSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLIR 421
            S +   FE  PQ LR+V + ++  L++  + ++I   E     I R+++R SGTE L+R
Sbjct: 361 SSELIKVFEPMPQLLRNVRLNNSESLDNLKVKESIKAGEDAFGDIGRILIRKSGTEPLLR 420

Query: 422 IMAEGDDLSRIKRIVDDLAKVIPMID 447
           +M E +D   +K ++ ++ + +  I+
Sbjct: 421 VMGECEDPKLLKAVIGNIVETVDAIN 446


>gi|23015577|ref|ZP_00055349.1| COG1109: Phosphomannomutase [Magnetospirillum magnetotacticum MS-1]
          Length = 451

 Score =  279 bits (713), Expect = 7e-73,   Method: Composition-based stats.
 Identities = 243/449 (54%), Positives = 316/449 (70%), Gaps = 3/449 (0%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M R+ FGTDGIRG +NT P+T    M++G+A G  F   +    VVIGKDTRLSGY++E 
Sbjct: 1   MTRKLFGTDGIRGTANTDPMTAEMAMKLGMAAGRHFTRGEHRHVVVIGKDTRLSGYLIEP 60

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +L AGF + GMD  +LGP+P+PAVAMLTRS+RAD+GVMISASHNPYQDNGIKLFGPDG+K
Sbjct: 61  ALTAGFISVGMDVVLLGPLPTPAVAMLTRSMRADLGVMISASHNPYQDNGIKLFGPDGFK 120

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +S + E  IE  + + L S     D +G AKR+D    RYIE+ K T PR + L GL+IV
Sbjct: 121 LSDEDELTIEAAMFNGLESCRVGSDHLGRAKRLDDAAGRYIEYAKFTFPRGLRLDGLKIV 180

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           VDCANGA+YKVAP V WELGA+V+ +   P+G NIN +CGS +  +++ +V    A +GI
Sbjct: 181 VDCANGAAYKVAPTVLWELGAEVIPVAVNPDGFNINKNCGSLHTETMREQVVTHGAHLGI 240

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           ALDGD DRV++ DE+G +++GDQ+MALI   W     L+G GIV TVMSN+GLERF+   
Sbjct: 241 ALDGDADRVVLCDEQGHLIDGDQLMALIGDLWHRSGQLKGGGIVATVMSNLGLERFLGQR 300

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           GL   RT VGDRY++E+M+  GFNVGGEQSGHIILSD+ +TGDGLVA LQVL  + Q  K
Sbjct: 301 GLKTIRTNVGDRYVLEHMRREGFNVGGEQSGHIILSDHSTTGDGLVAGLQVLAALVQSGK 360

Query: 361 PVSTICHCFEEYPQFLRSVSVKD---TSILNSSSIVQAIADAESELRGIDRLIVRASGTE 417
           P S +   F   PQ L++V V       +L + ++  AI DAE+ L G  RL++R SGTE
Sbjct: 361 PASEMLRLFTPLPQVLKNVRVSKGSVAEVLAAPAVEAAIKDAEARLVGQGRLLIRKSGTE 420

Query: 418 SLIRIMAEGDDLSRIKRIVDDLAKVIPMI 446
            LIR+MAEG+D + ++  VD + + I  +
Sbjct: 421 PLIRVMAEGEDQTLVEATVDGIVEHIRQV 449


>gi|326389131|ref|ZP_08210711.1| phosphoglucosamine mutase [Novosphingobium nitrogenifigens DSM
           19370]
 gi|326206362|gb|EGD57199.1| phosphoglucosamine mutase [Novosphingobium nitrogenifigens DSM
           19370]
          Length = 445

 Score =  278 bits (711), Expect = 1e-72,   Method: Composition-based stats.
 Identities = 251/445 (56%), Positives = 328/445 (73%), Gaps = 2/445 (0%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M R++FGTDGIRG++N   +T    M++G A G  F+  +   RVVIGKDTRLSGYMLEN
Sbjct: 1   MGRKYFGTDGIRGRTNAGVMTAATAMKVGQAAGTYFQRGEHRHRVVIGKDTRLSGYMLEN 60

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           ++ AGFT+ GMD  +LGP+P+PAVAMLTR +RADVGVMISASHNP++DNGIKLFGPDG+K
Sbjct: 61  AMTAGFTSVGMDVVLLGPMPTPAVAMLTREMRADVGVMISASHNPFEDNGIKLFGPDGFK 120

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +S + E  IE +LE+DL   L+  D++G A+R++    RYI  +K +LP DV L GLRIV
Sbjct: 121 LSDEDELAIEAMLEEDL--PLAAADAVGRARRIEDARGRYIHAIKASLPHDVRLDGLRIV 178

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           +DCANGA+Y+VAP   WELGA+V+ IG +PNG NINL  GST++ +++ KV EVRADIGI
Sbjct: 179 LDCANGAAYQVAPSALWELGAEVIAIGVEPNGKNINLGVGSTHLDAIKDKVREVRADIGI 238

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           ALDGD DR+I+VDEKG  V+GDQIMALI     +   LRG G+V TVMSN+GLERF+   
Sbjct: 239 ALDGDADRLIVVDEKGHTVDGDQIMALIGSRLAAQGQLRGGGVVATVMSNLGLERFLNAR 298

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           GL L R  VGDR+++E M+  G+NVGGEQSGH+IL+D+G+TGDG VAALQVL  +    K
Sbjct: 299 GLELVRAAVGDRHVLEKMRAGGYNVGGEQSGHMILTDHGTTGDGTVAALQVLAALVSSGK 358

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
           P S + H F+  PQ LR+V       L + ++ + IA+AESEL G  RL++R SGTE +I
Sbjct: 359 PASEVLHLFDPVPQLLRNVRFTGGKPLENETVREVIAEAESELAGKGRLVIRPSGTEPVI 418

Query: 421 RIMAEGDDLSRIKRIVDDLAKVIPM 445
           R+MAEGDD  ++  +V+ +   +  
Sbjct: 419 RVMAEGDDAEQVAEVVERICAAVRK 443


>gi|118588320|ref|ZP_01545729.1| phosphoglucomutase/phosphomannomutase family protein MrsA [Stappia
           aggregata IAM 12614]
 gi|118439026|gb|EAV45658.1| phosphoglucomutase/phosphomannomutase family protein MrsA [Stappia
           aggregata IAM 12614]
          Length = 447

 Score =  278 bits (710), Expect = 1e-72,   Method: Composition-based stats.
 Identities = 272/442 (61%), Positives = 346/442 (78%)

Query: 3   RRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSL 62
           R+FFGTDGIRG++N++P+T    +++G+A G  F+      RVVIGKDTRLSGYMLEN+L
Sbjct: 2   RKFFGTDGIRGQANSYPMTAEMALKVGMAAGLAFKNGGHRHRVVIGKDTRLSGYMLENAL 61

Query: 63  VAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVS 122
           VAGFT+ GMD F+LGP+P+PAVAMLTRSLR+D+GVMISASHNP+QDNGIK FGPDG+K+S
Sbjct: 62  VAGFTSVGMDVFLLGPMPTPAVAMLTRSLRSDLGVMISASHNPFQDNGIKFFGPDGFKLS 121

Query: 123 TDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVVD 182
             IE  IE L+E DLTS L     +G AKR+DG   RYIE  KRTLPR+++L+GLR+V+D
Sbjct: 122 DQIEQTIEELMESDLTSRLPSASELGRAKRIDGAQQRYIETAKRTLPREMSLEGLRVVID 181

Query: 183 CANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIAL 242
           CANGA+YKVAPE  WELGADV+ +G  P+G NIN +CGST+  +L RKVHEVRADIGIAL
Sbjct: 182 CANGAAYKVAPEALWELGADVITMGVTPDGFNINKECGSTSTDALSRKVHEVRADIGIAL 241

Query: 243 DGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLGL 302
           DGD DRVIIVDE G++V+GDQ+MA++A+ W + + L   GIV TVMSN+GLER++  LGL
Sbjct: 242 DGDADRVIIVDENGSVVDGDQLMAVVAQSWQASNRLSAPGIVATVMSNLGLERYLQSLGL 301

Query: 303 SLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKPV 362
            L RT+VGDRY++E+M+ NG+NVGGEQSGHI+LSD+ +TGDGL+A LQVL  +K  DKPV
Sbjct: 302 GLARTKVGDRYVVEHMRANGYNVGGEQSGHIVLSDFATTGDGLIAGLQVLACVKDQDKPV 361

Query: 363 STICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLIRI 422
           S +C  FE  PQ L++V  K    L    +  AI D E+ L    RL++RASGTE LIR+
Sbjct: 362 SEVCRRFEPVPQILKNVRYKGGKPLEQDLVKSAIEDGEARLGNSGRLVIRASGTEPLIRV 421

Query: 423 MAEGDDLSRIKRIVDDLAKVIP 444
           MAEGDD   +K++V+D+A V+ 
Sbjct: 422 MAEGDDADLVKQVVNDIAGVVA 443


>gi|319404752|emb|CBI78354.1| phosphoglucomutase/phosphomannomutasefamily protein MrsA
           [Bartonella rochalimae ATCC BAA-1498]
          Length = 451

 Score =  278 bits (710), Expect = 1e-72,   Method: Composition-based stats.
 Identities = 273/448 (60%), Positives = 347/448 (77%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M R++FGTDGIRGK+N FP+TP+F M+IG+AVG LFR K++  RVVIGKDTRLSGYMLEN
Sbjct: 1   MARKYFGTDGIRGKANLFPMTPDFAMKIGMAVGVLFRTKEQSHRVVIGKDTRLSGYMLEN 60

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +LV+G TAAGMDAF+LGP+P+PAVAML RSLRAD+GVMISASHNP+ DNGIKLFGPDG+K
Sbjct: 61  ALVSGLTAAGMDAFLLGPVPTPAVAMLCRSLRADLGVMISASHNPFYDNGIKLFGPDGFK 120

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +S +IE +IE L+E DL   L+    IG AKRV+G   RYIE+ KRTLPRDV L  LRIV
Sbjct: 121 LSDEIEIKIEQLVEKDLVHSLAEASEIGRAKRVEGDIYRYIEYAKRTLPRDVRLDSLRIV 180

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           VDCANGA+YK AP   WELGA+V  I ++P G+NIN  CGST++ SL+RKVHEVRAD+GI
Sbjct: 181 VDCANGATYKAAPRALWELGAEVFAINNEPTGLNINQKCGSTDLTSLKRKVHEVRADVGI 240

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           ALDGDGDRVI+VDEK   ++GDQI+A+IA  W     L+ NG+V ++MSN+GLERF+   
Sbjct: 241 ALDGDGDRVIMVDEKAQTIDGDQIIAVIAEHWYKTERLQRNGVVASIMSNLGLERFLNNK 300

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           GL L RT VGDRY+++ M+  G+NVGGE SGHI+LSD+G+TGDGLVAALQ+L  +++   
Sbjct: 301 GLELIRTNVGDRYVVDAMRQKGYNVGGESSGHIVLSDFGTTGDGLVAALQILACMQESQI 360

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
           P+S +C  FE  PQ L+++S+K+  IL +S +  AI   +  L    RL++R SGTE  I
Sbjct: 361 PMSQLCQRFETVPQILKNISIKNKKILQNSKVKTAIDQVQKRLGKEVRLVIRPSGTEPFI 420

Query: 421 RIMAEGDDLSRIKRIVDDLAKVIPMIDS 448
           R+MAEGDD   I+  V +++ V+   DS
Sbjct: 421 RVMAEGDDQKVIEDGVAEISTVLIQYDS 448


>gi|304393348|ref|ZP_07375276.1| phosphoglucosamine mutase [Ahrensia sp. R2A130]
 gi|303294355|gb|EFL88727.1| phosphoglucosamine mutase [Ahrensia sp. R2A130]
          Length = 450

 Score =  278 bits (710), Expect = 2e-72,   Method: Composition-based stats.
 Identities = 268/447 (59%), Positives = 342/447 (76%)

Query: 2   KRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENS 61
           KR++FGTDGIRG +N  P+T    M++G+A G  F+      RVV+GKDTRLSGYM+EN+
Sbjct: 4   KRKYFGTDGIRGYANRSPMTAETAMKVGMAAGVAFKQGNHRHRVVVGKDTRLSGYMIENA 63

Query: 62  LVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKV 121
           LVAGFTAAGMD F LGP+P+PAVAMLTRS+RAD+GVMISASHN Y DNGIKLFGPDG+K+
Sbjct: 64  LVAGFTAAGMDVFQLGPVPTPAVAMLTRSMRADIGVMISASHNAYHDNGIKLFGPDGFKL 123

Query: 122 STDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVV 181
           S +IE  IE L+++DLT  L+    IG A RVDGV DRYIE  KRTLPR+++L GLR+V+
Sbjct: 124 SDEIELEIERLIDEDLTPQLAGGPDIGRASRVDGVDDRYIEFAKRTLPRNLSLSGLRVVI 183

Query: 182 DCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIA 241
           DCANGA+YKVAP+V WELGA+VV IG  PNG NIN +CGST+  +L RKV+EVRADIGIA
Sbjct: 184 DCANGAAYKVAPKVLWELGAEVVEIGTSPNGTNINSECGSTSTGALVRKVNEVRADIGIA 243

Query: 242 LDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLG 301
           LDGD DRVIIVDEK  +V+GDQ+MAL+A  +    LL G GIV T+MSN+GLER +   G
Sbjct: 244 LDGDADRVIIVDEKSNVVDGDQLMALVAGSYRKKELLTGGGIVATIMSNLGLERCMQAQG 303

Query: 302 LSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKP 361
           L+L RT VGDRY++E+M+ +G+NVGGEQSGHI++SD+ +TGDGLVAALQVL  +++ DK 
Sbjct: 304 LNLARTAVGDRYVVEHMRKHGYNVGGEQSGHIVMSDHSTTGDGLVAALQVLAVVQESDKQ 363

Query: 362 VSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLIR 421
           VS +C+CF   PQ L++V   +   L   ++V +I D    L    RL++R SGTE LIR
Sbjct: 364 VSEVCNCFTPVPQVLKNVRYSEGEPLKDKAVVASIDDGRHRLANQGRLVIRKSGTEPLIR 423

Query: 422 IMAEGDDLSRIKRIVDDLAKVIPMIDS 448
           +MAEGDD   ++ +VDD+   +  + +
Sbjct: 424 VMAEGDDAGLVRNVVDDICDTLRKVAA 450


>gi|146276701|ref|YP_001166860.1| phosphoglucosamine mutase [Rhodobacter sphaeroides ATCC 17025]
 gi|166990423|sp|A4WQ91|GLMM_RHOS5 RecName: Full=Phosphoglucosamine mutase
 gi|145554942|gb|ABP69555.1| phosphoglucosamine mutase [Rhodobacter sphaeroides ATCC 17025]
          Length = 447

 Score =  277 bits (709), Expect = 2e-72,   Method: Composition-based stats.
 Identities = 226/446 (50%), Positives = 307/446 (68%), Gaps = 4/446 (0%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKK-KHRRVVIGKDTRLSGYMLE 59
           M R+ FGTDG+RG++N++P+T    +R+G A G  FR       RVVIGKDTRLSGYMLE
Sbjct: 1   MTRKLFGTDGVRGRANSYPMTAEVALRLGAAAGRYFRPVGAGSPRVVIGKDTRLSGYMLE 60

Query: 60  NSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGY 119
           N+L AG T+ GM+  +LGP+P+PAV  LTRS+RAD+GVMISASHNP++DNGIK FGPDG+
Sbjct: 61  NALTAGLTSTGMNVLLLGPVPTPAVGFLTRSMRADLGVMISASHNPHEDNGIKFFGPDGF 120

Query: 120 KVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRI 179
           K+S + E  IE +L  ++        +IG AKR+D    RY E+ K T P  + L GL++
Sbjct: 121 KLSDEAEAEIEAILAGEIQPA--QPGNIGRAKRIDDGRGRYQEYCKTTFPAGLRLDGLKV 178

Query: 180 VVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIG 239
           V+DCANGA+Y+ APEV WELGA+V+ +G +P+G NINL CGST+  +    V    AD+G
Sbjct: 179 VIDCANGAAYRAAPEVLWELGAEVIPLGVEPDGKNINLRCGSTHPEAAAEAVRAHGADVG 238

Query: 240 IALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAG 299
           I LDGD DRVII+DE+G   +GDQIMAL A  W     LR   +V TVMSN+GLERF++ 
Sbjct: 239 ICLDGDADRVIILDEQGRQADGDQIMALFAARWAEEGRLRDATLVATVMSNLGLERFLSA 298

Query: 300 LGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYD 359
            GL L+RT VGDRY++E M+  G+N+GGEQSGHI+++D+ +TGDGL+A LQ L  + Q  
Sbjct: 299 RGLRLERTPVGDRYVVEAMRRGGWNLGGEQSGHIVMTDFATTGDGLLAGLQFLAAMAQTG 358

Query: 360 KPVSTICHCFEEYPQFLRSVSV-KDTSILNSSSIVQAIADAESELRGIDRLIVRASGTES 418
           +  S +   FE  PQ L++V        L + S+   I +AE  L G  RL++R SGTE 
Sbjct: 359 RKASELSRSFETVPQLLQNVRYAAGQEPLTAPSVQAVIREAEVRLNGSGRLLIRKSGTEP 418

Query: 419 LIRIMAEGDDLSRIKRIVDDLAKVIP 444
           LIR+MAE +D + ++ +V+++   + 
Sbjct: 419 LIRVMAECEDEALLRDVVEEIVAAVK 444


>gi|90425588|ref|YP_533958.1| phosphoglucosamine mutase [Rhodopseudomonas palustris BisB18]
 gi|122475316|sp|Q20YZ7|GLMM_RHOPB RecName: Full=Phosphoglucosamine mutase
 gi|90107602|gb|ABD89639.1| phosphoglucosamine mutase [Rhodopseudomonas palustris BisB18]
          Length = 450

 Score =  277 bits (708), Expect = 2e-72,   Method: Composition-based stats.
 Identities = 258/443 (58%), Positives = 333/443 (75%), Gaps = 1/443 (0%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M RR+FGTDGIRG++N   ITP   M++G A G +F+  +   RVVIGKDTRLSGYM+E 
Sbjct: 1   MSRRYFGTDGIRGRAN-GLITPELAMKVGQAAGLVFQRGEYRHRVVIGKDTRLSGYMIET 59

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +LVAGFT+ GMD  +LGP+P+PAVAMLT+S+RAD+GVMISASHN ++DNGIKLFGP G+K
Sbjct: 60  ALVAGFTSVGMDVLLLGPMPTPAVAMLTKSMRADLGVMISASHNLFEDNGIKLFGPLGFK 119

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +S D+E +IE LL++ L   L+   S+G A+R+DGVHDRYIE  KRTLPRD++L GLR+V
Sbjct: 120 LSDDVEKQIEQLLDESLDKKLAESASLGRARRIDGVHDRYIEFAKRTLPRDLSLDGLRVV 179

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           +DCA+GA+YKV PE  WELGADV+ IG +P+G NIN +CGST   +L RKV E+RADIGI
Sbjct: 180 IDCAHGAAYKVVPEALWELGADVIAIGVEPDGFNINKECGSTAPEALSRKVREMRADIGI 239

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           ALDGD DRVI+VDE+G +V+GDQ++A+IA+ W     L   GIV TVMSN+GLERF+   
Sbjct: 240 ALDGDADRVILVDERGHVVDGDQLLAVIAQSWKEDGRLSKPGIVATVMSNLGLERFLQSN 299

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           G+ + RT VGDRY++E M   G+NVGGE SGHIILSDY +TGDG VAALQVL  +++  +
Sbjct: 300 GIEMVRTPVGDRYVLEQMLKQGYNVGGEPSGHIILSDYATTGDGFVAALQVLAVVQKLGR 359

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
           PVS +CH FE  PQ L++V  +    L    +  AI  AE  L G  RL+VR+SGTE +I
Sbjct: 360 PVSEVCHLFEPLPQVLKNVRYRAGKPLEDDEVKSAIHAAEKRLNGHGRLLVRSSGTEPVI 419

Query: 421 RIMAEGDDLSRIKRIVDDLAKVI 443
           R+M EGDD   ++ +VD +   +
Sbjct: 420 RVMGEGDDREMVEEVVDTICSAL 442


>gi|299134296|ref|ZP_07027489.1| phosphoglucosamine mutase [Afipia sp. 1NLS2]
 gi|298591043|gb|EFI51245.1| phosphoglucosamine mutase [Afipia sp. 1NLS2]
          Length = 448

 Score =  277 bits (708), Expect = 2e-72,   Method: Composition-based stats.
 Identities = 255/444 (57%), Positives = 341/444 (76%), Gaps = 1/444 (0%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M R++FGTDGIRG++N   ITP   +++G A G +F+  +   RVVIGKDTRLSGYM+E 
Sbjct: 1   MVRKYFGTDGIRGRAN-GLITPELALKVGQAAGLVFQRGEYRHRVVIGKDTRLSGYMIET 59

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           ++VAGFT+ GMD  +LGPIP+PAVAMLT+S+RAD+GVMISASHN + DNGIKLFGP G+K
Sbjct: 60  AMVAGFTSVGMDVLLLGPIPTPAVAMLTKSMRADLGVMISASHNLFDDNGIKLFGPSGFK 119

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +S ++E +IE L+++++   L+    +G A+R+DGVHDRYIE  KRTLPRD++L+GLR+V
Sbjct: 120 LSDEVELQIEELMDENIDKRLAQSAHLGRARRIDGVHDRYIEFAKRTLPRDLSLEGLRVV 179

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           VDCANGA+YKV PE  WELGADV+ IG +P+G NIN +CGST+  +L RKV E+RAD+GI
Sbjct: 180 VDCANGAAYKVVPEALWELGADVITIGAEPDGFNINKECGSTSPEALSRKVREMRADVGI 239

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           ALDGD DRV+++DE+G +V+GDQ++A+IA+ W     L   GIV TVMSN+GLERF+AG 
Sbjct: 240 ALDGDADRVLVIDERGHLVDGDQLLAVIAQSWKEDGRLAKPGIVATVMSNLGLERFLAGE 299

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           GLS+ RT VGDRY++E M   G+N+GGE SGHII+SD+ +TGDG VAALQVL  +++  +
Sbjct: 300 GLSMVRTPVGDRYVLEQMLAQGYNLGGEPSGHIIMSDFTTTGDGFVAALQVLAVVQKLGR 359

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
           PVS +CH FE  PQ L++V  +    L +  +  AIADAE +L G  RL+VR+SGTE +I
Sbjct: 360 PVSEVCHRFEALPQILKNVRYRTGKPLENPQVKSAIADAEKKLNGNGRLLVRSSGTEPVI 419

Query: 421 RIMAEGDDLSRIKRIVDDLAKVIP 444
           R+M EGDD  R++  VD +   + 
Sbjct: 420 RVMGEGDDRDRVEEAVDMIVSALS 443


>gi|87198506|ref|YP_495763.1| phosphoglucosamine mutase [Novosphingobium aromaticivorans DSM
           12444]
 gi|123490724|sp|Q2GB44|GLMM_NOVAD RecName: Full=Phosphoglucosamine mutase
 gi|87134187|gb|ABD24929.1| phosphoglucosamine mutase [Novosphingobium aromaticivorans DSM
           12444]
          Length = 445

 Score =  277 bits (708), Expect = 2e-72,   Method: Composition-based stats.
 Identities = 247/445 (55%), Positives = 324/445 (72%), Gaps = 2/445 (0%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M R+FFGTDGIRG++N+  +T    M++G A G  F+      RVVIGKDTRLSGYM+E+
Sbjct: 1   MARKFFGTDGIRGRTNSGVMTAEIAMKVGQAAGTYFQRGTHRHRVVIGKDTRLSGYMMES 60

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           ++ AGFT+ GMD  +LGP+P+PAVAMLTRS+RAD+GVMISASHNP++DNGIKLFGPDGYK
Sbjct: 61  AMTAGFTSVGMDVVLLGPMPTPAVAMLTRSMRADLGVMISASHNPFEDNGIKLFGPDGYK 120

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +S + E  IE++L  +L   L+    +G A+R++    RYI  VK +LP +V L GLRIV
Sbjct: 121 LSDEAELTIESMLLQEL--PLADAAQVGRARRIEDARGRYIHAVKASLPDNVRLDGLRIV 178

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           VDCANGA+Y V P   WELGA+V+ IG +PNG NIN   GST++ +++ KV E RADIGI
Sbjct: 179 VDCANGAAYHVTPSALWELGAEVIAIGVEPNGKNINAGVGSTHLDAIKAKVRETRADIGI 238

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           ALDGD DR+I+VDEK   V+GDQIMALI  +  +   LRG G+V TVMSN+GLER +   
Sbjct: 239 ALDGDADRLIVVDEKCQTVDGDQIMALIGTQLAARGELRGGGVVATVMSNLGLERHLNAH 298

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           GL+L+RT VGDRY++E M++ GFNVGGEQSGH+IL+D+ +TGDG VAALQVL  +    K
Sbjct: 299 GLTLERTAVGDRYVLERMRSGGFNVGGEQSGHMILTDHATTGDGTVAALQVLAALVSSGK 358

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
           P S + H F+  PQ L++V       L + S+ +AIA+AE+ L G  RL++R SGTE LI
Sbjct: 359 PASELLHLFDPVPQLLKNVRFTGGKPLEAKSVKEAIAEAEARLAGKGRLVIRPSGTEPLI 418

Query: 421 RIMAEGDDLSRIKRIVDDLAKVIPM 445
           R+MAEGDD   ++ +VD +   +  
Sbjct: 419 RVMAEGDDADEVEAVVDQICDAVRK 443


>gi|49474665|ref|YP_032707.1| phosphoglucomutase /phosphomannomutasefamily protein mrsA
           [Bartonella quintana str. Toulouse]
 gi|81646808|sp|Q6FYQ7|GLMM_BARQU RecName: Full=Phosphoglucosamine mutase
 gi|49240169|emb|CAF26633.1| Phosphoglucomutase /phosphomannomutasefamily protein mrsA
           [Bartonella quintana str. Toulouse]
          Length = 459

 Score =  277 bits (708), Expect = 3e-72,   Method: Composition-based stats.
 Identities = 270/448 (60%), Positives = 351/448 (78%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M +++FGTDGIRGK+N FP+TP+F M++G+AVG LFR +++ RRVVIGKDTRLSGYMLEN
Sbjct: 1   MAQKYFGTDGIRGKANVFPMTPDFAMKVGMAVGVLFRSQRQSRRVVIGKDTRLSGYMLEN 60

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +LV+GFTAAGM+AF+LGP+P+PAVAML RSLRAD+GVMISASHNP+ DNGIKLFGPDG+K
Sbjct: 61  ALVSGFTAAGMEAFLLGPVPTPAVAMLCRSLRADLGVMISASHNPFYDNGIKLFGPDGFK 120

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +S +IE +IE L++ DL+  L+    IG+AKRV+G   RYIE+ KRTLPRDV L  LRIV
Sbjct: 121 LSDEIEKKIEQLIDTDLSKSLASCAEIGYAKRVEGDIYRYIEYAKRTLPRDVRLDALRIV 180

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           VDCANGA+YK AP   WELGA+V  I D PNG NIN  CGST++ SL++KVHEVRAD+GI
Sbjct: 181 VDCANGAAYKAAPRALWELGAEVFAINDAPNGTNINQKCGSTDLASLKQKVHEVRADVGI 240

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           ALDGDGDRV+IVDEK   V+GDQ++A+IA  W     L+GNG+VTT+MSN+GLERF+   
Sbjct: 241 ALDGDGDRVLIVDEKAQTVDGDQLIAVIAEHWHKTGRLQGNGVVTTIMSNLGLERFLNRK 300

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           GL L RT VGDRY+++ M+  G+N+GGE SGHI+LSD+G+TGDGLVAALQ+L  +++   
Sbjct: 301 GLELVRTNVGDRYVVDAMRQKGYNIGGEASGHIVLSDFGTTGDGLVAALQILACMQESQS 360

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
            +S +C  FE  PQ L++V++K+ ++L  + +  AI  A   L    RL++RASGTE +I
Sbjct: 361 SMSHLCKRFEPVPQILKNVTIKNKNVLKKNQVKTAIDQATQRLGNEARLVIRASGTEPVI 420

Query: 421 RIMAEGDDLSRIKRIVDDLAKVIPMIDS 448
           RIM EGD+   +  +V ++  VI   D+
Sbjct: 421 RIMGEGDEREVLDAVVAEMVDVIAHHDA 448


>gi|302879455|ref|YP_003848019.1| phosphoglucosamine mutase [Gallionella capsiferriformans ES-2]
 gi|302582244|gb|ADL56255.1| phosphoglucosamine mutase [Gallionella capsiferriformans ES-2]
          Length = 450

 Score =  277 bits (707), Expect = 3e-72,   Method: Composition-based stats.
 Identities = 206/453 (45%), Positives = 295/453 (65%), Gaps = 8/453 (1%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRG----KKKHRRVVIGKDTRLSGY 56
           M +++FGTDGIRG+   FPITP F+M++G A G +       + +   V+IGKDTR+SGY
Sbjct: 1   MSKKYFGTDGIRGRVGDFPITPQFVMQLGYAAGRVLASAEHTRGERSAVLIGKDTRISGY 60

Query: 57  MLENSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGP 116
           MLE++L AG  AAG+D ++ GPIP+PAVA LTR+LR   G++ISASHNPY+DNGIK F  
Sbjct: 61  MLESALQAGLIAAGVDVYLAGPIPTPAVAYLTRTLRLQAGIVISASHNPYEDNGIKFFSA 120

Query: 117 DGYKVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQG 176
           +G K+  DIE  IE  L+ +++  +     +G AKR+D    RYIE  K T P  + L+G
Sbjct: 121 NGSKLPDDIEHAIEAGLDGEIS--IDSATGLGKAKRLDDAVGRYIEFCKSTFPSAMNLRG 178

Query: 177 LRIVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRA 236
           ++IVVDCA+GA+Y +A  V  ELGA+V+ IG KP+G NIN   G+T   +LQ  V E +A
Sbjct: 179 MKIVVDCAHGATYHIAQHVLHELGAEVIAIGVKPDGKNINDGYGATAPANLQAAVVEHQA 238

Query: 237 DIGIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERF 296
           D+GIALDGDGDR+++VD KG + +GDQ++ +IAR+      L G  + T  M+N+  E  
Sbjct: 239 DLGIALDGDGDRLVMVDSKGVLYDGDQLIYVIARQRQEQGRLVGGVVGTL-MTNLAFEHA 297

Query: 297 IAGLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIK 356
           +  +G+   R  VGDRY+ME +  NG+ +GGE SGHII  D  STGDG+V+AL+VL  ++
Sbjct: 298 MQKMGVPFLRARVGDRYVMELLHQNGWELGGENSGHIICLDKHSTGDGIVSALEVLHALR 357

Query: 357 QYDKPVSTICHCFEEYPQFLRSVSV-KDTSILNSSSIVQAIADAESELRGIDRLIVRASG 415
             +  +S      + YPQ L  V V K    L  + +  A+A AE  L G  R+++R SG
Sbjct: 358 TQNVSLSEAAGDLKLYPQVLIYVRVAKGVDCLGHADVKAAVAIAERALDGRGRVLLRPSG 417

Query: 416 TESLIRIMAEGDDLSRIKRIVDDLAKVIPMIDS 448
           TE L+R+M EG+D + +++    +A V+  + +
Sbjct: 418 TEPLLRVMVEGEDKALVEQSAKQIADVVRKLAN 450


>gi|75677154|ref|YP_319575.1| phosphoglucosamine mutase [Nitrobacter winogradskyi Nb-255]
 gi|84029245|sp|Q3SNB8|GLMM_NITWN RecName: Full=Phosphoglucosamine mutase
 gi|74422024|gb|ABA06223.1| phosphoglucosamine mutase [Nitrobacter winogradskyi Nb-255]
          Length = 448

 Score =  277 bits (707), Expect = 3e-72,   Method: Composition-based stats.
 Identities = 255/443 (57%), Positives = 336/443 (75%), Gaps = 1/443 (0%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M RR+FGTDGIRG++N   ITP   M++G A G +F+  +   RVVIGKDTRLSGYM+E 
Sbjct: 1   MSRRYFGTDGIRGRAN-GLITPELAMKVGQAAGLVFQRGEHRHRVVIGKDTRLSGYMIEY 59

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +LVAGFT+ GMD  +LGP+P+PAVAMLT+S+RAD+GVMISASHN ++DNGIK+FGP G+K
Sbjct: 60  ALVAGFTSVGMDVLLLGPMPTPAVAMLTKSMRADLGVMISASHNLFEDNGIKMFGPRGFK 119

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +S ++E +IE LL+++L   L+   ++G A+R+DGVHDRYIE  KRTLPR+++L+GLR+V
Sbjct: 120 LSDEVEKKIEKLLDENLDKKLAQSRNLGRARRIDGVHDRYIEFAKRTLPRELSLEGLRVV 179

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           VDCA+GA+YKV PE  WELGADVV IG +P+G+NIN +CGST   +L RKV E+R DIGI
Sbjct: 180 VDCAHGAAYKVVPEALWELGADVVPIGVEPDGLNINKECGSTAPEALCRKVREMRGDIGI 239

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           ALDGD DRVIIVDE+G +V+GDQ++A+IA  W     L   GIV TVMSN+GLERF+   
Sbjct: 240 ALDGDADRVIIVDERGHVVDGDQLLAVIAESWKEDGRLTKPGIVATVMSNLGLERFLKDR 299

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
            LSL RT VGDRY++E M   G+N+GGEQSGHIILSDY +TGDG V+ALQVL  +++  +
Sbjct: 300 DLSLVRTPVGDRYVLEQMLKQGYNLGGEQSGHIILSDYATTGDGFVSALQVLAVVQKLGR 359

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
           PVS +CH FE  PQ L++   ++   L+ + +  AI   E  L G  RL+VR+SGTE +I
Sbjct: 360 PVSQVCHKFEPLPQILKNFRYRNGKPLDRAEVKSAITAGEKRLNGHGRLLVRSSGTEPVI 419

Query: 421 RIMAEGDDLSRIKRIVDDLAKVI 443
           R+M EGDD   ++ +VD +   +
Sbjct: 420 RVMGEGDDRILVEEVVDTIVSAL 442


>gi|83312298|ref|YP_422562.1| phosphoglucosamine mutase [Magnetospirillum magneticum AMB-1]
 gi|123541254|sp|Q2W2C2|GLMM_MAGMM RecName: Full=Phosphoglucosamine mutase
 gi|82947139|dbj|BAE52003.1| Phosphomannomutase [Magnetospirillum magneticum AMB-1]
          Length = 451

 Score =  277 bits (707), Expect = 3e-72,   Method: Composition-based stats.
 Identities = 242/447 (54%), Positives = 314/447 (70%), Gaps = 3/447 (0%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M R+ FGTDGIRG +NT P+T    M++G+A G  F        VVIGKDTRLSGY+LE 
Sbjct: 1   MTRKLFGTDGIRGTANTDPMTAEMAMKLGMAAGRHFTRGDHRHVVVIGKDTRLSGYLLEP 60

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +L AGF + GMD  +LGP+P+PAVA+LTRS+RAD+GVMISASHNPY+DNGIKLFGPDG+K
Sbjct: 61  ALTAGFISVGMDVVLLGPLPTPAVALLTRSMRADLGVMISASHNPYEDNGIKLFGPDGFK 120

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +S + E  IE  + + L S     D +G AKR+D    RYIE+ K T PR + L GL+IV
Sbjct: 121 LSDEDELTIEASMSNGLESCRVGSDHLGRAKRLDDAAGRYIEYAKYTFPRGLRLDGLKIV 180

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           VDCANGA+YKVAP V WELGA+V+ +   P+G NIN +CGS +  +++ +V    A +GI
Sbjct: 181 VDCANGAAYKVAPTVLWELGAEVIPVAVNPDGFNINKNCGSLHTETMREQVVAHGAHLGI 240

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           ALDGD DRV++ DE G +++GDQ+MALI   W     L+G GIV TVMSN+GLERF+   
Sbjct: 241 ALDGDADRVVLCDELGHMIDGDQLMALIGDLWHRSGQLKGGGIVATVMSNLGLERFLDQR 300

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           GL   RT VGDRY++E+M+ +GFNVGGEQSGHIILSD+ +TGDGLVA LQVL  + Q  K
Sbjct: 301 GLKTIRTAVGDRYVLEHMRRDGFNVGGEQSGHIILSDHSTTGDGLVAGLQVLAALVQSGK 360

Query: 361 PVSTICHCFEEYPQFLRSVSVKD---TSILNSSSIVQAIADAESELRGIDRLIVRASGTE 417
           P S +   F   PQ L++V V       +L + ++  AI DAE++L G  RL++R SGTE
Sbjct: 361 PASEMLRLFTPLPQVLKNVRVAKGSVAEVLAAPAVEAAIRDAEAKLAGQGRLLIRKSGTE 420

Query: 418 SLIRIMAEGDDLSRIKRIVDDLAKVIP 444
            LIR+MAEG+D   ++  VD + + I 
Sbjct: 421 PLIRVMAEGEDEGLVEASVDAIVETIR 447


>gi|95930468|ref|ZP_01313204.1| phosphoglucosamine mutase [Desulfuromonas acetoxidans DSM 684]
 gi|95133508|gb|EAT15171.1| phosphoglucosamine mutase [Desulfuromonas acetoxidans DSM 684]
          Length = 456

 Score =  277 bits (707), Expect = 3e-72,   Method: Composition-based stats.
 Identities = 217/445 (48%), Positives = 300/445 (67%), Gaps = 2/445 (0%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M ++FFGTDG+RG +N +P+T    M++G AV YLF+G  K RR+VIGKDTRLSGYM+EN
Sbjct: 1   MTKKFFGTDGVRGVANVYPMTTEIAMQLGRAVAYLFKGSDKRRRIVIGKDTRLSGYMIEN 60

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           ++ +G  + G+D  ++GP+P+P +A +T S+RAD GV+ISASHNPYQDNGIK F  +G K
Sbjct: 61  AMASGICSMGVDVQLVGPLPTPGIAFITNSMRADAGVVISASHNPYQDNGIKFFSNEGLK 120

Query: 121 VSTDIEDRIETLL-EDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRI 179
           +  ++E R+E L+  ++L       D +G A R+D    RYI  +K T PRD+ L+G++I
Sbjct: 121 LPDEMELRLEQLMFSEELDVLRPTADEVGRAFRIDDATGRYIVFLKYTFPRDLDLRGMKI 180

Query: 180 VVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIG 239
           VVDCANGA+YKVAP VF ELGADVV IG  PNG NIN  CGS     L   V E  AD+G
Sbjct: 181 VVDCANGAAYKVAPAVFEELGADVVRIGVSPNGTNINAGCGSLYPAELADAVKEHGADVG 240

Query: 240 IALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAG 299
           +ALDGD DRVI VDE G  V+GD IMA+ A   +    L  N +V TVMSN+GL+  +  
Sbjct: 241 VALDGDADRVIFVDETGREVDGDHIMAICATHMLGEGTLAHNTLVATVMSNMGLDIALRR 300

Query: 300 LGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYD 359
            G ++ +T VGDRY++E M   G+N+GGEQSGH+I  D+ +TGDG+++ALQ L  +++  
Sbjct: 301 AGGTVVKTGVGDRYVVEEMLKKGYNLGGEQSGHMIFFDHNTTGDGVLSALQTLAIMQRTG 360

Query: 360 KPVSTICHCFEEYPQFLRSVSVKDTSILN-SSSIVQAIADAESELRGIDRLIVRASGTES 418
           KP+S +       PQ L +V VK+   L    ++ + I     EL    R+++R SGTE 
Sbjct: 361 KPLSQLAGVMTALPQLLVNVRVKEKVDLATVPAVQRVIDACNEELGETGRVLIRYSGTEP 420

Query: 419 LIRIMAEGDDLSRIKRIVDDLAKVI 443
           L+RIM EG++  +I+R+ DD+A  +
Sbjct: 421 LLRIMLEGENDQQIQRLADDIADAV 445


>gi|85715280|ref|ZP_01046263.1| phosphoglucosamine mutase [Nitrobacter sp. Nb-311A]
 gi|85697926|gb|EAQ35800.1| phosphoglucosamine mutase [Nitrobacter sp. Nb-311A]
          Length = 448

 Score =  276 bits (706), Expect = 4e-72,   Method: Composition-based stats.
 Identities = 254/443 (57%), Positives = 339/443 (76%), Gaps = 1/443 (0%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M R++FGTDGIRG++N   ITP   M++G A G +F+  +   RVVIGKDTRLSGYM+E 
Sbjct: 1   MSRKYFGTDGIRGRAN-GLITPELAMKVGQAAGLVFQRGEYRHRVVIGKDTRLSGYMIEY 59

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +LVAGFT+ GMD  +LGP+P+PAVAMLT+S+RAD+GVMISASHN ++DNGIK+FGP G+K
Sbjct: 60  ALVAGFTSVGMDVLLLGPMPTPAVAMLTKSMRADLGVMISASHNLFEDNGIKMFGPRGFK 119

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +S ++E +IE LL+++L   L+   ++G A+R+DGVHDRYIE  KRTLPR+++L+GLR+V
Sbjct: 120 LSDEVEKKIEQLLDENLDKKLAQSANLGRARRIDGVHDRYIEFAKRTLPRELSLEGLRVV 179

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           VDCA+GA+YKV PE  WELGADV+ IG +P+G+NIN +CGST   +L RKV E+R DIGI
Sbjct: 180 VDCAHGAAYKVVPEALWELGADVIPIGVEPDGLNINKECGSTAPEALCRKVREMRGDIGI 239

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           ALDGD DRVIIVDE+G +V+GDQ++A+IA  W     L   GIV TVMSN+GLERF+ G 
Sbjct: 240 ALDGDADRVIIVDERGHVVDGDQLLAVIAESWKEDGRLTRPGIVATVMSNLGLERFLQGH 299

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
            LSL RT VGDRY++E M  +G+N+GGEQSGHIILSDY +TGDG V+ALQVL  +++  +
Sbjct: 300 ELSLVRTPVGDRYVLEQMLKHGYNLGGEQSGHIILSDYATTGDGFVSALQVLAVVQKLGR 359

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
           PVS +CH FE  PQ L++   ++ + L+ + +  AI   E  L G  RL+VR+SGTE +I
Sbjct: 360 PVSEVCHKFEPMPQILKNFRYRNGTPLDRAEVRSAITAGEKRLNGHGRLLVRSSGTEPVI 419

Query: 421 RIMAEGDDLSRIKRIVDDLAKVI 443
           R+M EGDD   ++ +VD +   +
Sbjct: 420 RVMGEGDDRILVEEVVDTIVSAL 442


>gi|300023917|ref|YP_003756528.1| phosphoglucosamine mutase [Hyphomicrobium denitrificans ATCC 51888]
 gi|299525738|gb|ADJ24207.1| phosphoglucosamine mutase [Hyphomicrobium denitrificans ATCC 51888]
          Length = 449

 Score =  276 bits (706), Expect = 4e-72,   Method: Composition-based stats.
 Identities = 254/439 (57%), Positives = 326/439 (74%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M RR+FGTDGIRG++N  P+T    +++G+A G +FR      RVVIGKDTRLSGYMLE 
Sbjct: 1   MSRRYFGTDGIRGQANRHPMTSEIALKVGMAAGTMFRSGNHRHRVVIGKDTRLSGYMLEA 60

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +L++GFT+ GMD F+LGP+P+PAVAMLTRSLRAD+GVM+SASHNP  DNGIKLF  DGYK
Sbjct: 61  ALMSGFTSVGMDVFLLGPMPTPAVAMLTRSLRADLGVMLSASHNPSSDNGIKLFDADGYK 120

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +S ++E +IE L++ D  + L+  + IG A RV+   +RYIE  KRT+P+ + L GLRIV
Sbjct: 121 LSDEMERQIEDLIDTDSKTLLAPAEQIGRATRVESAQERYIEFAKRTMPKHLRLAGLRIV 180

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           +DCANGA+YKVAPE  WELGA+V+ IG +PNG NINL+CGST    L  KV E RADIGI
Sbjct: 181 IDCANGAAYKVAPEALWELGAEVIKIGVEPNGQNINLNCGSTAPDLLVEKVKEFRADIGI 240

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
            LDGD DRV+IVDEKG IVNGDQ+MA+IA  W     L   GIV TVMSN+GLER++  +
Sbjct: 241 GLDGDADRVVIVDEKGRIVNGDQLMAVIADSWQRSGQLTAGGIVATVMSNLGLERYLKSI 300

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           GL++ RT VGDRY+ E+M+ +GFNVGGEQSGHI+LSD+ +TGDGLV+ALQ+L  +    K
Sbjct: 301 GLTMARTPVGDRYVTEHMRKHGFNVGGEQSGHIVLSDFTTTGDGLVSALQILACVVATGK 360

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
            VS +C  F   PQ LR+V       L+ + +V+AI  A+++L    RL++R SGTE +I
Sbjct: 361 TVSEVCDRFHPLPQILRNVRYASGKPLDDNRVVKAIEGAKAKLGENGRLVIRPSGTEPVI 420

Query: 421 RIMAEGDDLSRIKRIVDDL 439
           R+MAEGDD   +  IV D+
Sbjct: 421 RVMAEGDDEQVVSSIVGDI 439


>gi|149913091|ref|ZP_01901625.1| hypothetical protein RAZWK3B_03845 [Roseobacter sp. AzwK-3b]
 gi|149813497|gb|EDM73323.1| hypothetical protein RAZWK3B_03845 [Roseobacter sp. AzwK-3b]
          Length = 446

 Score =  276 bits (706), Expect = 4e-72,   Method: Composition-based stats.
 Identities = 226/446 (50%), Positives = 312/446 (69%), Gaps = 3/446 (0%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M ++ FGTDG+RG++N++P+T    +++G A G  FR   +  RVVIGKDTRLSGYM+EN
Sbjct: 1   MSQKLFGTDGVRGRANSWPMTAEIALKLGAAAGRYFRRDTQEHRVVIGKDTRLSGYMIEN 60

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +L AGFT+ GM+ F+LGP+P+PA+  LT  LRADVGVMISASHNP  DNGIK FGPDG+K
Sbjct: 61  ALTAGFTSTGMNVFLLGPMPTPAIGYLTHGLRADVGVMISASHNPASDNGIKFFGPDGFK 120

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +S + E  IE L+ + + +     ++IG AKR D    RY+E+ K T P    L GLRIV
Sbjct: 121 LSDEAEAGIEALMMEGVQAAA--PENIGRAKRFDDAMGRYVEYAKTTFPSRRRLDGLRIV 178

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           VDCANGA+YK AP V WELGA+V+ +G +P+G NIN +CGST+  +  +KV E RADIGI
Sbjct: 179 VDCANGAAYKTAPAVLWELGAEVISMGVEPDGSNINRNCGSTHPEAAAKKVIETRADIGI 238

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
            LDGD DRV+++DEKG I +GDQIM LIA  W     L G+ +V TVMSN+GLER++   
Sbjct: 239 CLDGDADRVVLIDEKGQIADGDQIMGLIAGRWHQEGRLAGDALVATVMSNLGLERYLNDR 298

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           G+ +KRT VGDRY++E M+  G ++GGEQSGHI+++DY +TGDGL+ ALQ L  + +  +
Sbjct: 299 GIGMKRTAVGDRYVVEAMRAGGHSLGGEQSGHIVMTDYATTGDGLIGALQFLACMVETGQ 358

Query: 361 PVSTICHCFEEYPQFLRSVSVK-DTSILNSSSIVQAIADAESELRGIDRLIVRASGTESL 419
             ST+ H F+  PQ L ++  +   + L + ++ +AIA  E  L    RL++R SGTE L
Sbjct: 359 KASTLAHVFDPVPQKLINLRYESGKTPLEAEAVKEAIAMGEKALGRDGRLLIRKSGTEPL 418

Query: 420 IRIMAEGDDLSRIKRIVDDLAKVIPM 445
           IR+MAE  D + + ++++D+   +  
Sbjct: 419 IRVMAEAVDPAMLDKVLNDVVAAVQK 444


>gi|90418981|ref|ZP_01226892.1| phosphoglucomutase/phosphomannomutase [Aurantimonas manganoxydans
           SI85-9A1]
 gi|90337061|gb|EAS50766.1| phosphoglucomutase/phosphomannomutase [Aurantimonas manganoxydans
           SI85-9A1]
          Length = 449

 Score =  276 bits (706), Expect = 4e-72,   Method: Composition-based stats.
 Identities = 262/445 (58%), Positives = 337/445 (75%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M RR+FGTDGIRG +N  P+T    MR+G+A G +F+      RVVIGKDTR S YM+EN
Sbjct: 2   MSRRYFGTDGIRGTANRHPMTAEVAMRVGMAAGLVFQRGSYRHRVVIGKDTRRSSYMIEN 61

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           ++VAGFTAAG+D F+LGP+P+PAVAMLTRSLRAD+GVMISASHNP++DNGIKLFGPDGYK
Sbjct: 62  AMVAGFTAAGVDVFLLGPMPTPAVAMLTRSLRADIGVMISASHNPFEDNGIKLFGPDGYK 121

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +S ++E RIE LL++DLT  L+  D +G AKR+DGVHDRYIE  KRTLPR+++L+G+R+ 
Sbjct: 122 LSDELELRIEALLDEDLTPRLATGDGLGRAKRIDGVHDRYIEAAKRTLPRELSLEGVRVA 181

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           +DCANGA+Y+VAP+V WELGA++V +G  P+G NIN +CGST   +L  KV EVRADIGI
Sbjct: 182 IDCANGAAYRVAPDVLWELGAEIVKLGVDPDGTNINRNCGSTAPAALIEKVKEVRADIGI 241

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           ALDGD DRV+IVDE+G +V+GDQ+MA+IA  W     L   GIV TVMSN+GLERF++  
Sbjct: 242 ALDGDADRVLIVDERGEVVDGDQLMAVIAESWAEDGRLAAGGIVATVMSNLGLERFLSDH 301

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
            L L RT VGDRY++E+M+ +G+NVGGEQSGHI+LSD+G+TGDGLVAALQVL  +++   
Sbjct: 302 DLQLARTAVGDRYVVEHMRQHGYNVGGEQSGHIVLSDFGTTGDGLVAALQVLAVVQRKGG 361

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
            VS +C  FE  PQ L++      + L    +  AI+     L    RL++RASGTE LI
Sbjct: 362 TVSEVCRRFEPVPQILKNFRYSGGAPLERQRVQDAISAGRDRLGEGGRLVIRASGTEPLI 421

Query: 421 RIMAEGDDLSRIKRIVDDLAKVIPM 445
           R+MAEGDD   +  +VDD+   +  
Sbjct: 422 RVMAEGDDRGLVNAVVDDILGALQQ 446


>gi|148553010|ref|YP_001260592.1| phosphoglucosamine mutase [Sphingomonas wittichii RW1]
 gi|172048091|sp|A5V2D8|GLMM_SPHWW RecName: Full=Phosphoglucosamine mutase
 gi|148498200|gb|ABQ66454.1| phosphoglucosamine mutase [Sphingomonas wittichii RW1]
          Length = 445

 Score =  276 bits (706), Expect = 4e-72,   Method: Composition-based stats.
 Identities = 249/445 (55%), Positives = 321/445 (72%), Gaps = 2/445 (0%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M RR+FGTDGIRG++N  P+T    M++G A G  F   +   RVVIGKDTRLSGYM+E+
Sbjct: 1   MGRRYFGTDGIRGRTNESPMTAEIAMKVGQAAGAHFVRGEHRHRVVIGKDTRLSGYMMES 60

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +LVAGFT+ GMD  +LGP+P+PAVAMLTRS+RAD+GVMISASHN + DNGIKLFGPDGYK
Sbjct: 61  ALVAGFTSVGMDCVLLGPMPTPAVAMLTRSMRADLGVMISASHNMFADNGIKLFGPDGYK 120

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +S D E  IE  LE  +   L+    IG A RV+    RY+  VK + P  + L GLR+V
Sbjct: 121 LSDDDETAIEARLEKPVK--LAASADIGRAHRVESARGRYVHAVKSSFPEHLRLDGLRVV 178

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           +DCA+GA+Y+VAP   WELGA+++ +G  PNG+NIN  CGST+  +LQ KV E RADIGI
Sbjct: 179 IDCAHGAAYEVAPLALWELGAELISMGVNPNGVNINDQCGSTDTRALQDKVRETRADIGI 238

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           ALDGD DR+IIVD +G +V+GDQ+MAL+A        LRG GIV TVMSN+GLERF+A  
Sbjct: 239 ALDGDADRLIIVDNEGRVVDGDQLMALVAVGAHRRGELRGGGIVATVMSNLGLERFLAEQ 298

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           GLSL RT+VGDRY++E M+  GFN+GGEQSGHI+++D+ +TGDGLVAALQVL  + +  K
Sbjct: 299 GLSLHRTKVGDRYVVEAMRAEGFNIGGEQSGHIVMTDHATTGDGLVAALQVLAQLVESGK 358

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
           P S + H F+  PQ L++V       L    ++ AIADAE +L G  RL++R SGTE LI
Sbjct: 359 PASELLHQFDPLPQLLKNVRFAGGEPLKDEKVIAAIADAEEKLTGTGRLVIRKSGTEPLI 418

Query: 421 RIMAEGDDLSRIKRIVDDLAKVIPM 445
           R+MAEG+D   ++ +VD +   +  
Sbjct: 419 RVMAEGEDKRLVEAMVDQICDAVRK 443


>gi|86748432|ref|YP_484928.1| phosphoglucosamine mutase [Rhodopseudomonas palustris HaA2]
 gi|123099006|sp|Q2J0J3|GLMM_RHOP2 RecName: Full=Phosphoglucosamine mutase
 gi|86571460|gb|ABD06017.1| phosphoglucosamine mutase [Rhodopseudomonas palustris HaA2]
          Length = 450

 Score =  276 bits (705), Expect = 5e-72,   Method: Composition-based stats.
 Identities = 256/443 (57%), Positives = 339/443 (76%), Gaps = 1/443 (0%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M RR+FGTDGIRG++N   ITP   +++G A G +F+      RVVIGKDTRLSGYM+EN
Sbjct: 1   MSRRYFGTDGIRGRAN-GLITPELALKVGQAAGLVFQRGDHRHRVVIGKDTRLSGYMIEN 59

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           ++VAGFT+ GMD  ++GP+P+PAVAMLT+S+RAD+GVMISASHN ++DNGIKLFGP G+K
Sbjct: 60  AMVAGFTSVGMDVLLVGPMPTPAVAMLTKSMRADLGVMISASHNMFEDNGIKLFGPLGFK 119

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +S D+E +IE LL++ +   LS   S+G A+R+DGVHDRYIE  KRTLPRD++L GLR+V
Sbjct: 120 LSDDVEKQIEQLLDEPMDKKLSESASLGRARRIDGVHDRYIEFAKRTLPRDLSLDGLRVV 179

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           VDCANGA+YKV PE  WELGADV+ IG +P+G NIN +CGST+  +L RKV E+RADIGI
Sbjct: 180 VDCANGAAYKVVPEALWELGADVISIGVEPDGFNINKECGSTSPEALCRKVREMRADIGI 239

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           ALDGD DRVI+VDE+G +++GDQ++A+IA+ W     L   GIV TVMSN+GLERF+A  
Sbjct: 240 ALDGDADRVIMVDERGHVIDGDQLLAVIAQSWKEDGRLARPGIVATVMSNLGLERFLASE 299

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           G+ L RT VGDRY++E M  +G+NVGGE SGHIILSDY +TGDG VAALQ+L  +++  +
Sbjct: 300 GIELVRTSVGDRYVLEAMLRDGYNVGGEASGHIILSDYATTGDGFVAALQILAVVQKLGR 359

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
           PVS +CH F+  PQ L++V  +    L+ + +  AI+DAE  L G  RL++R SGTE +I
Sbjct: 360 PVSEVCHRFDPLPQILKNVRYRAGRPLDDAGVQSAISDAEKRLNGHGRLLIRPSGTEPVI 419

Query: 421 RIMAEGDDLSRIKRIVDDLAKVI 443
           R+M EG+D   ++ +VD +   +
Sbjct: 420 RVMGEGEDRIMVEEVVDTIVDAL 442


>gi|94986636|ref|YP_594569.1| phosphoglucosamine mutase [Lawsonia intracellularis PHE/MN1-00]
 gi|158564221|sp|Q1MRX8|GLMM_LAWIP RecName: Full=Phosphoglucosamine mutase
 gi|94730885|emb|CAJ54248.1| phosphomannomutase [Lawsonia intracellularis PHE/MN1-00]
          Length = 451

 Score =  276 bits (705), Expect = 5e-72,   Method: Composition-based stats.
 Identities = 217/447 (48%), Positives = 308/447 (68%), Gaps = 2/447 (0%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M ++ FGTDG+RG+ N +P+TP   +R+G+A G  +R K    RVVIGKDTR+SGY+ EN
Sbjct: 1   MGKKLFGTDGLRGRVNIYPMTPEVALRLGLAAGTYYRRKSHRSRVVIGKDTRISGYIFEN 60

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +L AG  A+GMD F++GP+P+PAV+ LT ++RAD GV+ISASHNP+ DNGIKLF  DG+K
Sbjct: 61  ALTAGLLASGMDVFLVGPLPTPAVSFLTANMRADFGVVISASHNPFYDNGIKLFDADGFK 120

Query: 121 VST-DIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRI 179
           +         E +L+   T       S+G A ++     RYI ++K T P  ++L+GLRI
Sbjct: 121 IPDKAEHKISEMILDQSHTWDYPDPSSVGRAHKIKDALGRYIVYLKNTFPSTLSLEGLRI 180

Query: 180 VVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIG 239
           V+DCANGA+YKVAP    ELGA+++ IG  PNG+NIN  CGS     + +KV E+RADIG
Sbjct: 181 VLDCANGANYKVAPLALEELGAELIKIGTDPNGLNINHQCGSLFPEYVAKKVIEMRADIG 240

Query: 240 IALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAG 299
           +ALDGD DR+I+VDEKG I+NGDQIMAL A++ M  + L GN +V TVMSN+ LE F+  
Sbjct: 241 LALDGDADRLIVVDEKGIILNGDQIMALCAQDLMRQNKLPGNILVATVMSNMALEVFMKE 300

Query: 300 LGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYD 359
              +L R+ VGDRY+ME M+ +G   GGEQSGH+I  +Y +TGDGL+AALQ+LR +KQY+
Sbjct: 301 KKGALIRSNVGDRYVMEAMRKHGAMFGGEQSGHLIFREYSNTGDGLLAALQILRIMKQYE 360

Query: 360 KPVSTICHCFEEYPQFLRSVSVKDTSILN-SSSIVQAIADAESELRGIDRLIVRASGTES 418
           +P+S++    + +PQ L +V+VK    +    ++++ I   E+   G  R+++R SGTE 
Sbjct: 361 RPLSSLAGLLQLFPQRLINVNVKQKRPIETMPTLLKTIQRIETAFSGRGRVLLRYSGTEP 420

Query: 419 LIRIMAEGDDLSRIKRIVDDLAKVIPM 445
           L R+M EG+  S++    ++LA ++  
Sbjct: 421 LCRVMVEGESDSKVNTYAEELADIVAK 447


>gi|260426604|ref|ZP_05780583.1| phosphoglucosamine mutase [Citreicella sp. SE45]
 gi|260421096|gb|EEX14347.1| phosphoglucosamine mutase [Citreicella sp. SE45]
          Length = 447

 Score =  276 bits (705), Expect = 6e-72,   Method: Composition-based stats.
 Identities = 229/447 (51%), Positives = 311/447 (69%), Gaps = 4/447 (0%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKH-RRVVIGKDTRLSGYMLE 59
           M R+ FGTDG+RG +N FP+T    + IG A G  FR ++    RVVIGKDTRLSGYM E
Sbjct: 1   MTRKLFGTDGVRGTANAFPMTAEMALMIGAAAGRYFRRERAGVHRVVIGKDTRLSGYMFE 60

Query: 60  NSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGY 119
           N+L AG T+ GM   +LGP+P+PAV +LT ++RAD+G+MISASHNP  DNGIK FGPDG+
Sbjct: 61  NALTAGLTSTGMSVLLLGPVPTPAVGLLTPAMRADLGIMISASHNPADDNGIKFFGPDGF 120

Query: 120 KVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRI 179
           K+S ++E  IE L+E  +    +   +IG AKR+D    RY+E VK TLP  + L G+++
Sbjct: 121 KLSDEVEAEIEALVEAGVQPAQAH--NIGRAKRIDDGRFRYMERVKSTLPHGMRLDGMKV 178

Query: 180 VVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIG 239
           VVDCANGA+Y+ APEV WELGADV+ +G  PNG+NIN +CGST   +    V    AD+G
Sbjct: 179 VVDCANGAAYRTAPEVLWELGADVIPVGTSPNGLNINANCGSTRPQAAAEAVVAHGADVG 238

Query: 240 IALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAG 299
           I LDGD DR+I++DE G I +GDQIMAL+A  W     L    +V TVMSN+GLERF+  
Sbjct: 239 ICLDGDADRIILIDETGTIADGDQIMALMAARWAEEQRLHEGTLVATVMSNLGLERFLES 298

Query: 300 LGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYD 359
            GL L+RT+VGDRY++E M+ +G+N+GGEQSGHI+++DY +TGDGL+A LQ L  + +  
Sbjct: 299 RGLRLERTKVGDRYVVEAMRAHGWNLGGEQSGHIVMTDYATTGDGLMAGLQFLCEMVRTG 358

Query: 360 KPVSTICHCFEEYPQFLRSVSV-KDTSILNSSSIVQAIADAESELRGIDRLIVRASGTES 418
           +P S +   F   PQ L++V    D + L ++S+  AIA+AE+ L G  RL++R SGTE 
Sbjct: 359 QPASDLARNFAPVPQLLKNVRFGADKAPLEAASVQGAIAEAEAALTGKGRLLIRKSGTEP 418

Query: 419 LIRIMAEGDDLSRIKRIVDDLAKVIPM 445
           LIR+MAE +D + + ++VD +   +  
Sbjct: 419 LIRVMAECEDEALLAQVVDGIVAEVQA 445


>gi|192360111|ref|YP_001983131.1| phosphoglucosamine mutase [Cellvibrio japonicus Ueda107]
 gi|226722721|sp|B3PLQ1|GLMM_CELJU RecName: Full=Phosphoglucosamine mutase
 gi|190686276|gb|ACE83954.1| phosphoglucosamine mutase [Cellvibrio japonicus Ueda107]
          Length = 445

 Score =  276 bits (705), Expect = 6e-72,   Method: Composition-based stats.
 Identities = 196/447 (43%), Positives = 285/447 (63%), Gaps = 7/447 (1%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRR-VVIGKDTRLSGYMLE 59
           M R++FGTDGIRG     PITP+FM+++G A G +   +      ++IGKDTR+SGYM E
Sbjct: 1   MTRKYFGTDGIRGLVGEGPITPDFMLKLGWAAGRVLMDRFDGSNMILIGKDTRISGYMFE 60

Query: 60  NSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGY 119
           ++L AG   AG+D  +LGP+P+P VA LTR+ +A  G++ISASHN Y DNGIK FG +G 
Sbjct: 61  SALQAGLINAGVDVGLLGPMPTPGVAYLTRTFQAQAGIVISASHNSYVDNGIKFFGGNGT 120

Query: 120 KVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRI 179
           K+  D    +E L+E  L   +   + +G AKR+     RYIE  K T+P    L+G+ +
Sbjct: 121 KLPDD----LEDLIEKQLEQPMVTAEKLGKAKRIQDASGRYIEFCKGTMPWGFNLKGMHL 176

Query: 180 VVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIG 239
           V+DCA+GA+Y +AP VF ELGA V  I   PNG NIN  CGST   +LQ KV E+ AD+G
Sbjct: 177 VIDCAHGATYNIAPNVFSELGAHVTPIFVDPNGTNINRGCGSTKPEALQEKVVELGADLG 236

Query: 240 IALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAG 299
           IA DGDGDRV+ VD KG +V+GD+++ +IA     ++      + T  MSN G E  +  
Sbjct: 237 IAFDGDGDRVVFVDHKGELVDGDELLYIIAAYQQEYAGGCDGVVGTL-MSNFGFELGLKK 295

Query: 300 LGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYD 359
           LG+   R +VGDRY++E M+  G+ +GGE SGHI+ S+  +TGDG+++ALQVL  I    
Sbjct: 296 LGIPFARAKVGDRYVIEMMRERGWRLGGENSGHIVCSNVTTTGDGIISALQVLLAITTLG 355

Query: 360 KPVSTICHCFEEYPQFLRSVSVKDTSIL-NSSSIVQAIADAESELRGIDRLIVRASGTES 418
           + +  I     + PQ + +V +   + L N+ +I +A+   E +L G  R+++R SGTE 
Sbjct: 356 QKLHKIKKGMAKLPQVMINVHMAKRADLANNETIQRAVKLTEEKLGGSGRVLLRPSGTEP 415

Query: 419 LIRIMAEGDDLSRIKRIVDDLAKVIPM 445
           ++R+M EG+D +++K +  +LA V+  
Sbjct: 416 VVRVMVEGEDKAQVKELAQELASVVEA 442


>gi|328952043|ref|YP_004369377.1| phosphoglucosamine mutase [Desulfobacca acetoxidans DSM 11109]
 gi|328452367|gb|AEB08196.1| phosphoglucosamine mutase [Desulfobacca acetoxidans DSM 11109]
          Length = 452

 Score =  276 bits (704), Expect = 6e-72,   Method: Composition-based stats.
 Identities = 204/444 (45%), Positives = 294/444 (66%), Gaps = 2/444 (0%)

Query: 3   RRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSL 62
           R+ FGTDGIRG +N +P+T +  +++G  + Y+ +   +  R+V+GKDTRLSGY+LE ++
Sbjct: 2   RKLFGTDGIRGVANEYPMTADVALKLGNVIAYVVKNGARRHRIVVGKDTRLSGYILEYAI 61

Query: 63  VAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVS 122
            AG  + G+D  ++GP+P+P +A +T S+RAD GV+ISASHNPYQDNGIK F  +G K+ 
Sbjct: 62  TAGICSMGVDVMLVGPMPTPGIAFITSSMRADAGVVISASHNPYQDNGIKFFSHEGLKLP 121

Query: 123 TDIEDRIETLL-EDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVV 181
            ++E R+E L+   +L S+      +G A R+D    RY  ++K TLP+++  +G +IV+
Sbjct: 122 DEMEVRMEELMLNPELGSHCPTATGVGQALRIDDASGRYNSYLKSTLPKNLDFKGFKIVL 181

Query: 182 DCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIA 241
           DCA+GA+YKVAP V  ELGA+V+  G +PNG NIN  CGST   ++Q  V    ADIGIA
Sbjct: 182 DCAHGAAYKVAPAVLQELGAEVIPFGVRPNGKNINRQCGSTYPATIQSLVRRHDADIGIA 241

Query: 242 LDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLG 301
           LDGDGDRVI VD +G IV+GD IMA+ +        LR   +V TVMSN+GLE  +  +G
Sbjct: 242 LDGDGDRVICVDHQGNIVDGDHIMAICSHHLHEKGDLRKKTLVATVMSNMGLEIALKKMG 301

Query: 302 LSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKP 361
             L RT+VGDRY++E M   G+N+GGEQSGHII  D+ +TGDG ++ALQ+L  +    + 
Sbjct: 302 CRLIRTQVGDRYVIERMLQGGYNLGGEQSGHIIFWDHSTTGDGTLSALQLLAIMHSTGRS 361

Query: 362 VSTICHCFEEYPQFLRSVSVKDTSIL-NSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
           ++ +    E YPQ L +V V++   L     I Q I  AE +L    RL++R SGTE+ +
Sbjct: 362 LADLAKIMEVYPQALLNVRVREKKDLSQIPPIYQGIRAAEEKLGDRGRLLIRYSGTEAKL 421

Query: 421 RIMAEGDDLSRIKRIVDDLAKVIP 444
           R+M EG+D   ++ I  ++A +I 
Sbjct: 422 RVMCEGEDPEEVEAIAQEIADLIE 445


>gi|325844428|ref|ZP_08168155.1| phosphoglucosamine mutase [Turicibacter sp. HGF1]
 gi|325489102|gb|EGC91486.1| phosphoglucosamine mutase [Turicibacter sp. HGF1]
          Length = 445

 Score =  276 bits (704), Expect = 6e-72,   Method: Composition-based stats.
 Identities = 183/443 (41%), Positives = 284/443 (64%), Gaps = 4/443 (0%)

Query: 4   RFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSLV 63
           ++FGTDGIRG +NT  +TP F +++G  +G+  + K    +V+IG+DTR+SG +LE++L+
Sbjct: 3   KYFGTDGIRGVANT-ELTPEFALKLGRILGHHLKEKNTRPKVLIGRDTRISGELLESALI 61

Query: 64  AGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVST 123
           AG  ++G D   LG I +P VA LT++L  D GVMISASHNP QDNGIK+F   GYK+S 
Sbjct: 62  AGLVSSGADVLTLGVITTPGVAYLTKNLDVDAGVMISASHNPVQDNGIKIFSHSGYKLSD 121

Query: 124 DIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVVDC 183
             E+ IE L++            IG  +       +Y+  +K T+ +   L GL+IV+DC
Sbjct: 122 QEEEEIEALIDSSDELPRPIAGEIGRVEDFQMGSQKYVNFIKGTVGQ--KLTGLKIVLDC 179

Query: 184 ANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIALD 243
           ANGAS  +AP++F +L AD+V +   P+GININ +CGST+  +L ++V +  A +G A D
Sbjct: 180 ANGASSALAPQLFADLDADIVTVSSNPDGININHNCGSTHPENLAKEVVKHEAHLGFAFD 239

Query: 244 GDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLGLS 303
           GD DR+I VD  G I++GD IM ++ R      LL+   +V+TVMSN+G    +   GL 
Sbjct: 240 GDCDRLIAVDHNGNIIDGDYIMFIVGRYLNEKGLLKQGTVVSTVMSNLGFYNAVEANGLH 299

Query: 304 LKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKPVS 363
             +T+VGDRY++E M  N +N GGEQSGH+I  DYG+TGDG+++A+Q+ + I +  + ++
Sbjct: 300 SVQTKVGDRYVLEEMLKNDYNFGGEQSGHLIFLDYGTTGDGMLSAVQLAKIIVEKGQSLA 359

Query: 364 TICHCFEEYPQFLRSVSVKDTSI-LNSSSIVQAIADAESELRGIDRLIVRASGTESLIRI 422
            +     +YPQ L+++ V+D +  + + +I+  IA+ E+E+ G  R++VR SGTE L+R+
Sbjct: 360 DLAKEMPKYPQLLKNLRVEDKNAMMTNEAILAVIAEVEAEMNGKGRVLVRPSGTEPLVRV 419

Query: 423 MAEGDDLSRIKRIVDDLAKVIPM 445
           M E +     +  V+ +  ++  
Sbjct: 420 MVEAETEELCESYVERILAIVEK 442


>gi|149909284|ref|ZP_01897940.1| phosphoglucosamine mutase [Moritella sp. PE36]
 gi|149807601|gb|EDM67549.1| phosphoglucosamine mutase [Moritella sp. PE36]
          Length = 444

 Score =  276 bits (704), Expect = 6e-72,   Method: Composition-based stats.
 Identities = 199/446 (44%), Positives = 296/446 (66%), Gaps = 5/446 (1%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M R++FGTDGIRG     PITP F +++G A G +   +   R+V+IGKDTR+SGYMLE 
Sbjct: 1   MSRKYFGTDGIRGLVGVAPITPEFALKLGWAAGKVLAKQG-TRKVLIGKDTRISGYMLEC 59

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +L AG +AAG+D   +GP+P+PAVA LTR+ RA+ G++ISASHNPY DNGIK F  +G K
Sbjct: 60  ALEAGLSAAGLDVAFMGPMPTPAVAYLTRTFRAEAGIVISASHNPYHDNGIKFFSANGTK 119

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +  ++E  IE  LE +LT        +G A R++    RYIE+ K T P   +L+GL+IV
Sbjct: 120 LPDEVELAIEAQLEKELT--CVESAQLGKAVRIEDAAGRYIEYCKSTFPSRASLKGLKIV 177

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           +DCA+GA+Y +AP VF ELGA+++ IG +PNG+NIN  CG+T   +L  +V   +AD+G+
Sbjct: 178 LDCAHGATYHIAPSVFTELGAEIITIGVEPNGLNINDGCGATAPEALVARVLAEKADLGV 237

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           A DGDGDR+++VD  G +++GD+++ +IAR+ + +  L+G  + T  M+N+GLE  +  L
Sbjct: 238 AYDGDGDRLMMVDHTGYVIDGDEVLYIIARDALRNGELKGGVVGTL-MANMGLELALKSL 296

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           G+   R+ VGDRY++E M   G+ +GGE SGHII  D+ +TGDG+V++L VL  +     
Sbjct: 297 GIPFARSAVGDRYVVEMMLEKGWRIGGENSGHIISLDHTTTGDGIVSSLLVLAALVNSGL 356

Query: 361 PVSTICHCFEEYPQFLRSVSVK-DTSILNSSSIVQAIADAESELRGIDRLIVRASGTESL 419
            +  +     ++PQ L +V    DT  L + S++QA+ D E EL    R+++R SGTE L
Sbjct: 357 TLKELRSGMSKFPQVLVNVRFNGDTDPLLAESVLQAVKDVEQELADRGRVLLRKSGTEPL 416

Query: 420 IRIMAEGDDLSRIKRIVDDLAKVIPM 445
           IR+M EG+D + +  + + +A  +  
Sbjct: 417 IRVMVEGEDETHVLALANKIADAVKA 442


>gi|51245493|ref|YP_065377.1| phosphoglucomutase/phosphomannomutase [Desulfotalea psychrophila
           LSv54]
 gi|81642162|sp|Q6AMQ5|GLMM_DESPS RecName: Full=Phosphoglucosamine mutase
 gi|50876530|emb|CAG36370.1| probable phosphoglucomutase/phosphomannomutase [Desulfotalea
           psychrophila LSv54]
          Length = 450

 Score =  276 bits (704), Expect = 7e-72,   Method: Composition-based stats.
 Identities = 203/450 (45%), Positives = 299/450 (66%), Gaps = 6/450 (1%)

Query: 3   RRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSL 62
           R+ FGTDGIRG +N  P+T    M++G A+ +L + +    R+VIGKDTRLSGYM+EN++
Sbjct: 2   RKLFGTDGIRGVANVHPMTMEIAMQVGRAIAFLVKKENYRHRIVIGKDTRLSGYMIENAI 61

Query: 63  VAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVS 122
           VAG  + G+D  ++GP+P+P +A +T S+RAD GV+ISASHNP+QDNGIK+F  DG+K+ 
Sbjct: 62  VAGICSMGVDVLLVGPLPTPGIAFITTSMRADAGVVISASHNPFQDNGIKIFFSDGFKLP 121

Query: 123 TDIEDRIETL-LEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVV 181
             +E +IE L L   + +     + +G A R+D    RYI  +K T P+  TL G  IV+
Sbjct: 122 DAMELKIEDLVLSQRMLALQPLAEEVGRASRIDDAKGRYIVFLKNTFPKKYTLDGFHIVI 181

Query: 182 DCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIA 241
           DCA+GA+Y VAP VF ELGA V  +G +PNG NIN  CG+ +   +  KV E+ ADIG+A
Sbjct: 182 DCAHGATYGVAPHVFEELGAKVTALGIEPNGQNINAGCGALHPELMAGKVKELGADIGLA 241

Query: 242 LDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLG 301
            DGDGDR+I+ DE G +V+GD +MA+ A+E ++    +   +V TVMSN+GLE  +  +G
Sbjct: 242 FDGDGDRLIVCDEHGVVVDGDHVMAICAKELLAQRKSKKKTLVATVMSNMGLEVAMKKMG 301

Query: 302 LSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKP 361
             L R +VGDRY++E M+ NG++ GGEQSGH++  ++ +TGDG++AALQ+L  +K+  K 
Sbjct: 302 GHLVRADVGDRYVVECMRKNGYSFGGEQSGHLVFLEHMTTGDGILAALQILAIMKKRKKT 361

Query: 362 VSTICHCFEEYPQFLRSVSVKDTSILNSSSIV---QAIADAESELRGIDRLIVRASGTES 418
           +S +    + +PQ L++V       ++  SIV    A+   E +L    R++VR SGTE 
Sbjct: 362 LSELAQVMQSFPQVLKNVRTAKK--ISVDSIVGFADAVKKYEMQLGDTGRILVRPSGTEP 419

Query: 419 LIRIMAEGDDLSRIKRIVDDLAKVIPMIDS 448
           +IR+M EG D + I  I D+L ++I  + +
Sbjct: 420 VIRVMVEGLDSAEINDIADELCELIRRVSN 449


>gi|315497140|ref|YP_004085944.1| transcriptional regulator, xre family [Asticcacaulis excentricus CB
           48]
 gi|315415152|gb|ADU11793.1| transcriptional regulator, XRE family [Asticcacaulis excentricus CB
           48]
          Length = 541

 Score =  276 bits (704), Expect = 7e-72,   Method: Composition-based stats.
 Identities = 240/444 (54%), Positives = 325/444 (73%), Gaps = 1/444 (0%)

Query: 2   KRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRV-VIGKDTRLSGYMLEN 60
            R++FGTDGIRG+ N+FP+T     R+G+A G +F      R + VIGKDTRLSGYM+E 
Sbjct: 97  TRKYFGTDGIRGRVNSFPMTAEVAYRVGMAAGKMFMSSDNRRHLAVIGKDTRLSGYMIEP 156

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +LVAGFT+ GMD  + GP+P+P VAM+TRS+RAD+GVMISASHNPY DNGIKLFGPDGYK
Sbjct: 157 ALVAGFTSVGMDVRLFGPLPTPGVAMMTRSMRADLGVMISASHNPYYDNGIKLFGPDGYK 216

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +S ++E  IE  ++ ++   ++    +G  +RVD    RY+E  K T P+++ L+GLRIV
Sbjct: 217 LSDEVELAIEARMDGNILDGIADPQHLGRVQRVDDAQYRYVEIAKATFPKNLLLKGLRIV 276

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           +DCANGA+YKVAP   +ELGA++  +G  P+G+NIN  CGST   ++  KV E+RADIGI
Sbjct: 277 IDCANGAAYKVAPTTLYELGAEIFCLGVSPDGMNINEKCGSTQPQAMAEKVKELRADIGI 336

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           ALDGD DR++I DEKG +V+GDQIMA+IA    +   L+G G+V TVMSN+GLER +   
Sbjct: 337 ALDGDADRLVICDEKGTLVDGDQIMAIIATSLAAKGQLKGGGLVATVMSNLGLERLMTSK 396

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           GL L+RT+VGDRY+ME M+  GFN+GGEQSGH+I+ D+ +TGDGL+AALQVL  + +  +
Sbjct: 397 GLKLERTKVGDRYVMEKMREGGFNLGGEQSGHVIMLDHATTGDGLIAALQVLAVLVEGGR 456

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
           P+S +   FE  PQ L++V     S LN + + QAIAD E+ L+G  R++VR SGTE LI
Sbjct: 457 PMSELARQFEPVPQLLKNVRFTGESPLNRADVKQAIADGEATLKGTGRVLVRPSGTEPLI 516

Query: 421 RIMAEGDDLSRIKRIVDDLAKVIP 444
           R+MAEGDD ++++ +VD +   I 
Sbjct: 517 RVMAEGDDAAQVRTVVDQIIDAIS 540


>gi|316935834|ref|YP_004110816.1| phosphoglucosamine mutase [Rhodopseudomonas palustris DX-1]
 gi|315603548|gb|ADU46083.1| phosphoglucosamine mutase [Rhodopseudomonas palustris DX-1]
          Length = 450

 Score =  275 bits (703), Expect = 8e-72,   Method: Composition-based stats.
 Identities = 254/443 (57%), Positives = 337/443 (76%), Gaps = 1/443 (0%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M RR+FGTDGIRG++N   ITP   +++G A G  F+  +   RVVIGKDTRLSGYM+EN
Sbjct: 1   MSRRYFGTDGIRGRAN-GLITPELALKVGQAAGLAFQRGEHRHRVVIGKDTRLSGYMIEN 59

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +LVAGFT+ GMD  ++GP+P+PAVAMLT+S+RAD+GVMISASHN ++DNGIKLFGP GYK
Sbjct: 60  ALVAGFTSVGMDVLLVGPMPTPAVAMLTKSMRADLGVMISASHNLFEDNGIKLFGPLGYK 119

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +S D+E +IE +L+D L   L+   S+G A+R+DGVHDRYIE  KRTLPR+++L+GLR+V
Sbjct: 120 LSDDVEKQIELMLDDSLDKKLAQSASLGRARRIDGVHDRYIEFAKRTLPRELSLEGLRVV 179

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           +DCANGA+Y+V PE  WELGADV+ IG +P+G NIN +CGST   +L  KV E+RADIGI
Sbjct: 180 IDCANGAAYRVVPEALWELGADVISIGVEPDGFNINKECGSTAPQALCAKVREMRADIGI 239

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           ALDGD DRVI+VDE+G +V+GDQ++A+I + W     L   G+V TVMSN+GLERF+A  
Sbjct: 240 ALDGDADRVILVDERGHVVDGDQLLAVIGQSWKEDGRLAKPGVVATVMSNLGLERFLASE 299

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           G++L RT VGDRY++E M  +G+NVGGE SGHIILSD+ +TGDG VAALQVL  +++  +
Sbjct: 300 GIALLRTPVGDRYVLEQMLKDGYNVGGESSGHIILSDFNTTGDGFVAALQVLAMVQKLGR 359

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
           PVS +CH F+  PQ L++V  +    L+ S ++ AI D E  L G  RL++R SGTE +I
Sbjct: 360 PVSEVCHRFDPLPQILKNVRYRSGRPLDDSGVIAAIEDGEKRLNGHGRLLIRPSGTEPVI 419

Query: 421 RIMAEGDDLSRIKRIVDDLAKVI 443
           R+M EGDD   ++ +VD +   +
Sbjct: 420 RVMGEGDDHDVVEEVVDSIVDAL 442


>gi|325982673|ref|YP_004295075.1| phosphoglucosamine mutase [Nitrosomonas sp. AL212]
 gi|325532192|gb|ADZ26913.1| phosphoglucosamine mutase [Nitrosomonas sp. AL212]
          Length = 452

 Score =  275 bits (703), Expect = 8e-72,   Method: Composition-based stats.
 Identities = 196/451 (43%), Positives = 290/451 (64%), Gaps = 10/451 (2%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRG------KKKHRRVVIGKDTRLS 54
           M +++FGTDGIRG+   FPITP+F+M +G + G +         + K   V+IGKDTR+S
Sbjct: 1   MAKKYFGTDGIRGRVGQFPITPDFIMHLGYSAGKVLAAADWHLMEGKRPTVLIGKDTRVS 60

Query: 55  GYMLENSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLF 114
           GYMLE++L AG  AAG+D  + GP+P+PAVA L R+LR   G++ISASHN ++DNG+K F
Sbjct: 61  GYMLESALEAGLCAAGVDVLLSGPMPTPAVAYLIRALRLQAGIVISASHNLFEDNGVKFF 120

Query: 115 GPDGYKVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTL 174
              G K+  ++E +IE  L   + +       +G  +R+D    RYIE  K T P  + L
Sbjct: 121 SAVGCKLPDEMEHKIEAELNTPIVTKP--SAQLGKVQRIDDAAGRYIEFCKSTFPYHLDL 178

Query: 175 QGLRIVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEV 234
           +GLRIV+DCA+GA+Y +A  V  ELGADVV IG +PNG+NINL+CG+T+  +LQ+ V + 
Sbjct: 179 RGLRIVIDCAHGAAYHIAGHVMHELGADVVTIGVQPNGLNINLECGATHGTTLQKAVKQH 238

Query: 235 RADIGIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLE 294
            AD+GIALDGDGDRV++VD++G   NGDQ++ +IA+       +   G+V T+M+N+ +E
Sbjct: 239 HADLGIALDGDGDRVMMVDKQGRSYNGDQLIYIIAKHR-KQRKILTGGVVGTLMTNLAIE 297

Query: 295 RFIAGLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRY 354
                L +   RT VGDRY++  ++  G+++GGE SGHII  D  +TGDG+++ALQVL  
Sbjct: 298 NQFNKLRIPFLRTNVGDRYVLALLQEQGWHLGGENSGHIICMDKHTTGDGIISALQVLYA 357

Query: 355 IKQYDKPVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAI-ADAESELRGIDRLIVRA 413
           ++  DK ++        YPQ L +V +        +  +  +  +AE++L G  RL++RA
Sbjct: 358 LRDADKTLAEFMRGVSLYPQRLINVKIPKPFNFTGNKAINTVRKEAEADLNGNGRLLIRA 417

Query: 414 SGTESLIRIMAEGDDLSRIKRIVDDLAKVIP 444
           SGTE LIR+M E     ++    + +AKV+ 
Sbjct: 418 SGTEPLIRVMVESQSKQKVNYWTERIAKVVQ 448


>gi|205830898|sp|A7IIG5|GLMM_XANP2 RecName: Full=Phosphoglucosamine mutase
          Length = 447

 Score =  275 bits (703), Expect = 9e-72,   Method: Composition-based stats.
 Identities = 264/448 (58%), Positives = 339/448 (75%), Gaps = 1/448 (0%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M RR+FGTDG+RG++N   +T +  +R+G+A G +F+  +   RVVIGKDTRLSGYM+EN
Sbjct: 1   MSRRYFGTDGVRGRANA-TLTADLALRVGMAAGLIFQRGEYRHRVVIGKDTRLSGYMIEN 59

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +LVAGFT+ GMD  +LGP+P+PAV MLTRS+RAD+GVMISASHNP+ DNGIKLFGPDG+K
Sbjct: 60  ALVAGFTSVGMDVLLLGPVPTPAVGMLTRSMRADLGVMISASHNPFDDNGIKLFGPDGFK 119

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +S ++E  IE L+++D+   L+    IG AKR++GVH RYIE+ KRTLPRD T  G+R+V
Sbjct: 120 LSDEVEREIEELIDEDIAKRLAKPAEIGRAKRLEGVHARYIEYAKRTLPRDQTFDGIRVV 179

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           VDCANGA YKVAPE  WELGADVV IG +P+G+NIN D GST+  +L  KV EVRADIGI
Sbjct: 180 VDCANGAGYKVAPEALWELGADVVSIGVEPDGMNINRDVGSTSPAALSAKVREVRADIGI 239

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           ALDGD DRVIIVDEKG +V+GDQ+MA++A  +     L  +G+V TVMSN+GLER +AG 
Sbjct: 240 ALDGDADRVIIVDEKGHVVDGDQLMAVVAESFKEDGRLARSGLVATVMSNLGLERHLAGE 299

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           G+SL RT VGDRY++E M+ +G+NVGGEQSGHIILSDY +TGDGLVAALQVL  + +  K
Sbjct: 300 GISLARTAVGDRYVLERMRADGYNVGGEQSGHIILSDYSTTGDGLVAALQVLAVVARRGK 359

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
           PVS +CH F+  PQ L++V       L    +   IADAE  L    RL++R SGTE +I
Sbjct: 360 PVSEVCHRFDPLPQILKNVRYASGRPLEDEKVKIVIADAERRLANHGRLLIRPSGTEPVI 419

Query: 421 RIMAEGDDLSRIKRIVDDLAKVIPMIDS 448
           R+M EGDD   ++ +VDD+  V+  + +
Sbjct: 420 RVMGEGDDRDLVENVVDDVIDVLQKVAA 447


>gi|154246507|ref|YP_001417465.1| phosphoglucosamine mutase [Xanthobacter autotrophicus Py2]
 gi|154160592|gb|ABS67808.1| phosphoglucosamine mutase [Xanthobacter autotrophicus Py2]
          Length = 466

 Score =  275 bits (703), Expect = 9e-72,   Method: Composition-based stats.
 Identities = 264/448 (58%), Positives = 339/448 (75%), Gaps = 1/448 (0%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M RR+FGTDG+RG++N   +T +  +R+G+A G +F+  +   RVVIGKDTRLSGYM+EN
Sbjct: 20  MSRRYFGTDGVRGRANA-TLTADLALRVGMAAGLIFQRGEYRHRVVIGKDTRLSGYMIEN 78

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +LVAGFT+ GMD  +LGP+P+PAV MLTRS+RAD+GVMISASHNP+ DNGIKLFGPDG+K
Sbjct: 79  ALVAGFTSVGMDVLLLGPVPTPAVGMLTRSMRADLGVMISASHNPFDDNGIKLFGPDGFK 138

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +S ++E  IE L+++D+   L+    IG AKR++GVH RYIE+ KRTLPRD T  G+R+V
Sbjct: 139 LSDEVEREIEELIDEDIAKRLAKPAEIGRAKRLEGVHARYIEYAKRTLPRDQTFDGIRVV 198

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           VDCANGA YKVAPE  WELGADVV IG +P+G+NIN D GST+  +L  KV EVRADIGI
Sbjct: 199 VDCANGAGYKVAPEALWELGADVVSIGVEPDGMNINRDVGSTSPAALSAKVREVRADIGI 258

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           ALDGD DRVIIVDEKG +V+GDQ+MA++A  +     L  +G+V TVMSN+GLER +AG 
Sbjct: 259 ALDGDADRVIIVDEKGHVVDGDQLMAVVAESFKEDGRLARSGLVATVMSNLGLERHLAGE 318

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           G+SL RT VGDRY++E M+ +G+NVGGEQSGHIILSDY +TGDGLVAALQVL  + +  K
Sbjct: 319 GISLARTAVGDRYVLERMRADGYNVGGEQSGHIILSDYSTTGDGLVAALQVLAVVARRGK 378

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
           PVS +CH F+  PQ L++V       L    +   IADAE  L    RL++R SGTE +I
Sbjct: 379 PVSEVCHRFDPLPQILKNVRYASGRPLEDEKVKIVIADAERRLANHGRLLIRPSGTEPVI 438

Query: 421 RIMAEGDDLSRIKRIVDDLAKVIPMIDS 448
           R+M EGDD   ++ +VDD+  V+  + +
Sbjct: 439 RVMGEGDDRDLVENVVDDVIDVLQKVAA 466


>gi|16124372|ref|NP_418936.1| phosphoglucomutase/phosphomannomutase family protein [Caulobacter
           crescentus CB15]
 gi|221233055|ref|YP_002515491.1| phosphoglucosamine mutase [Caulobacter crescentus NA1000]
 gi|81621311|sp|Q9ABV3|GLMM_CAUCR RecName: Full=Phosphoglucosamine mutase
 gi|254798569|sp|B8GXK7|GLMM_CAUCN RecName: Full=Phosphoglucosamine mutase
 gi|13421224|gb|AAK22104.1| phosphoglucomutase/phosphomannomutase family protein [Caulobacter
           crescentus CB15]
 gi|220962227|gb|ACL93583.1| phosphoglucosamine mutase [Caulobacter crescentus NA1000]
          Length = 448

 Score =  275 bits (703), Expect = 1e-71,   Method: Composition-based stats.
 Identities = 248/447 (55%), Positives = 328/447 (73%), Gaps = 2/447 (0%)

Query: 1   MKRR-FFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRR-VVIGKDTRLSGYML 58
           M +R +FGTDGIRG++N  P+T    +R+G+A G LFR + + R  VVIGKDTRLSGYM+
Sbjct: 1   MSKRAYFGTDGIRGQANKHPMTAEVALRVGLAAGKLFRSQDERRHLVVIGKDTRLSGYMI 60

Query: 59  ENSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDG 118
           E +LVAG T+ G+D  + GP+P+PAVAM+TRS+RAD+G+MISASHN + DNGIKLFGPDG
Sbjct: 61  EPALVAGLTSVGLDVRLFGPLPTPAVAMMTRSMRADLGIMISASHNSFADNGIKLFGPDG 120

Query: 119 YKVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLR 178
           YK+S   E  IE L++  L   L+    +G  KR+D    RY+E VK T PR + L GLR
Sbjct: 121 YKLSDAQELGIEALMDQGLQEGLAAPRELGRVKRIDDAQARYVEIVKATFPRHLNLSGLR 180

Query: 179 IVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADI 238
           IV+DCANGA+YKVAP   +ELGA+V+ +G  P+G NIN +CGST+  ++ + V E RADI
Sbjct: 181 IVIDCANGAAYKVAPTALYELGAEVITLGVSPDGTNINEECGSTHPEAMAKMVREYRADI 240

Query: 239 GIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIA 298
           GIALDGD DR++I DEKG +V+GDQIMA+IA        L+G G+V TVMSN+GLER + 
Sbjct: 241 GIALDGDADRLVICDEKGVVVDGDQIMAIIAAASHKAGTLKGGGVVATVMSNLGLERQLN 300

Query: 299 GLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQY 358
            +GLSL+RT VGDRY+M+ M+  GFNVGGEQSGH+ILSD+ +TGDGL+AALQVL  + + 
Sbjct: 301 TMGLSLERTAVGDRYVMQRMREGGFNVGGEQSGHLILSDFSTTGDGLIAALQVLAVMVET 360

Query: 359 DKPVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTES 418
           DKP+S +   FE  PQ L +V       L ++++ +AIAD E++L G  R++VRASGTE 
Sbjct: 361 DKPMSALGRQFEPVPQLLENVRFVGGKPLEAAAVKEAIADGEAQLNGAGRIVVRASGTEP 420

Query: 419 LIRIMAEGDDLSRIKRIVDDLAKVIPM 445
           LIRIMAEGDD + +K++V  +A  +  
Sbjct: 421 LIRIMAEGDDPALVKKVVKSIASAVKA 447


>gi|167648552|ref|YP_001686215.1| phosphoglucosamine mutase [Caulobacter sp. K31]
 gi|189040777|sp|B0T1V6|GLMM_CAUSK RecName: Full=Phosphoglucosamine mutase
 gi|167350982|gb|ABZ73717.1| phosphoglucosamine mutase [Caulobacter sp. K31]
          Length = 448

 Score =  275 bits (702), Expect = 1e-71,   Method: Composition-based stats.
 Identities = 245/448 (54%), Positives = 324/448 (72%), Gaps = 2/448 (0%)

Query: 1   MKRR-FFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRR-VVIGKDTRLSGYML 58
           M +R +FGTDGIRG++N  P+T    +R+G+A G LFR +   R  VVIGKDTRLSGYM+
Sbjct: 1   MSKRAYFGTDGIRGQANKHPMTAEVALRVGLAAGKLFRSQDDRRHLVVIGKDTRLSGYMI 60

Query: 59  ENSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDG 118
           E +LVAGF + GMD  + GP+P+PAVAM+TRS+RAD+GVMISASHN + DNGIKLFGPDG
Sbjct: 61  EPALVAGFASVGMDVRLFGPLPTPAVAMMTRSMRADLGVMISASHNDFADNGIKLFGPDG 120

Query: 119 YKVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLR 178
           YK+S + E +IE L+++ L   L+    +G  +RVD    RYIE VK T PR+++L GLR
Sbjct: 121 YKLSDEQELKIEALMDEGLQEGLAPPRGLGRVQRVDDAQARYIEIVKATFPRNMSLAGLR 180

Query: 179 IVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADI 238
           IV+DCA+GA+YKVAP+  +ELGA+V  +G  PNG NIN +CGST+  ++ R V E RADI
Sbjct: 181 IVIDCAHGAAYKVAPQALYELGAEVFPVGVAPNGTNINAECGSTHPEAMARLVREYRADI 240

Query: 239 GIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIA 298
           GIALDGD DR++I DEKG +V+GDQIMA+IA        L+  G+V TVMSN+GLER + 
Sbjct: 241 GIALDGDADRLVICDEKGVVVDGDQIMAIIALALAKAGKLKAGGVVATVMSNLGLERLMT 300

Query: 299 GLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQY 358
             GL L+RT VGDRY+M  M+  GFN+GGEQSGH+ILSD+ +TGDGL+AALQVL  + + 
Sbjct: 301 DNGLKLERTSVGDRYVMARMREGGFNIGGEQSGHVILSDFSTTGDGLIAALQVLAVMIET 360

Query: 359 DKPVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTES 418
            +P+S +   FE  PQ L +V       L   ++ +AIAD E++L G  R++VR SGTE 
Sbjct: 361 GRPMSALGRQFEPAPQILENVRFSGGKPLEHKTVKEAIADGEAQLNGSGRIVVRPSGTEP 420

Query: 419 LIRIMAEGDDLSRIKRIVDDLAKVIPMI 446
           LIRIMAEGDD + +K++V  +   +  +
Sbjct: 421 LIRIMAEGDDPALVKKVVKSIVSAVKAV 448


>gi|83950837|ref|ZP_00959570.1| Phosphoglucomutase/phosphomannomutase [Roseovarius nubinhibens ISM]
 gi|83838736|gb|EAP78032.1| Phosphoglucomutase/phosphomannomutase [Roseovarius nubinhibens ISM]
          Length = 451

 Score =  275 bits (702), Expect = 1e-71,   Method: Composition-based stats.
 Identities = 231/447 (51%), Positives = 308/447 (68%), Gaps = 4/447 (0%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKK-KHRRVVIGKDTRLSGYMLE 59
           M R++FGTDGIRG +N FP+T +  +RIG A G  FR       RVVIGKDTR SGYMLE
Sbjct: 1   MARKYFGTDGIRGTANQFPMTADNALRIGAAAGRHFRKDGLNGHRVVIGKDTRRSGYMLE 60

Query: 60  NSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGY 119
           N+L AG T+ GM+  +LGPIP+PAV  LTRS+RAD+G+MISASHNP+ DNGIK FGPDG+
Sbjct: 61  NALTAGLTSTGMNVLLLGPIPTPAVGFLTRSMRADLGIMISASHNPHHDNGIKFFGPDGF 120

Query: 120 KVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRI 179
           K+S   E  IE +LE D+T       +IG AKR++    RY+E+ K T PRD  L GL+I
Sbjct: 121 KLSDTDEAAIEAILEGDVTPA--QPGNIGRAKRIESGRGRYVEYAKTTFPRDQRLSGLKI 178

Query: 180 VVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIG 239
           VVDCANGA+Y VAPEV WELGA+V+ +G  P+G NIN DCGST   +  R+V +  AD+G
Sbjct: 179 VVDCANGAAYHVAPEVLWELGAEVIPVGVTPDGFNINADCGSTAPQTAAREVLKHGADLG 238

Query: 240 IALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAG 299
           I LDGD DR+I++DEKG + +GDQIMAL A  W + + L    +V TVMSN+GLE FI G
Sbjct: 239 ICLDGDADRIILIDEKGQVADGDQIMALFASRWAAQNALAHGTLVATVMSNLGLENFIKG 298

Query: 300 LGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYD 359
            GL+L+RT VGDR+++E M+  GFN+GGEQSGHI+++D+ +TGDGL+A LQ L  + +  
Sbjct: 299 KGLTLERTAVGDRHVVERMRAGGFNLGGEQSGHIVMTDFATTGDGLIAGLQFLSAMVESG 358

Query: 360 KPVSTICHCFEEYPQFLRSVSVK-DTSILNSSSIVQAIADAESELRGIDRLIVRASGTES 418
           +  S +   F   PQ L +V     +  L +  +  AIA  E  +    R+++R SGTE 
Sbjct: 359 QRASELVQNFAPVPQILENVRFDAGSDPLGAERVQSAIAAQEKRIADRGRILIRKSGTEP 418

Query: 419 LIRIMAEGDDLSRIKRIVDDLAKVIPM 445
           LIR+MAE +D + ++ +V ++A  +  
Sbjct: 419 LIRVMAECEDETLLREVVGEIAGAVRE 445


>gi|291613531|ref|YP_003523688.1| phosphoglucosamine mutase [Sideroxydans lithotrophicus ES-1]
 gi|291583643|gb|ADE11301.1| phosphoglucosamine mutase [Sideroxydans lithotrophicus ES-1]
          Length = 451

 Score =  275 bits (702), Expect = 1e-71,   Method: Composition-based stats.
 Identities = 202/452 (44%), Positives = 291/452 (64%), Gaps = 9/452 (1%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFR----GKKKHRRVVIGKDTRLSGY 56
           M R++FGTDG+RG+    PITP F+M +G A G +       +     V+IGKDTR+SGY
Sbjct: 1   MSRKYFGTDGVRGRVGVHPITPQFVMNLGYAAGKVLAKAEHAQSDRPAVLIGKDTRISGY 60

Query: 57  MLENSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGP 116
           MLE++L AG  AAG+D ++ GPIP+PAVA LTR+LR   GV+ISASHNP+ DNGIK F  
Sbjct: 61  MLESALEAGLIAAGIDVYLAGPIPTPAVAYLTRALRLQAGVVISASHNPFDDNGIKFFSG 120

Query: 117 DGYKVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQG 176
            G K+  ++E  IE  L++ + +     + +G AKR+D    RYIE  K T P D+ L+G
Sbjct: 121 SGTKLPDEVELAIEAALDEPMQTNP--SEGLGKAKRIDDAVGRYIEFCKSTFPADMNLRG 178

Query: 177 LRIVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRA 236
           ++IVVD A+GA+Y +A  VF ELGADV+ IG +PNG NIN   G+T   +LQ+ V E +A
Sbjct: 179 MKIVVDSAHGATYHIARNVFHELGADVIAIGAEPNGKNINEGYGATKPQNLQKAVVEHKA 238

Query: 237 DIGIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERF 296
            IGIALDGDGDR+I+VD  G + +GDQ++ +IA+   +       G+V T+M+N+  E  
Sbjct: 239 HIGIALDGDGDRLIMVDAGGKLYDGDQLLYVIAKHRQAL-GTLHGGVVGTLMTNLAFEHA 297

Query: 297 IAGLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIK 356
           +  LG+   R +VGDRY+ME ++   + +GGE SGHII  D  STGDG+V+ALQVL  ++
Sbjct: 298 MLKLGIPFARAKVGDRYVMEVLQEKKWQLGGENSGHIICLDKHSTGDGIVSALQVLCALR 357

Query: 357 QYDKPVSTICHCFEEYPQFLRSVSVKDTSI--LNSSSIVQAIADAESELRGIDRLIVRAS 414
              + ++        YPQ L +V VK  +   L  + +   +A AE +L G  R+++R S
Sbjct: 358 MKQQTLAQAASDLHMYPQILINVRVKGKAAELLELTPVKAEVAKAERDLNGKGRVLLRPS 417

Query: 415 GTESLIRIMAEGDDLSRIKRIVDDLAKVIPMI 446
           GTE L+R+M EG+D  ++K   + +A+ +  +
Sbjct: 418 GTEPLLRVMVEGEDGGQVKLWAERIAEAVRGV 449


>gi|89095219|ref|ZP_01168142.1| Phosphoglucomutase protein MrsA [Oceanospirillum sp. MED92]
 gi|89080516|gb|EAR59765.1| Phosphoglucomutase protein MrsA [Oceanospirillum sp. MED92]
          Length = 450

 Score =  274 bits (701), Expect = 1e-71,   Method: Composition-based stats.
 Identities = 202/446 (45%), Positives = 294/446 (65%), Gaps = 6/446 (1%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M +R+FGTDGIRGK   FPITP+F++++G A G +F  +    +++IGKDTR+SGYM E+
Sbjct: 1   MGKRYFGTDGIRGKVGQFPITPDFVLKLGWAAGKVFAREG-LSKILIGKDTRISGYMFES 59

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +L AG +AAG+D  + GP+P+PAVA L+R+ RAD G++ISASHNPY DNGIK F  +G K
Sbjct: 60  ALEAGLSAAGVDVLLTGPMPTPAVAYLSRTFRADAGIVISASHNPYFDNGIKFFSSEGTK 119

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +  +IE  IE  ++  +T+       +G AKR+D    RYIE  K T    ++L+GL+IV
Sbjct: 120 LPDEIEQAIEAQMDIAMTTV--DSAELGKAKRIDDAAGRYIEFCKATA-GGISLKGLKIV 176

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           +DCANGA+Y VAP VF ELGA VV I   P+G+NIN +CG+T    LQ  V   +AD+GI
Sbjct: 177 LDCANGATYHVAPAVFDELGAKVVEIASSPDGLNINEECGATATQRLQTVVTAEKADLGI 236

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           ALDGDGDRVI+VD  G  V+GD+++ +IA   M        G+V T+M+N GLE+  A  
Sbjct: 237 ALDGDGDRVIMVDHLGQEVDGDELLYIIAA-QMRREGSFTGGVVGTLMTNYGLEQAYARE 295

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
            +   R +VGDRY+ME +  N + +GGE SGHI+     +TGDG VAALQVL+   +  K
Sbjct: 296 DIHFIRAKVGDRYVMEQLYANDWLLGGESSGHIVCRHLTTTGDGTVAALQVLKAAVETGK 355

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTSILNS-SSIVQAIADAESELRGIDRLIVRASGTESL 419
            +S +     + PQ + +V ++    ++  + I  A+A+ E++L    R+++R SGTE +
Sbjct: 356 SLSELRAGMTKLPQKMINVRMEQKVSIDGVAEIDAAVAEVETKLGDRGRVLLRPSGTEPV 415

Query: 420 IRIMAEGDDLSRIKRIVDDLAKVIPM 445
           +R+M EG+D + + ++ + LAK +  
Sbjct: 416 VRVMIEGEDEAEVNQLCEQLAKDVEK 441


>gi|39937378|ref|NP_949654.1| phosphoglucosamine mutase [Rhodopseudomonas palustris CGA009]
 gi|81619312|sp|Q6N1T6|GLMM_RHOPA RecName: Full=Phosphoglucosamine mutase
 gi|39651236|emb|CAE29759.1| phosphoglucomutase/phosphomannomutase family protein MrsA
           [Rhodopseudomonas palustris CGA009]
          Length = 450

 Score =  274 bits (701), Expect = 1e-71,   Method: Composition-based stats.
 Identities = 255/443 (57%), Positives = 338/443 (76%), Gaps = 1/443 (0%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M RR+FGTDGIRG++N   ITP   +++G A G  F+  +   RVVIGKDTRLSGYM+EN
Sbjct: 1   MSRRYFGTDGIRGRAN-GLITPELALKVGQAAGLAFQRGEHRHRVVIGKDTRLSGYMIEN 59

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +LVAGFT+ GMD  ++GP+P+PAVAMLT+S+RAD+GVMISASHN ++DNGIKLFGP GYK
Sbjct: 60  ALVAGFTSVGMDVLLVGPMPTPAVAMLTKSMRADLGVMISASHNLFEDNGIKLFGPLGYK 119

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +S D+E +IE +L++ L   L+   S+G A+R+DGVHDRYIE  KRTLPR+++L+GLR+V
Sbjct: 120 LSDDVEKQIELMLDESLDKKLAQSASLGRARRIDGVHDRYIEFAKRTLPRELSLEGLRVV 179

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           +DCANGA+YKV PE  WELGADV+ IG +P+G NIN +CGST   +L  KV E+RADIGI
Sbjct: 180 IDCANGAAYKVVPEALWELGADVISIGVEPDGFNINKECGSTAPQALCAKVREMRADIGI 239

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           ALDGD DRVI+VDE+G +V+GDQ++A+I + W     L   G+V TVMSN+GLERF+AG 
Sbjct: 240 ALDGDADRVILVDERGHVVDGDQLLAVIGQSWKEDGRLAKPGVVATVMSNLGLERFLAGE 299

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           G++L RT VGDRY++E M  +G+NVGGE SGHIILSD+ +TGDG VAALQVL  +++  +
Sbjct: 300 GIALLRTPVGDRYVLEQMLKDGYNVGGESSGHIILSDFNTTGDGFVAALQVLAMVQKLGR 359

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
           PVS +CH F+  PQ L++V  +    L+ S ++ AI D E  L G  RL++R SGTE +I
Sbjct: 360 PVSEVCHRFDPLPQILKNVRYRSGRPLDDSGVISAIQDGEKRLNGHGRLLIRPSGTEPVI 419

Query: 421 RIMAEGDDLSRIKRIVDDLAKVI 443
           R+M EGDD   ++ +VD +   +
Sbjct: 420 RVMGEGDDHDVVEEVVDSIVDAL 442


>gi|192293158|ref|YP_001993763.1| phosphoglucosamine mutase [Rhodopseudomonas palustris TIE-1]
 gi|226723911|sp|B3Q6Y9|GLMM_RHOPT RecName: Full=Phosphoglucosamine mutase
 gi|192286907|gb|ACF03288.1| phosphoglucosamine mutase [Rhodopseudomonas palustris TIE-1]
          Length = 450

 Score =  274 bits (701), Expect = 2e-71,   Method: Composition-based stats.
 Identities = 254/443 (57%), Positives = 337/443 (76%), Gaps = 1/443 (0%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M RR+FGTDGIRG++N   ITP   +++G A G  F+  +   RVVIGKDTRLSGYM+EN
Sbjct: 1   MSRRYFGTDGIRGRAN-GLITPELALKVGQAAGLAFQRGEHRHRVVIGKDTRLSGYMIEN 59

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +LVAGFT+ GMD  ++GP+P+PAVAMLT+S+RAD+GVMISASHN ++DNGIKLFGP GYK
Sbjct: 60  ALVAGFTSVGMDVLLVGPMPTPAVAMLTKSMRADLGVMISASHNLFEDNGIKLFGPLGYK 119

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +S D+E +IE +L++ L   L+   S+G A+R+DGVHDRYIE  KRTLPR+++L+GLR+V
Sbjct: 120 LSDDVEKQIELMLDESLDKKLAQSASLGRARRIDGVHDRYIEFAKRTLPRELSLEGLRVV 179

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           +DCANGA+YKV PE  WELGADV+ IG +P+G NIN +CGST   +L  KV E+RADIGI
Sbjct: 180 IDCANGAAYKVVPEALWELGADVISIGVEPDGFNINKECGSTAPQALCAKVREMRADIGI 239

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           ALDGD DRVI+VDE+G +V+GDQ++A+I + W     L   G+V TVMSN+GLERF+AG 
Sbjct: 240 ALDGDADRVILVDERGHVVDGDQLLAVIGQSWKEDGRLAKPGVVATVMSNLGLERFLAGE 299

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           G++L RT VGDRY++E M  +G+NVGGE SGHIILSD+ +TGDG VAALQVL  +++  +
Sbjct: 300 GIALLRTPVGDRYVLEQMLKDGYNVGGESSGHIILSDFNTTGDGFVAALQVLAMVQKLGR 359

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
           PVS +C  F+  PQ L++V  +    L+ S ++ AI D E  L G  RL++R SGTE +I
Sbjct: 360 PVSEVCRRFDPLPQILKNVRYRSGRPLDDSGVISAIQDGEKRLNGHGRLLIRPSGTEPVI 419

Query: 421 RIMAEGDDLSRIKRIVDDLAKVI 443
           R+M EGDD   ++ +VD +   +
Sbjct: 420 RVMGEGDDRDVVEEVVDSIVDAL 442


>gi|293375420|ref|ZP_06621701.1| phosphoglucosamine mutase [Turicibacter sanguinis PC909]
 gi|292645973|gb|EFF64002.1| phosphoglucosamine mutase [Turicibacter sanguinis PC909]
          Length = 445

 Score =  274 bits (701), Expect = 2e-71,   Method: Composition-based stats.
 Identities = 183/443 (41%), Positives = 284/443 (64%), Gaps = 4/443 (0%)

Query: 4   RFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSLV 63
           ++FGTDGIRG +NT  +TP F +++G  +G+  + K    +V+IG+DTR+SG +LE++L+
Sbjct: 3   KYFGTDGIRGVANT-ELTPEFALKLGRILGHHLKEKNTRPKVLIGRDTRISGELLESALI 61

Query: 64  AGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVST 123
           AG  ++G D   LG I +P VA LT++L  D GVMISASHNP QDNGIK+F   GYK+S 
Sbjct: 62  AGLVSSGADVLTLGVITTPGVAYLTKNLDVDAGVMISASHNPVQDNGIKIFSHSGYKLSD 121

Query: 124 DIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVVDC 183
             E+ IE L++            IG  +       +Y+  +K T+ +   L GL+IV+DC
Sbjct: 122 QEEEEIEALIDLSDELPRPIAGEIGRVEDFQMGSQKYVNFIKGTVGQ--KLTGLKIVLDC 179

Query: 184 ANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIALD 243
           ANGAS  +AP++F +L AD+V +   P+GININ +CGST+  +L ++V +  A +G A D
Sbjct: 180 ANGASSALAPQLFADLDADIVTVSSNPDGININHNCGSTHPENLAKEVVKHEAHLGFAFD 239

Query: 244 GDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLGLS 303
           GD DR+I VD  G I++GD IM ++ R      LL+   +V+TVMSN+G    +   GL 
Sbjct: 240 GDCDRLIAVDHNGNIIDGDYIMFIVGRYLNEKGLLKQGTVVSTVMSNLGFYNAVEANGLH 299

Query: 304 LKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKPVS 363
             +T+VGDRY++E M  N +N GGEQSGH+I  DYG+TGDG+++A+Q+ + I +  + ++
Sbjct: 300 SVQTKVGDRYVLEEMLKNDYNFGGEQSGHLIFLDYGTTGDGMLSAVQLAKIIVEKGQSLA 359

Query: 364 TICHCFEEYPQFLRSVSVKDTSI-LNSSSIVQAIADAESELRGIDRLIVRASGTESLIRI 422
            +     +YPQ L+++ V+D +  + + +I+  IA+ E+E+ G  R++VR SGTE L+R+
Sbjct: 360 DLAKEMPKYPQLLKNLRVEDKNAMMTNEAILAVIAEVEAEMNGKGRVLVRPSGTEPLVRV 419

Query: 423 MAEGDDLSRIKRIVDDLAKVIPM 445
           M E +     +  V+ +  ++  
Sbjct: 420 MVEAETEELCESYVERILAIVEK 442


>gi|119477407|ref|ZP_01617598.1| phosphoglucosamine mutase [marine gamma proteobacterium HTCC2143]
 gi|119449333|gb|EAW30572.1| phosphoglucosamine mutase [marine gamma proteobacterium HTCC2143]
          Length = 445

 Score =  274 bits (701), Expect = 2e-71,   Method: Composition-based stats.
 Identities = 200/445 (44%), Positives = 296/445 (66%), Gaps = 5/445 (1%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M R++FGTDGIRG+  T PITP F++++G AVG +F G     +V+IGKDTR+SGYM E+
Sbjct: 1   MSRKYFGTDGIRGRVGTGPITPEFVLKLGWAVGKVFAG-SGRSKVIIGKDTRISGYMFES 59

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +L AG  AAG+D  +LGP+P+PAVA LTR+  A  G++ISASHNPY DNGIK F   G K
Sbjct: 60  ALEAGLVAAGVDVAMLGPMPTPAVAYLTRTFHAQAGIVISASHNPYPDNGIKFFSSHGAK 119

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +   +E  IE  ++  +T  +     +G   RVD    RYIE  K T+P   +L+G+++V
Sbjct: 120 LDDAVELAIEAQMDQPMT--IVESADLGKVTRVDDAAGRYIEFCKSTIPSSFSLRGVKMV 177

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           +DCA+GA+Y+VAP V  ELGA V+++G +PNG+NIN + GST   +LQ +V +  AD+GI
Sbjct: 178 IDCAHGATYQVAPAVMEELGASVILMGAQPNGLNINDEVGSTEPAALQARVLQESADLGI 237

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           A DGDGDR++ VD  G +V+GD+++ +IA++ +  +   G  + T  MSN+G E  +  L
Sbjct: 238 AFDGDGDRLLFVDRNGEVVDGDELLFIIAKDQLRSAGSCGGVVGTL-MSNLGFELALKEL 296

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
            +   R++VGDRY++E M + G+ +GGE SGHII +D  +TGD LVAAL+VL  +     
Sbjct: 297 EIPFVRSKVGDRYVVELMTSRGWKLGGENSGHIICADVTTTGDALVAALKVLYALVDGGV 356

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTSIL-NSSSIVQAIADAESELRGIDRLIVRASGTESL 419
           P+        ++PQ + +V++ D S L N+  I +AIA AE  L G  R+++R SGTE +
Sbjct: 357 PLHDAKLGMNKFPQTMINVALADKSRLQNNPEIDRAIAAAEKSLNGRGRVLLRPSGTEPV 416

Query: 420 IRIMAEGDDLSRIKRIVDDLAKVIP 444
           +R+M EG+D + +  +  ++A V+ 
Sbjct: 417 VRVMVEGEDEALVNTLAAEIAAVVE 441


>gi|126461286|ref|YP_001042400.1| phosphoglucosamine mutase [Rhodobacter sphaeroides ATCC 17029]
 gi|221638272|ref|YP_002524534.1| phosphoglucosamine mutase [Rhodobacter sphaeroides KD131]
 gi|158705806|sp|A3PH12|GLMM_RHOS1 RecName: Full=Phosphoglucosamine mutase
 gi|254798591|sp|B9KM35|GLMM_RHOSK RecName: Full=Phosphoglucosamine mutase
 gi|126102950|gb|ABN75628.1| phosphoglucosamine mutase [Rhodobacter sphaeroides ATCC 17029]
 gi|221159053|gb|ACM00033.1| Phosphoglucosamine mutase [Rhodobacter sphaeroides KD131]
          Length = 447

 Score =  274 bits (701), Expect = 2e-71,   Method: Composition-based stats.
 Identities = 226/446 (50%), Positives = 301/446 (67%), Gaps = 4/446 (0%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKK-KHRRVVIGKDTRLSGYMLE 59
           M R+ FGTDG+RG +NT P+T    +R+G A G  FR       RVVIGKDTRLSGYMLE
Sbjct: 1   MTRKLFGTDGVRGTANTHPMTAEMALRLGAAAGRYFRPVGAGSPRVVIGKDTRLSGYMLE 60

Query: 60  NSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGY 119
           N+L AG T+ GM+  +LGP+P+PAV  LTRS+RA +GVMISASHNP++DNGIK FGPDG+
Sbjct: 61  NALTAGLTSTGMNVLLLGPVPTPAVGFLTRSMRAALGVMISASHNPHEDNGIKFFGPDGF 120

Query: 120 KVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRI 179
           K+S + E  IE +L  ++        +IG AKR++    RY E+ K T P  + L GL++
Sbjct: 121 KLSDEAEAEIEAILAGEIQPA--QPGNIGRAKRIEDGRGRYQEYCKTTFPSGLRLDGLKV 178

Query: 180 VVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIG 239
           V+DCANGA+Y+ APEV WELGA+V+ +G +PNG NINL CGST+  +    V    AD+G
Sbjct: 179 VIDCANGAAYRAAPEVLWELGAEVIPVGVEPNGKNINLRCGSTHPEAAAEAVRAHGADVG 238

Query: 240 IALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAG 299
           I LDGD DRVII+DE G   +GDQIMAL A  W     LR   +V TVMSN+GLERF+  
Sbjct: 239 ICLDGDADRVIILDETGKEADGDQIMALFAARWADEGRLRDGTLVATVMSNLGLERFLGA 298

Query: 300 LGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYD 359
            GL L+RT VGDRY++E M+  G+N+GGEQSGHI+++D+ +TGDGL+A LQ L  + Q  
Sbjct: 299 RGLRLERTPVGDRYVVEAMRRGGWNLGGEQSGHIVMTDFATTGDGLLAGLQFLAAMAQTG 358

Query: 360 KPVSTICHCFEEYPQFLRSVSV-KDTSILNSSSIVQAIADAESELRGIDRLIVRASGTES 418
           +  S +   FE  PQ L++V        L +  +   I DAE  L G  RL++R SGTE 
Sbjct: 359 RRASDLARSFETVPQLLQNVRYAAGQEPLKAPGVQAVIRDAEVRLNGAGRLLIRKSGTEP 418

Query: 419 LIRIMAEGDDLSRIKRIVDDLAKVIP 444
           LIR+MAE +D + ++ +V+++   + 
Sbjct: 419 LIRVMAECEDEALLRDVVEEIVAAVR 444


>gi|83592436|ref|YP_426188.1| phosphoglucosamine mutase [Rhodospirillum rubrum ATCC 11170]
 gi|123739578|sp|Q2RVE4|GLMM_RHORT RecName: Full=Phosphoglucosamine mutase
 gi|83575350|gb|ABC21901.1| phosphoglucosamine mutase [Rhodospirillum rubrum ATCC 11170]
          Length = 452

 Score =  274 bits (701), Expect = 2e-71,   Method: Composition-based stats.
 Identities = 246/448 (54%), Positives = 324/448 (72%), Gaps = 4/448 (0%)

Query: 1   MKRR-FFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLE 59
           M +R  FGTDG+RG +N  P+T +  +RIG+A G+L R       VVIGKDTRLSGYMLE
Sbjct: 1   MAKRTLFGTDGVRGTANREPMTADTALRIGMAAGHLLRNGDHRHTVVIGKDTRLSGYMLE 60

Query: 60  NSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGY 119
            +L AGF + GMD  +LGP+P+PAVAMLTRSLRAD+GVMI+ASHNP+QDNGIKLFGPDGY
Sbjct: 61  PALAAGFISVGMDVVLLGPLPTPAVAMLTRSLRADLGVMITASHNPFQDNGIKLFGPDGY 120

Query: 120 KVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRI 179
           K+S D E  IE LL++ L  + +   ++G A+R+D  + RY+E VK T PR   L+GLRI
Sbjct: 121 KLSDDQEATIEALLDNGLEGHRAGPTALGKARRLDDCNGRYVEFVKSTFPRGRRLEGLRI 180

Query: 180 VVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIG 239
           VVDCA+GA+Y+VAP+V WELGA +V IG  P+G NIN DCGS +   +   V    AD+G
Sbjct: 181 VVDCAHGAAYRVAPKVLWELGATIVPIGVTPDGTNINKDCGSLHSRVMCETVVREGADLG 240

Query: 240 IALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAG 299
           +ALDGD DRV++ DEKGA+V+GDQ++ALI R W     L+G G+V TVMSN+GLERF+  
Sbjct: 241 VALDGDADRVVLCDEKGALVDGDQLLALIGRNWKRAGTLQGGGVVATVMSNLGLERFLKD 300

Query: 300 LGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYD 359
            GL+L RT VGDRY++E+M+  G+N+GGEQSGHI++SD+G+TGDGL+AALQVL  +   D
Sbjct: 301 EGLALARTPVGDRYVVEHMRAEGYNLGGEQSGHIVMSDFGTTGDGLMAALQVLSALVAED 360

Query: 360 KPVSTICHCFEEYPQFLRSVSV---KDTSILNSSSIVQAIADAESELRGIDRLIVRASGT 416
           +P S +   F   PQ LR+V V      +IL    + +A++  E  L G  RL++R SGT
Sbjct: 361 RPASEVLDVFTPLPQLLRNVRVAGHDPRAILADPQVARAVSAGEGRLNGGGRLLIRKSGT 420

Query: 417 ESLIRIMAEGDDLSRIKRIVDDLAKVIP 444
           E LIR+MAEG+D + + ++V D+  VI 
Sbjct: 421 EPLIRVMAEGEDEALVAQVVGDICAVIE 448


>gi|148253341|ref|YP_001237926.1| phosphoglucosamine mutase [Bradyrhizobium sp. BTAi1]
 gi|158513271|sp|A5ECX6|GLMM_BRASB RecName: Full=Phosphoglucosamine mutase
 gi|146405514|gb|ABQ34020.1| phosphoglucosamine mutase [Bradyrhizobium sp. BTAi1]
          Length = 449

 Score =  274 bits (700), Expect = 2e-71,   Method: Composition-based stats.
 Identities = 259/443 (58%), Positives = 339/443 (76%), Gaps = 1/443 (0%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M R +FGTDGIRG++N   ITP   +++G A G LF+  +   RVVIGKDTRLSGYM+E 
Sbjct: 1   MSRNYFGTDGIRGRAN-GLITPELALKVGQAAGLLFQRGEHRHRVVIGKDTRLSGYMIEY 59

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           ++VAGFT+ GMD  ++GP+P+PAVAMLT+S+RAD+GVMISASHN ++DNGIKLFGP G+K
Sbjct: 60  AMVAGFTSVGMDVLLVGPMPTPAVAMLTKSMRADLGVMISASHNLFEDNGIKLFGPQGFK 119

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +S D+E +IE LL++ L   L+   S+G A+R+DGVHDRYIE  KRTLPRD++L GLR+V
Sbjct: 120 LSDDVEKQIEQLLDESLDKKLAQSASLGRARRIDGVHDRYIEFAKRTLPRDLSLDGLRVV 179

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           VDCANGA+YKV PE  WELGADV+ IG +P+G NIN +CGST+  +L RKV E+RADIGI
Sbjct: 180 VDCANGAAYKVVPEALWELGADVISIGVEPDGFNINKECGSTSPEALCRKVREMRADIGI 239

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           ALDGD DRVI+VDE+G IV+GDQ++A+IA+ W     L   GIV TVMSN+GLERF+ G 
Sbjct: 240 ALDGDADRVILVDERGHIVDGDQLLAVIAQSWKEDGRLARPGIVATVMSNLGLERFLQGQ 299

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           GL L RT VGDRY++E M  +G+N+GGEQSGHIILSDY +TGDG VAALQVL  +++  +
Sbjct: 300 GLELVRTPVGDRYVLERMLADGYNLGGEQSGHIILSDYATTGDGFVAALQVLATVQRLRR 359

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
           PVS +CH F+  PQ L++V  +    L++ ++  AI   +  L G  RL+VR+SGTE +I
Sbjct: 360 PVSEVCHKFDPLPQILKNVRYRSGKPLDADAVKSAIDTGQKRLNGHGRLLVRSSGTEPVI 419

Query: 421 RIMAEGDDLSRIKRIVDDLAKVI 443
           R+M EGDD   ++ +VDD+   +
Sbjct: 420 RVMGEGDDRDLVEEVVDDIVTAV 442


>gi|83644096|ref|YP_432531.1| phosphoglucosamine mutase [Hahella chejuensis KCTC 2396]
 gi|123534481|sp|Q2SML8|GLMM_HAHCH RecName: Full=Phosphoglucosamine mutase
 gi|83632139|gb|ABC28106.1| phosphoglucosamine mutase [Hahella chejuensis KCTC 2396]
          Length = 445

 Score =  274 bits (699), Expect = 2e-71,   Method: Composition-based stats.
 Identities = 198/445 (44%), Positives = 291/445 (65%), Gaps = 4/445 (0%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M + +FGTDGIRG+    PITP FM+++G A G +FR + +  RV+IGKDTR+SGY+ E+
Sbjct: 1   MSKEYFGTDGIRGRVGEGPITPEFMLKLGWAAGRVFRQEGRRNRVLIGKDTRISGYIFES 60

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +L +G  AAG+D  +LGP+P+PA+A LTR+ RA  G++ISASHNP+ DNG+K F  +G K
Sbjct: 61  ALESGLAAAGVDVAMLGPMPTPAIAYLTRTFRACAGIVISASHNPFNDNGVKFFSAEGTK 120

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +    E++IE  +   +   +     +G A R +    RYIE  K T+P  ++  G+R+V
Sbjct: 121 LPDSTEEQIEHFIRQPME--IVPSSQLGKAARFEDAKGRYIEFCKSTVPFHMSFAGMRVV 178

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           +DCA GA+Y+VAP VF ELGA V  IG  P+G+NIN + GST+   L  KV E  AD+GI
Sbjct: 179 LDCAQGATYQVAPSVFKELGAKVETIGVTPDGLNINHEIGSTHPDQLAAKVVEAGADLGI 238

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           A DGDGDRV++VD KG IV+GD+I+ +IAR+ M    L+G  + T  M+N G E     L
Sbjct: 239 AFDGDGDRVVMVDHKGEIVDGDEILYIIARDKMRKGRLKGGVVGTL-MTNFGAELAFGEL 297

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           G+  +R  VGDRY+ME +  N + +GGE SGHI+  D  +TGDG++++LQVL  +     
Sbjct: 298 GIPFERANVGDRYVMEALLRNDWCLGGEGSGHIVCLDRTTTGDGIISSLQVLAALSDLGI 357

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTSILNSS-SIVQAIADAESELRGIDRLIVRASGTESL 419
            +        + PQ + +V V     +    +I  A+A+AE +  G  R+++R+SGTE +
Sbjct: 358 TLHEAKKGMSKLPQHMINVRVSQKVDIKGHTTIQSAVANAEKQFAGKGRVLLRSSGTEPV 417

Query: 420 IRIMAEGDDLSRIKRIVDDLAKVIP 444
           IR+MAEG+D ++++ IV +LAK++ 
Sbjct: 418 IRVMAEGEDEAKVRSIVAELAKIVE 442


>gi|108755192|emb|CAK32584.1| phosphomannomutase [uncultured organism]
          Length = 448

 Score =  274 bits (699), Expect = 2e-71,   Method: Composition-based stats.
 Identities = 250/443 (56%), Positives = 322/443 (72%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M R+ FGTDGIRG +N  P+T    +R+G+A    F       RVVIGKDTRLSGY++E 
Sbjct: 1   MTRKLFGTDGIRGTANREPMTAATALRVGMAAAAHFTRGNHRHRVVIGKDTRLSGYLIEP 60

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +L AGF + GMD  ++GP+P+PAVAMLTRSLRAD+GVMISASHNPY+DNG+KLFGPD YK
Sbjct: 61  ALTAGFVSMGMDVILVGPLPTPAVAMLTRSLRADLGVMISASHNPYEDNGLKLFGPDAYK 120

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +S ++E  IE  ++ D++  L     +G AKR+D    RY EHVK+T P+ + L GL++V
Sbjct: 121 LSDEVEAEIERRMDGDMSGGLVAPADLGRAKRLDDAQGRYTEHVKQTFPKGLRLDGLKVV 180

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           VDCANGA+YKVAPE+ WELGADV+ IG +P+G NIN DCGST V ++   V    AD+G+
Sbjct: 181 VDCANGAAYKVAPEILWELGADVISIGVQPDGFNINKDCGSTCVETMCGHVAPNGADLGL 240

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           ALDGD DRV+I DE GA+++GDQ+M L+A  W  +  L+G G+V TVMSN+GLER++ G+
Sbjct: 241 ALDGDADRVLIADETGALIDGDQMMGLVAGHWAGNGQLKGGGVVATVMSNLGLERYLDGI 300

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           GL L RT VGDRY++E+M+ +GFN+GGEQSGH+IL DY +TGDGL+AALQVL  I Q  +
Sbjct: 301 GLDLVRTPVGDRYVVEHMRRHGFNLGGEQSGHLILGDYSTTGDGLIAALQVLAVIVQRRR 360

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
           P S +C  FE  PQ LR+VS      L   S+  AIA AE  L    RL+VR SGTE +I
Sbjct: 361 PASEVCRVFEALPQRLRNVSFNGGRPLEHDSVKAAIAAAEKRLGKTGRLLVRRSGTEPVI 420

Query: 421 RIMAEGDDLSRIKRIVDDLAKVI 443
           R+MAEG+D   I  +VDD+A VI
Sbjct: 421 RVMAEGEDEDLIGAVVDDIAGVI 443


>gi|237808994|ref|YP_002893434.1| phosphoglucosamine mutase [Tolumonas auensis DSM 9187]
 gi|237501255|gb|ACQ93848.1| phosphoglucosamine mutase [Tolumonas auensis DSM 9187]
          Length = 444

 Score =  274 bits (699), Expect = 2e-71,   Method: Composition-based stats.
 Identities = 205/444 (46%), Positives = 298/444 (67%), Gaps = 5/444 (1%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M R++FGTDG+RGK    PITP+F+M++G A G +   +   ++V+IGKDTR+SGYMLE 
Sbjct: 1   MSRKYFGTDGVRGKVGEMPITPDFVMKLGWAAGKVLAKQG-SKKVLIGKDTRISGYMLEA 59

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +L AG +AAG+   +LGP+P+PAVA LTR+ RA+ GV+ISASHNPY DNGIK F   G K
Sbjct: 60  ALEAGLSAAGLKPVLLGPMPTPAVAYLTRTFRAEAGVVISASHNPYYDNGIKFFSAQGTK 119

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +  +IE+ IE  +++D+         +G A R+D    RYIE  K T P ++ L GL+IV
Sbjct: 120 LPDEIENAIEKTMDEDI--RCVESAQLGKASRIDDAPGRYIEFCKSTFPGELNLDGLKIV 177

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           VDCA+GA+Y +AP VF ELGADV+ +G  P+G+NIN   GST   +L  +V + +AD+GI
Sbjct: 178 VDCAHGATYHIAPSVFRELGADVITMGCAPDGLNINDHVGSTAPQALVERVLQEKADLGI 237

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           A DGDGDR+I+VD  G  V+GD+++ +IA   +        G+V T+M+N+GLE  +A  
Sbjct: 238 AFDGDGDRLIMVDHTGYEVDGDELLYIIA-CDLQQQGSLTGGVVGTLMTNMGLEVALAKR 296

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
            + L R +VGDRY+ME ++  G+ +GGE SGHII  D  +TGDG+VAALQVL+   +  K
Sbjct: 297 DIPLVRAKVGDRYVMELLQEKGWRLGGENSGHIICLDQTTTGDGIVAALQVLKAASRAGK 356

Query: 361 PVSTICHCFEEYPQFLRSVS-VKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESL 419
            +  +     ++PQ L +V  V D   L S+S+ QA+ DAE  L    R+++R SGTE L
Sbjct: 357 TLFELRSDIRKFPQILINVRFVGDHDPLLSASVQQAVRDAEKILGQTGRVLLRKSGTEPL 416

Query: 420 IRIMAEGDDLSRIKRIVDDLAKVI 443
           +R+M EG++  +++++ + +A  +
Sbjct: 417 LRVMVEGENEQQVRQLAEKIAAEV 440


>gi|90022363|ref|YP_528190.1| phosphoglucosamine mutase [Saccharophagus degradans 2-40]
 gi|123276501|sp|Q21H51|GLMM_SACD2 RecName: Full=Phosphoglucosamine mutase
 gi|89951963|gb|ABD81978.1| phosphoglucosamine mutase [Saccharophagus degradans 2-40]
          Length = 446

 Score =  274 bits (699), Expect = 2e-71,   Method: Composition-based stats.
 Identities = 212/447 (47%), Positives = 299/447 (66%), Gaps = 10/447 (2%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRR---VVIGKDTRLSGYM 57
           M R++FGTDGIRG      ITP F +++G AVG +   +   +    V+IGKDTR+SGYM
Sbjct: 1   MARKYFGTDGIRGLVGEGVITPQFFLQLGWAVGKVLAQQNGDKSGGLVLIGKDTRISGYM 60

Query: 58  LENSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPD 117
            E++L AG  +AG+D  +LGP+P+PA+A LTR+ +A  G++ISASHNPY DNGIKLF  D
Sbjct: 61  FESALEAGLISAGVDVGLLGPMPTPAIAYLTRTFQASAGIVISASHNPYTDNGIKLFNTD 120

Query: 118 GYKVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGL 177
           G K+  D    +E  +ED L   ++    +G A+R+     RYIE  K +LP    L+GL
Sbjct: 121 GTKLPDD----VELAIEDQLDRAMTTASKLGKARRIADAEGRYIEFCKGSLPWGFNLRGL 176

Query: 178 RIVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRAD 237
            IVVDCANGA+Y+VAP+VF ELGA+V+ I +KP+G+NINLDCGST +  LQ+ V E  AD
Sbjct: 177 NIVVDCANGATYEVAPKVFGELGANVIPIANKPDGLNINLDCGSTKLNQLQKHVLETGAD 236

Query: 238 IGIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFI 297
           +GIA DGDGDRV+ VDEKG +++GDQ++ +IA     +     +G+V T+MSN G E  +
Sbjct: 237 MGIAFDGDGDRVMFVDEKGEVLDGDQLLFIIASHKHKNGG--CSGVVGTLMSNFGFELGL 294

Query: 298 AGLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQ 357
              G+  +R +VGDRY++E MKNNG+ VGGE SGHI+ SD  +TGDG++AALQVL  +K 
Sbjct: 295 KNQGIPFERAKVGDRYVIEAMKNNGWQVGGESSGHIVCSDVTTTGDGIIAALQVLLALKA 354

Query: 358 YDKPVSTICHCFEEYPQFLRSVSVKDTSILNS-SSIVQAIADAESELRGIDRLIVRASGT 416
             + +  +    ++ PQ + +V V +   L+S   +  AIA AE  L G  R+++RASGT
Sbjct: 355 EKQSLHQLKLRMQKMPQVMINVRVTNKVDLDSHEQVQAAIASAEKRLDGKGRVLLRASGT 414

Query: 417 ESLIRIMAEGDDLSRIKRIVDDLAKVI 443
           E +IR+M EG +   +  +  +LA ++
Sbjct: 415 EPVIRVMVEGQEHQLVASLAQELADIV 441


>gi|197106423|ref|YP_002131800.1| phosphoglucomutase/phosphomannomutase family protein
           [Phenylobacterium zucineum HLK1]
 gi|226723903|sp|B4R906|GLMM_PHEZH RecName: Full=Phosphoglucosamine mutase
 gi|196479843|gb|ACG79371.1| phosphoglucomutase/phosphomannomutase family protein
           [Phenylobacterium zucineum HLK1]
          Length = 450

 Score =  274 bits (699), Expect = 3e-71,   Method: Composition-based stats.
 Identities = 247/450 (54%), Positives = 326/450 (72%), Gaps = 2/450 (0%)

Query: 1   MKRR-FFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRR-VVIGKDTRLSGYML 58
           M +R +FGTDGIRG++N  P+T    +R+G+A G LF  K   R  VVIGKDTRLSGYM+
Sbjct: 1   MSKRAYFGTDGIRGQANRHPMTAEVALRVGMAAGKLFMSKDDRRHLVVIGKDTRLSGYMI 60

Query: 59  ENSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDG 118
           E +LVAGFT+ GMD  + GP+P+P VAM+TRSLRAD+GVMISASHN + DNGIKLFGPDG
Sbjct: 61  EPALVAGFTSVGMDVRLFGPLPTPGVAMMTRSLRADLGVMISASHNHFADNGIKLFGPDG 120

Query: 119 YKVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLR 178
           YK+S + E  IE L++  L   L+  D +G  +R+D    RY+E  K T P+ ++L G+R
Sbjct: 121 YKLSDEKELEIEALMDQGLQEGLATPDKLGRVQRIDDCQARYVEIAKATFPKGLSLAGMR 180

Query: 179 IVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADI 238
           IV+DCANGA+YKVAPE  +ELGA+V+ +G +PNG NIN +CGST+  ++ R V E RADI
Sbjct: 181 IVIDCANGAAYKVAPETLYELGAEVIRVGVEPNGFNINEECGSTHPAAMSRLVKEYRADI 240

Query: 239 GIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIA 298
           GIALDGD DR++I DEKG +V+GDQIMALIA  W     L+G G+V TVMSN+GLERF+ 
Sbjct: 241 GIALDGDADRLVICDEKGQVVDGDQIMALIADSWAKAGRLQGGGVVATVMSNLGLERFLK 300

Query: 299 GLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQY 358
              L L+RT+VGDRY+M  M+  GFNVGGEQSGH+ILSD  +TGDGL+AALQVL  +++ 
Sbjct: 301 ARNLKLERTQVGDRYVMARMREGGFNVGGEQSGHVILSDLSTTGDGLLAALQVLAVLQES 360

Query: 359 DKPVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTES 418
           D+P+S +   FE  PQ L +V       L   ++ +A+A+AE  L G  R++VRASGTE 
Sbjct: 361 DRPMSALARQFEPVPQKLENVRFGSGKPLEHDAVKKALAEAEQRLNGSGRIVVRASGTEP 420

Query: 419 LIRIMAEGDDLSRIKRIVDDLAKVIPMIDS 448
           LIR+MAEGDD   + ++V ++   +  + +
Sbjct: 421 LIRVMAEGDDEKLVSQVVKEIVGAVKKVAA 450


>gi|298292989|ref|YP_003694928.1| phosphoglucosamine mutase [Starkeya novella DSM 506]
 gi|296929500|gb|ADH90309.1| phosphoglucosamine mutase [Starkeya novella DSM 506]
          Length = 447

 Score =  274 bits (699), Expect = 3e-71,   Method: Composition-based stats.
 Identities = 260/438 (59%), Positives = 336/438 (76%), Gaps = 1/438 (0%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M R+ FGTDGIRG++N   ITP   +R+G+A G +F+      RVVIGKDTRLSGYM+EN
Sbjct: 1   MGRKLFGTDGIRGRAN-GTITPELALRVGMAAGLVFQRGDYRHRVVIGKDTRLSGYMIEN 59

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +LVAGFT+ GMD  +LGP+P+PAVAMLT S+RAD+GVMISASHNPY DNGIKLFGPDGYK
Sbjct: 60  ALVAGFTSVGMDVLLLGPVPTPAVAMLTHSMRADIGVMISASHNPYDDNGIKLFGPDGYK 119

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +S ++E RIE L+  D+++ L+   S+G AKR++ VH RYIE+ KRTLPR  +  GLR+V
Sbjct: 120 LSDELEARIEELIAGDMSTKLASPASMGRAKRIESVHARYIEYAKRTLPRTQSFDGLRVV 179

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           VDCANGA+Y+VAPE  WELG +V+ IGDKP+G NIN + GST   +L  KV EVRADIGI
Sbjct: 180 VDCANGAAYRVAPEALWELGCEVITIGDKPDGFNINHEVGSTAPEALMAKVREVRADIGI 239

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           ALDGD DRV+IVDEKG +V+GDQ+MA++A  +     L  +GIV TVMSN+ LER +  +
Sbjct: 240 ALDGDADRVLIVDEKGRLVDGDQLMAVVAESFKEDGRLARDGIVATVMSNLALERHLNSV 299

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           GL+L RT VGDRY++E+M+ NGFNVGGEQSGH+ILSDY +TGDGLVAALQVL  +++  +
Sbjct: 300 GLTLDRTPVGDRYVLEHMRANGFNVGGEQSGHLILSDYSTTGDGLVAALQVLAVVQRRQR 359

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
           PVS +CH F+  PQ L++V  K+   L    +++AIA AE +L    RL++R SGTE +I
Sbjct: 360 PVSEVCHRFDALPQILKNVRYKNGRPLEDDGVIKAIAAAELKLNSHGRLLIRPSGTEPVI 419

Query: 421 RIMAEGDDLSRIKRIVDD 438
           R+M EGDD   ++ +V+D
Sbjct: 420 RVMGEGDDRDLVEAVVND 437


>gi|126725584|ref|ZP_01741426.1| phosphoglucosamine mutase [Rhodobacterales bacterium HTCC2150]
 gi|126704788|gb|EBA03879.1| phosphoglucosamine mutase [Rhodobacterales bacterium HTCC2150]
          Length = 447

 Score =  274 bits (699), Expect = 3e-71,   Method: Composition-based stats.
 Identities = 232/447 (51%), Positives = 308/447 (68%), Gaps = 4/447 (0%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKK-KHRRVVIGKDTRLSGYMLE 59
           M R+FFGTDG+RG++NT+P+T    +++G A G  FR       RVVIGKDTRLSGYM E
Sbjct: 1   MTRKFFGTDGVRGRANTYPMTAELALKLGAAAGRYFRRDGSPAHRVVIGKDTRLSGYMFE 60

Query: 60  NSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGY 119
           N+L AGFT+ GM+  +LGP+P+PAV +LT S+RADVGVMISASHNP+ DNGIK FGPDG+
Sbjct: 61  NALTAGFTSTGMNVLLLGPVPTPAVGLLTTSMRADVGVMISASHNPHTDNGIKFFGPDGF 120

Query: 120 KVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRI 179
           K+S + E  IE LL  D+       ++IG AKR+D    RY E  K T P D  L GL++
Sbjct: 121 KLSDETEKEIEALLMGDIEPV--MAENIGRAKRIDDGRFRYQERAKTTFPSDQRLDGLKV 178

Query: 180 VVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIG 239
           V+DCANGA+YK APEV WELGA V+ IG  PNG NIN DCGST+  +    V    AD+G
Sbjct: 179 VIDCANGAAYKAAPEVLWELGAKVIPIGTSPNGNNINKDCGSTHTETAAAAVVAHGADVG 238

Query: 240 IALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAG 299
           I LDGD DRV+I+DE G + +GDQ+MALIA+ W +   L+G+ +V TVMSN+GLER +A 
Sbjct: 239 ICLDGDADRVMIIDEAGNVADGDQLMALIAKRWANDGRLKGHALVATVMSNLGLERELAK 298

Query: 300 LGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYD 359
             ++L RT+VGDRY++E M+   FN+GGEQSGHI+++D+ +TGDGL+A LQ L  + +  
Sbjct: 299 SSIALHRTDVGDRYVVEAMRKGSFNLGGEQSGHIVMTDHATTGDGLIAGLQFLSEMIRTG 358

Query: 360 KPVSTICHCFEEYPQFLRSVSVK-DTSILNSSSIVQAIADAESELRGIDRLIVRASGTES 418
           +P S +   FE  PQ L++V  +   + L   S+  +I DAE  L G  RL++R SGTE 
Sbjct: 359 QPASELTRQFEPCPQLLKNVRFETGQTPLEIQSVKDSIKDAEKRLIGNGRLLIRKSGTEP 418

Query: 419 LIRIMAEGDDLSRIKRIVDDLAKVIPM 445
           LIR+MAE +D   +  +VD +   +  
Sbjct: 419 LIRVMAECEDEGTLNEVVDSVVSAVEN 445


>gi|77462409|ref|YP_351913.1| phosphoglucosamine mutase [Rhodobacter sphaeroides 2.4.1]
 gi|123592820|sp|Q3J5C2|GLMM_RHOS4 RecName: Full=Phosphoglucosamine mutase
 gi|77386827|gb|ABA78012.1| phosphoglucosamine mutase [Rhodobacter sphaeroides 2.4.1]
          Length = 447

 Score =  274 bits (699), Expect = 3e-71,   Method: Composition-based stats.
 Identities = 226/446 (50%), Positives = 301/446 (67%), Gaps = 4/446 (0%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKK-KHRRVVIGKDTRLSGYMLE 59
           M R+ FGTDG+RG +NT P+T    +R+G A G  FR       RVVIGKDTRLSGYMLE
Sbjct: 1   MTRKLFGTDGVRGTANTHPMTAEMALRLGAAAGRYFRPVGAGSPRVVIGKDTRLSGYMLE 60

Query: 60  NSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGY 119
           N+L AG T+ GM+  +LGP+P+PAV  LTRS+RA +GVMISASHNP++DNGIK FGPDG+
Sbjct: 61  NALTAGLTSTGMNVLLLGPVPTPAVGFLTRSMRAALGVMISASHNPHEDNGIKFFGPDGF 120

Query: 120 KVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRI 179
           K+S + E  IE +L  ++        +IG AKR++    RY E+ K T P  + L GL++
Sbjct: 121 KLSDEAEAEIEAILAGEIQPA--QPGNIGRAKRIEDGRGRYQEYCKTTFPSGLRLDGLKV 178

Query: 180 VVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIG 239
           V+DCANGA+Y+ APEV WELGA+V+ +G +PNG NINL CGST+  +    V    AD+G
Sbjct: 179 VIDCANGAAYRAAPEVLWELGAEVIPVGVEPNGKNINLRCGSTHPQAAGEAVRAHGADVG 238

Query: 240 IALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAG 299
           I LDGD DRVII+DE G   +GDQIMAL A  W     LR   +V TVMSN+GLERF+  
Sbjct: 239 ICLDGDADRVIILDETGKEADGDQIMALFAARWADEGRLRDGTLVATVMSNLGLERFLGA 298

Query: 300 LGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYD 359
            GL L+RT VGDRY++E M+  G+N+GGEQSGHI+++D+ +TGDGL+A LQ L  + Q  
Sbjct: 299 RGLRLERTPVGDRYVVEAMRRGGWNLGGEQSGHIVMTDFATTGDGLLAGLQFLAAMAQTG 358

Query: 360 KPVSTICHCFEEYPQFLRSVSV-KDTSILNSSSIVQAIADAESELRGIDRLIVRASGTES 418
           +  S +   FE  PQ L++V        L +  +   I DAE  L G  RL++R SGTE 
Sbjct: 359 RRASDLARSFETVPQLLQNVRYAAGQEPLKAPGVQAVIRDAEVRLNGAGRLLIRKSGTEP 418

Query: 419 LIRIMAEGDDLSRIKRIVDDLAKVIP 444
           LIR+MAE +D + ++ +V+++   + 
Sbjct: 419 LIRVMAECEDEALLRDVVEEIVAAVR 444


>gi|332185395|ref|ZP_08387143.1| phosphoglucosamine mutase [Sphingomonas sp. S17]
 gi|332014373|gb|EGI56430.1| phosphoglucosamine mutase [Sphingomonas sp. S17]
          Length = 446

 Score =  274 bits (699), Expect = 3e-71,   Method: Composition-based stats.
 Identities = 252/448 (56%), Positives = 316/448 (70%), Gaps = 2/448 (0%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M R++FGTDGIRG +N   +T    M++G+A G  F       RVVIGKDTRLSGYMLE+
Sbjct: 1   MARKYFGTDGIRGATNGAVMTAEMAMKVGMAAGAYFLRGDHRHRVVIGKDTRLSGYMLES 60

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +LVAGFT+ GMD  ++GP+P+PAVAMLT S+RAD+GVMISASHNP+ DNGIKLFGPDGYK
Sbjct: 61  ALVAGFTSVGMDVVMVGPLPTPAVAMLTHSMRADIGVMISASHNPFADNGIKLFGPDGYK 120

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +S + E+ IETL+E+ +   L     IG A+RVD    RYI   K T P+ + L GLR+V
Sbjct: 121 LSDEAEESIETLIEEKV--PLVPSGKIGRARRVDDAAGRYIHFAKSTFPQSLRLDGLRVV 178

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           +DCANGA+YKVAP   WELGADVV IG  PNG NIN   GST   +L   V    ADIGI
Sbjct: 179 IDCANGAAYKVAPAALWELGADVVAIGVTPNGTNINDGVGSTAPQTLAETVVASGADIGI 238

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           ALDGD DR+IIVDEKG IV+GDQ+MA IA  +     L G G+V TVMSN+GLER +A  
Sbjct: 239 ALDGDADRLIIVDEKGMIVDGDQLMATIATSYAREGRLAGGGLVATVMSNLGLERHLAAQ 298

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           GL L RT+VGDR+++E M+  G+NVGGEQSGHIILSDY  TGDGLVAALQVL  IK+   
Sbjct: 299 GLGLVRTKVGDRHVLEAMRTRGYNVGGEQSGHIILSDYARTGDGLVAALQVLAEIKRAGA 358

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
           P S + H F+  PQ L++V       L    +   IA AE+EL G  RL++R SGTE +I
Sbjct: 359 PASEVLHRFDPLPQLLKNVRFAGGKPLEHEKVQGVIAAAEAELAGRGRLVIRPSGTEPVI 418

Query: 421 RIMAEGDDLSRIKRIVDDLAKVIPMIDS 448
           R+MAEG+D ++++ +VD +  V+  + +
Sbjct: 419 RVMAEGEDKAQVETLVDRICDVVREVAA 446


>gi|254491822|ref|ZP_05105001.1| phosphoglucosamine mutase [Methylophaga thiooxidans DMS010]
 gi|224463300|gb|EEF79570.1| phosphoglucosamine mutase [Methylophaga thiooxydans DMS010]
          Length = 448

 Score =  273 bits (698), Expect = 3e-71,   Method: Composition-based stats.
 Identities = 219/446 (49%), Positives = 296/446 (66%), Gaps = 5/446 (1%)

Query: 2   KRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENS 61
           +RR+FGTDGIRGK     ITP+F++++G AVG +   + K+ RV+IGKDTR+SGYM E++
Sbjct: 4   QRRYFGTDGIRGKVGDGAITPDFVLKLGWAVGRVLAKE-KNSRVIIGKDTRISGYMFESA 62

Query: 62  LVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKV 121
           L AG +AAG+D ++LGP+P+PAVA LTR+  A  G++ISASHNPY DNGIK F  +G K+
Sbjct: 63  LQAGLSAAGVDIYLLGPMPTPAVAYLTRTFHAQAGIVISASHNPYHDNGIKFFSAEGTKL 122

Query: 122 STDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVV 181
              IE  IE +L+  L +  S    +G A R+     RYIE  K T+P  V L GL+IVV
Sbjct: 123 PDSIEHEIEAMLDQPLKTVDST--RLGKAHRIADAPGRYIEFCKSTIPSGVDLDGLKIVV 180

Query: 182 DCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIA 241
           DCA+GA+Y VAP+VF ELGADVVV+G +P+G NIN  CGST    LQ+ V E +AD+G+A
Sbjct: 181 DCAHGATYHVAPDVFRELGADVVVMGAEPDGFNINQHCGSTEPRLLQQAVLENKADLGLA 240

Query: 242 LDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLG 301
           LDGDGDR+I+VD +G IV+GD+++ +IAR    +     N +  T MSN+GLE  +A   
Sbjct: 241 LDGDGDRIIMVDHRGEIVDGDELLFIIARARQRNGDKSSNIVG-TQMSNLGLEHALAKFN 299

Query: 302 LSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKP 361
           L L R +VGDRY+ME +K  G  +GGE SGHII  D  STGDG+VAALQVL  I+Q    
Sbjct: 300 LLLHRAQVGDRYVMEKLKQVGGLIGGEASGHIICLDKTSTGDGIVAALQVLAEIRQTGDN 359

Query: 362 VSTICHCFEEYPQFLRSVSVKDTSILNS-SSIVQAIADAESELRGIDRLIVRASGTESLI 420
           +  +     +YPQ L +V V     +     I  A+A  E  L    R+++R SGTE +I
Sbjct: 360 LHALRSVVTKYPQQLINVKVSKMVDIAGNQDIASAVASVEKRLGDEGRVLLRPSGTEPVI 419

Query: 421 RIMAEGDDLSRIKRIVDDLAKVIPMI 446
           R+M EG D +  K++  +LA +I  +
Sbjct: 420 RVMVEGRDATLTKKLAQELADIIQAV 445


>gi|53803871|ref|YP_114284.1| phosphoglucosamine mutase [Methylococcus capsulatus str. Bath]
 gi|81681783|sp|Q607B4|GLMM_METCA RecName: Full=Phosphoglucosamine mutase
 gi|53757632|gb|AAU91923.1| phosphoglucosamine mutase [Methylococcus capsulatus str. Bath]
          Length = 447

 Score =  273 bits (698), Expect = 3e-71,   Method: Composition-based stats.
 Identities = 215/445 (48%), Positives = 300/445 (67%), Gaps = 4/445 (0%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           MK+ +FGTDGIRG+   +PITP+FM+++G A G +F  +   RRV+IGKDTR+SGYM E+
Sbjct: 1   MKKEYFGTDGIRGRVGDYPITPDFMLKLGWAAGCVFAREMPGRRVLIGKDTRISGYMFES 60

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +L AGF+AAG+D  +LGP+P+PAVA LTR+LRA  GV+ISASHNPY DNGIK FGPDG K
Sbjct: 61  ALEAGFSAAGVDTQLLGPMPTPAVAYLTRTLRAQAGVVISASHNPYYDNGIKFFGPDGMK 120

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +  ++E  IE  L   +T+       IG A R+     RYIE  K T+P  +   G++IV
Sbjct: 121 LPDELELLIEDYLGRPMTTVEC--SHIGKATRIVDAAGRYIEFCKSTIPLGMHFSGMKIV 178

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           VDCA+G++Y VAP+VF EL A V  +G  P+G+NIN   G+T+  +L++ V E  AD+GI
Sbjct: 179 VDCAHGSTYHVAPDVFSELRATVSTLGVAPDGLNINDRVGATDPENLRQTVLEENADLGI 238

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           ALDGDGDR+I+VD +G +V+GD+++ +IA    +        +V T+MSN+GLE+ I  L
Sbjct: 239 ALDGDGDRLIMVDHRGEVVDGDELLFVIANARHAE-GELKGSVVGTLMSNLGLEQAIRRL 297

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           GL  +R  VGDRY+ME M  +G  +GGE SGHII  D  +TGDG+V+ALQVL  I +  K
Sbjct: 298 GLEFRRAAVGDRYVMEMMLEHGSMLGGEGSGHIICRDRTTTGDGIVSALQVLAEIVRSGK 357

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAI-ADAESELRGIDRLIVRASGTESL 419
            +  +     +YPQ L +V + +   L S  +VQ + A+ E+EL    R+++R SGTE L
Sbjct: 358 TLHELKQGMRKYPQRLVNVRLAERVSLASVPLVQKVKAEVEAELGDSGRVLLRPSGTEPL 417

Query: 420 IRIMAEGDDLSRIKRIVDDLAKVIP 444
           IR+M EG D  +++ + D LA  + 
Sbjct: 418 IRVMVEGADEGQVRELADRLAGAVA 442


>gi|332560293|ref|ZP_08414615.1| phosphoglucosamine mutase [Rhodobacter sphaeroides WS8N]
 gi|332278005|gb|EGJ23320.1| phosphoglucosamine mutase [Rhodobacter sphaeroides WS8N]
          Length = 447

 Score =  273 bits (698), Expect = 3e-71,   Method: Composition-based stats.
 Identities = 226/446 (50%), Positives = 301/446 (67%), Gaps = 4/446 (0%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKK-KHRRVVIGKDTRLSGYMLE 59
           M R+ FGTDG+RG +NT P+T    +R+G A G  FR       RVVIGKDTRLSGYMLE
Sbjct: 1   MTRKLFGTDGVRGTANTHPMTAEMALRLGAAAGRYFRPVGAGSPRVVIGKDTRLSGYMLE 60

Query: 60  NSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGY 119
           N+L AG T+ GM+  +LGP+P+PAV  LTRS+RA +GVMISASHNP++DNGIK FGPDG+
Sbjct: 61  NALTAGLTSTGMNVLLLGPVPTPAVGFLTRSMRAALGVMISASHNPHEDNGIKFFGPDGF 120

Query: 120 KVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRI 179
           K+S + E  IE +L  ++        +IG AKR++    RY E+ K T P  + L GL++
Sbjct: 121 KLSDEAEAEIEAILAGEIQPA--QPGNIGRAKRIEDGRGRYQEYCKTTFPSGLRLDGLKV 178

Query: 180 VVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIG 239
           V+DCANGA+Y+ APEV WELGA+V+ +G +PNG NINL CGST+  +    V    AD+G
Sbjct: 179 VIDCANGAAYRAAPEVLWELGAEVIPVGVEPNGKNINLRCGSTHPEAAGEAVRAHGADVG 238

Query: 240 IALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAG 299
           I LDGD DRVII+DE G   +GDQIMAL A  W     LR   +V TVMSN+GLERF+  
Sbjct: 239 ICLDGDADRVIILDETGKEADGDQIMALFAARWADEGRLRDGTLVATVMSNLGLERFLGA 298

Query: 300 LGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYD 359
            GL L+RT VGDRY++E M+  G+N+GGEQSGHI+++D+ +TGDGL+A LQ L  + Q  
Sbjct: 299 RGLRLERTPVGDRYVVEAMRRGGWNLGGEQSGHIVMTDFATTGDGLLAGLQFLAAMAQTG 358

Query: 360 KPVSTICHCFEEYPQFLRSVSV-KDTSILNSSSIVQAIADAESELRGIDRLIVRASGTES 418
           +  S +   FE  PQ L++V        L +  +   I DAE  L G  RL++R SGTE 
Sbjct: 359 RRASDLARSFETVPQLLQNVRYAAGQEPLKAPGVQAVIRDAEVRLNGAGRLLIRKSGTEP 418

Query: 419 LIRIMAEGDDLSRIKRIVDDLAKVIP 444
           LIR+MAE +D + ++ +V+++   + 
Sbjct: 419 LIRVMAECEDEALLRDVVEEIVAAVR 444


>gi|330830893|ref|YP_004393845.1| phosphoglucosamine mutase [Aeromonas veronii B565]
 gi|328806029|gb|AEB51228.1| Phosphoglucosamine mutase [Aeromonas veronii B565]
          Length = 444

 Score =  273 bits (698), Expect = 3e-71,   Method: Composition-based stats.
 Identities = 201/445 (45%), Positives = 301/445 (67%), Gaps = 5/445 (1%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M R++FGTDG+RGK   +PITP+F+M++G A G +   KK  ++V+IGKDTR+SGYMLE+
Sbjct: 1   MARKYFGTDGVRGKVGEYPITPDFVMKLGWAAGKVL-SKKGTKKVLIGKDTRISGYMLES 59

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +L AG +AAG+ A ++GP+P+PAVA LTR+ RA+ G++ISASHNP+ DNGIK F  DG K
Sbjct: 60  ALEAGLSAAGLKAILMGPMPTPAVAYLTRTFRAEAGIVISASHNPFYDNGIKFFSADGTK 119

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +  D+E  IE  L+ +L         +G A R+D    RYIE  K T P  + L G+++V
Sbjct: 120 LPDDVELAIEAELDHEL--QCVESAELGKAVRIDDAAGRYIEFCKSTFPSHMNLDGVKMV 177

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           VDC +GA+Y +AP VF ELGA+V+ +G  P+G+NIN   GST   +L  KV E +AD+G+
Sbjct: 178 VDCGHGATYHIAPSVFRELGAEVITMGCAPDGLNINDGVGSTAPDALVAKVLECKADLGV 237

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           A DGDGDR+I+VD  G +++GD+++ +IAR+ + +  L+G  + T  M+N+GLE  +  L
Sbjct: 238 AFDGDGDRLIMVDHTGYLIDGDEVLYIIARDALRNGRLKGGVVGTL-MANMGLELALQTL 296

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           G+   R +VGDRY++E M+  G+ +GGE SGHII  D  +TGDG+VAALQVL  ++  + 
Sbjct: 297 GIPFARAKVGDRYVLEMMEEKGWRIGGENSGHIICLDQTTTGDGIVAALQVLTAMRSAEM 356

Query: 361 PVSTICHCFEEYPQFLRSVSVKD-TSILNSSSIVQAIADAESELRGIDRLIVRASGTESL 419
           P++ +     ++PQ L +V   +    L + +++  +A  E EL G  R+++R SGTE L
Sbjct: 357 PLAKLRSGMSKFPQVLVNVRFAEGKDPLAADAVMAEVAKVEQELAGRGRVLLRKSGTEPL 416

Query: 420 IRIMAEGDDLSRIKRIVDDLAKVIP 444
           IR+M EG+   +++ +   +AK + 
Sbjct: 417 IRVMVEGEHEQQVRDMAQRIAKQVE 441


>gi|146342781|ref|YP_001207829.1| phosphoglucosamine mutase [Bradyrhizobium sp. ORS278]
 gi|158514230|sp|A4Z0D8|GLMM_BRASO RecName: Full=Phosphoglucosamine mutase
 gi|146195587|emb|CAL79614.1| phosphoglucosamine mutase [Bradyrhizobium sp. ORS278]
          Length = 449

 Score =  273 bits (698), Expect = 4e-71,   Method: Composition-based stats.
 Identities = 259/443 (58%), Positives = 340/443 (76%), Gaps = 1/443 (0%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M R +FGTDGIRG++N   ITP   +++G A G LF+  +   RVVIGKDTRLSGYM+E 
Sbjct: 1   MSRNYFGTDGIRGRAN-GLITPELALKVGQAAGLLFQRGEHRHRVVIGKDTRLSGYMIEY 59

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           ++VAGFT+ GMD  ++GP+P+PAVAMLT+S+RAD+GVMISASHN ++DNGIKLFGP G+K
Sbjct: 60  AMVAGFTSVGMDVLLVGPMPTPAVAMLTKSMRADLGVMISASHNLFEDNGIKLFGPQGFK 119

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +S D+E +IE LL++ L   L+   S+G A+R+DGVHDRYIE  KRTLPRD++L GLR+V
Sbjct: 120 LSDDVEKQIEQLLDESLDKKLAQSASLGRARRIDGVHDRYIEFAKRTLPRDLSLDGLRVV 179

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           VDCANGA+YKV PE  WELGADV+ IG +P+G NIN +CGST+  +L RKV E+RADIGI
Sbjct: 180 VDCANGAAYKVVPEALWELGADVISIGVEPDGFNINKECGSTSPEALCRKVREMRADIGI 239

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           ALDGD DRVI+VDE+G IV+GDQ++A+IA+ W     L   GIV TVMSN+GLERF+ G 
Sbjct: 240 ALDGDADRVILVDERGHIVDGDQLLAVIAQSWKEDGRLSRPGIVATVMSNLGLERFLQGQ 299

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           GL L RT VGDRY++E M  +G+N+GGEQSGHIILSDY +TGDG VAALQVL  +++  +
Sbjct: 300 GLELVRTPVGDRYVLERMLADGYNLGGEQSGHIILSDYATTGDGFVAALQVLATVQKLRR 359

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
           PVS +CH F+  PQ L++V  +    L++ ++  AI   +  L G  RL+VR+SGTE +I
Sbjct: 360 PVSEVCHKFDPLPQILKNVRYRSGKPLDTDAVKSAIDTGQKRLNGHGRLLVRSSGTEPVI 419

Query: 421 RIMAEGDDLSRIKRIVDDLAKVI 443
           R+M EGDD + ++ +VDD+   +
Sbjct: 420 RVMGEGDDRNLVEEVVDDIVTAV 442


>gi|254293912|ref|YP_003059935.1| phosphoglucosamine mutase [Hirschia baltica ATCC 49814]
 gi|254042443|gb|ACT59238.1| phosphoglucosamine mutase [Hirschia baltica ATCC 49814]
          Length = 449

 Score =  273 bits (698), Expect = 4e-71,   Method: Composition-based stats.
 Identities = 240/446 (53%), Positives = 318/446 (71%), Gaps = 1/446 (0%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHR-RVVIGKDTRLSGYMLE 59
           M R++FGTDGIRG +N   +TP  +MR+G+A    F+   + R  VVIGKDTRLSGYM+E
Sbjct: 1   MSRKYFGTDGIRGPANKGTMTPEVVMRLGMASASYFKQDNERRHTVVIGKDTRLSGYMIE 60

Query: 60  NSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGY 119
            +L AGFTAAGMD  + GP+P+P VAMLTRSLRAD+GVMISASHN YQDNGIKLFGPDG+
Sbjct: 61  PALTAGFTAAGMDVVLFGPLPTPGVAMLTRSLRADLGVMISASHNAYQDNGIKLFGPDGF 120

Query: 120 KVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRI 179
           K+S + E  IE+L+E  + + L+    +G A R+D    RY+E VK T PR   L  LRI
Sbjct: 121 KLSDEAELEIESLMERPMDADLAASAKLGKASRIDDAQSRYVEIVKATFPRRQRLNKLRI 180

Query: 180 VVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIG 239
           VVDCA+GA+YKVAP+V +ELGA+VV +G  PNG NIN +CGST+  +L   V + RADIG
Sbjct: 181 VVDCAHGAAYKVAPKVLYELGAEVVSLGVSPNGFNINEECGSTDTRALSEAVLKYRADIG 240

Query: 240 IALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAG 299
           IALDGD DRV++ DEKG I++GDQ++ LIA+ W     L    I  TVMSN+GLE F+  
Sbjct: 241 IALDGDADRVVLCDEKGIIIDGDQVLGLIAQSWKEEGKLSKPAISATVMSNLGLENFLKS 300

Query: 300 LGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYD 359
           +G+ L+RT+VGDRY+++ M+ NG N+GGEQSGH+++SDY +TGDGLVAALQVL  + +  
Sbjct: 301 IGIELRRTKVGDRYVVQDMRENGVNLGGEQSGHVVMSDYATTGDGLVAALQVLAVVCKTG 360

Query: 360 KPVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESL 419
           KPVS + H F++ PQ L ++       L + ++ Q + D E EL    RL+VR SGTE L
Sbjct: 361 KPVSEVAHVFDKAPQRLDNIRYSGKDPLTTKAVKQVMKDVEEELGSKGRLVVRKSGTEPL 420

Query: 420 IRIMAEGDDLSRIKRIVDDLAKVIPM 445
           IR+MAE ++ S + + V+D+   +  
Sbjct: 421 IRVMAEAEEESMMNKAVEDVVAAVKQ 446


>gi|222110675|ref|YP_002552939.1| phosphoglucosamine mutase [Acidovorax ebreus TPSY]
 gi|254798576|sp|B9MI07|GLMM_DIAST RecName: Full=Phosphoglucosamine mutase
 gi|221730119|gb|ACM32939.1| phosphoglucosamine mutase [Acidovorax ebreus TPSY]
          Length = 444

 Score =  273 bits (697), Expect = 5e-71,   Method: Composition-based stats.
 Identities = 190/443 (42%), Positives = 279/443 (62%), Gaps = 4/443 (0%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M R++FGTDGIRG     PITP+F +R+  AVG + R  ++   V+IGKDTR+SGYMLE+
Sbjct: 1   MTRKYFGTDGIRGTVGQSPITPDFALRLAHAVGRVLRRTQERPTVLIGKDTRISGYMLES 60

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +L +GF +AG+D  +LGP+P+P VA LTR+ RA +GV+ISASHNPY DNGIK F   G K
Sbjct: 61  ALESGFNSAGVDVVLLGPLPTPGVAYLTRAQRASLGVVISASHNPYPDNGIKFFSAQGTK 120

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +    E+ +E  LE       +   S+G  +R+D    RYIE  K T   D+TL+GL+IV
Sbjct: 121 LPDAWEEEVEAALEQ--PPVWADSASLGKTRRLDDAAGRYIEFCKSTFANDLTLRGLKIV 178

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           VD A+GA+Y +AP+VF ELGA+V+ IG  P+G+NIN   G+T+  +L R V    AD GI
Sbjct: 179 VDAAHGAAYHIAPKVFHELGAEVLAIGCAPDGLNINHQVGATHPDALVRAVRANHADYGI 238

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           ALDGD DRV +VD  G + NGD+++ ++    ++        + T  M+N+ +E  +   
Sbjct: 239 ALDGDADRVQMVDAAGRLFNGDELLYVMVAARLARDEHVPGVVGTL-MTNMAVEEALQRR 297

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           G+   R +VGDRY++E ++   + +GGE SGH++  D  +TGDGL++ALQVL+   +  K
Sbjct: 298 GVKFMRAKVGDRYVLEELQRQHWLLGGEGSGHLLALDRHTTGDGLISALQVLQACVRSGK 357

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQ-AIADAESELRGIDRLIVRASGTESL 419
            ++ +      +PQ L +V +       ++ ++  AI DAE+EL    R++VRASGTE L
Sbjct: 358 TLAQLLADVPLFPQVLLNVRLNPGQDWKTNPVLADAIRDAEAELGAHGRVLVRASGTEPL 417

Query: 420 IRIMAEGDDLSRIKRIVDDLAKV 442
           +R+M E  +  +  R    +A  
Sbjct: 418 LRVMVEAREAEQANRCAQRIADA 440


>gi|328542549|ref|YP_004302658.1| phosphoglucosamine mutase [polymorphum gilvum SL003B-26A1]
 gi|326412295|gb|ADZ69358.1| Phosphoglucosamine mutase [Polymorphum gilvum SL003B-26A1]
          Length = 454

 Score =  273 bits (697), Expect = 5e-71,   Method: Composition-based stats.
 Identities = 268/443 (60%), Positives = 344/443 (77%)

Query: 3   RRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSL 62
           RR+FGTDGIRG +N  P+T    +++G+A G +FR      RVVIGKDTRLSGYMLEN+L
Sbjct: 9   RRYFGTDGIRGTANIHPMTAEVALKVGMAAGLMFRNGGYRNRVVIGKDTRLSGYMLENAL 68

Query: 63  VAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVS 122
           VAGFT+ G+D F+LGP+P+PAVAMLTRSLRAD+GVMISASHNP+ DNGIK FGPDGYK+S
Sbjct: 69  VAGFTSVGLDVFLLGPMPTPAVAMLTRSLRADLGVMISASHNPFGDNGIKFFGPDGYKLS 128

Query: 123 TDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVVD 182
            +IE +IE L++ DLTS LS    +G AKR+DG   RYIE  KRTLPR+++L+GLR+V+D
Sbjct: 129 DEIELQIEGLIDSDLTSRLSASTDLGRAKRIDGAQQRYIEFAKRTLPREMSLEGLRVVID 188

Query: 183 CANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIAL 242
           CANGA+YKVAPE  WELGA+VV +G  P+G NIN DCGST+  ++  KVHEVRADIGIAL
Sbjct: 189 CANGAAYKVAPEALWELGAEVVSLGVAPDGFNINRDCGSTSTEAVVAKVHEVRADIGIAL 248

Query: 243 DGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLGL 302
           DGD DRVII+DE+G  V+GDQ+MA++A  W S   L   GIV TVMSN+GLER++ GLGL
Sbjct: 249 DGDADRVIIIDEQGRTVDGDQLMAVVAESWQSSGRLSAPGIVATVMSNLGLERYLGGLGL 308

Query: 303 SLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKPV 362
           SL RT+VGDRY++E+M+  G+NVGGEQSGHI+LSD+ +TGDGL+AALQVL  +++ ++ V
Sbjct: 309 SLARTKVGDRYVVEHMRAEGYNVGGEQSGHIVLSDFATTGDGLIAALQVLACVREQNRSV 368

Query: 363 STICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLIRI 422
           S +C  FE  PQ L++V     + L +  +  AI D  S L    RL++RASGTE LIR+
Sbjct: 369 SEVCRKFEPVPQVLKNVRYAGGTPLETDRVRLAIDDGRSRLGKDGRLVIRASGTEPLIRV 428

Query: 423 MAEGDDLSRIKRIVDDLAKVIPM 445
           MAEGDD + + ++V+D+A V+  
Sbjct: 429 MAEGDDAALVNQVVNDIADVVAQ 451


>gi|121594722|ref|YP_986618.1| phosphoglucosamine mutase [Acidovorax sp. JS42]
 gi|158513899|sp|A1W8G7|GLMM_ACISJ RecName: Full=Phosphoglucosamine mutase
 gi|120606802|gb|ABM42542.1| phosphoglucosamine mutase [Acidovorax sp. JS42]
          Length = 444

 Score =  272 bits (696), Expect = 6e-71,   Method: Composition-based stats.
 Identities = 190/443 (42%), Positives = 279/443 (62%), Gaps = 4/443 (0%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M R++FGTDGIRG     PITP+F +R+  AVG + R  ++   V+IGKDTR+SGYMLE+
Sbjct: 1   MTRKYFGTDGIRGTVGQSPITPDFALRLAHAVGRVLRRTQERPTVLIGKDTRISGYMLES 60

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +L +GF +AG+D  +LGP+P+P VA LTR+ RA +GV+ISASHNPY DNGIK F   G K
Sbjct: 61  ALESGFNSAGVDVVLLGPLPTPGVAYLTRAQRASLGVVISASHNPYPDNGIKFFSAQGTK 120

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +    E+ +E  LE       +   S+G  +R+D    RYIE  K T   D+TL+GL+IV
Sbjct: 121 LPDAWEEEVEAALEQ--PPVWADSASLGKTRRLDDAAGRYIEFCKSTFANDLTLRGLKIV 178

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           VD A+GA+Y +AP+VF ELGA+V+ IG  P+G+NIN   G+T+  +L R V    AD GI
Sbjct: 179 VDAAHGAAYHIAPKVFHELGAEVMAIGCAPDGLNINHQVGATHPDALVRAVRANHADYGI 238

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           ALDGD DRV +VD  G + NGD+++ ++    ++        + T  M+N+ +E  +   
Sbjct: 239 ALDGDADRVQMVDAAGRLFNGDELLYVMVAARLARDEHVPGVVGTL-MTNMAVEEALQRR 297

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           G+   R +VGDRY++E ++   + +GGE SGH++  D  +TGDGL++ALQVL+   +  K
Sbjct: 298 GVKFMRAKVGDRYVLEELQRQHWLLGGEGSGHLLALDRHTTGDGLISALQVLQACVRSGK 357

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQ-AIADAESELRGIDRLIVRASGTESL 419
            ++ +      +PQ L +V +       ++ ++  AI DAE+EL    R++VRASGTE L
Sbjct: 358 TLAQLLADVPLFPQVLLNVRLNPGQDWKTNPVLADAIRDAEAELGAHGRVLVRASGTEPL 417

Query: 420 IRIMAEGDDLSRIKRIVDDLAKV 442
           +R+M E  +  +  R    +A  
Sbjct: 418 LRVMVEAREAEQANRCAQRMADA 440


>gi|87119796|ref|ZP_01075693.1| phosphoglucosamine mutase [Marinomonas sp. MED121]
 gi|86165272|gb|EAQ66540.1| phosphoglucosamine mutase [Marinomonas sp. MED121]
          Length = 445

 Score =  272 bits (696), Expect = 6e-71,   Method: Composition-based stats.
 Identities = 208/444 (46%), Positives = 291/444 (65%), Gaps = 6/444 (1%)

Query: 3   RRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSL 62
           R++FGTDGIRG+     ITP FM+++G A G +F+      +VVIGKDTR+SGYM E++L
Sbjct: 2   RKYFGTDGIRGRVGEGAITPEFMLKLGWAAGQVFKENG--NKVVIGKDTRISGYMFESAL 59

Query: 63  VAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVS 122
            AG  AAG+D  ++GP+P+PA+A LTR+ RA  G++ISASHNPY DNGIK F   G K+ 
Sbjct: 60  EAGLVAAGVDVRLVGPMPTPAIAYLTRTFRASAGIVISASHNPYTDNGIKFFSAAGAKLC 119

Query: 123 TDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVVD 182
            ++E++IE  L+  L   +   D+IG AKR+D    RYIE+ K T P  + L GL+IVVD
Sbjct: 120 DEMEEKIEHYLDQPL--VVVPSDNIGRAKRIDDAAGRYIEYCKGTFPIGMQLNGLKIVVD 177

Query: 183 CANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIAL 242
           CA+GA+Y VAP VF ELGA+VV+IGDKP+G+NIN + G+T    L+  V   +ADIGIAL
Sbjct: 178 CADGATYHVAPRVFSELGAEVVIIGDKPDGLNINENSGATKPELLRETVLAEKADIGIAL 237

Query: 243 DGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLGL 302
           DGDGDR+I+VD +G + +GD ++ +IA          G  + T  MSN GLE   +  G+
Sbjct: 238 DGDGDRLIMVDAEGGVRDGDDVLYVIANHMRQTGKFSGGVVGTL-MSNFGLELAFSEQGI 296

Query: 303 SLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKPV 362
              R  VGDR++ E +   G+ +GGE SGHI+     +TGDG+VAALQVL+ + + +K +
Sbjct: 297 GFGRASVGDRFVNEKLTQLGWVLGGEPSGHIVCRSITTTGDGVVAALQVLQAMVEGEKTL 356

Query: 363 STICHCFEEYPQFLRSVSVKDT-SILNSSSIVQAIADAESELRGIDRLIVRASGTESLIR 421
             +   F ++PQ L+++ VK   S      + QAIA A  +L G  R+++RASGTE LIR
Sbjct: 357 LELLEGFTKFPQRLKNIRVKSRFSPTEVPQLQQAIAHANEKLNGSGRVLLRASGTEPLIR 416

Query: 422 IMAEGDDLSRIKRIVDDLAKVIPM 445
           +M EGD+   +  +V  LA  +  
Sbjct: 417 VMVEGDNSDLVDELVTSLATQVEE 440


>gi|256823579|ref|YP_003147542.1| phosphoglucosamine mutase [Kangiella koreensis DSM 16069]
 gi|256797118|gb|ACV27774.1| phosphoglucosamine mutase [Kangiella koreensis DSM 16069]
          Length = 443

 Score =  272 bits (696), Expect = 7e-71,   Method: Composition-based stats.
 Identities = 203/448 (45%), Positives = 304/448 (67%), Gaps = 8/448 (1%)

Query: 1   MK-RRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLE 59
           M  R++FGTDGIRG    FPITP F++++G A G +     K  ++VIGKDTR+SGYM E
Sbjct: 1   MSERKYFGTDGIRGTVGDFPITPEFVLKLGWAAGKVL---GKKGKIVIGKDTRISGYMFE 57

Query: 60  NSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGY 119
           + L AG TAAG+ +F++GP+P+PA+A LTR+ RAD G++ISASHNP+QDNGIK F   G 
Sbjct: 58  SVLEAGLTAAGVSSFLVGPMPTPAIAYLTRTFRADAGIVISASHNPFQDNGIKFFSAAGT 117

Query: 120 KVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRI 179
           K+   +E  IE LLE ++TS     + +G A R++    RYIE  K ++P D  L G++I
Sbjct: 118 KLPDSVELEIEALLEQEMTSLP--SEKLGKAYRIEDAAARYIEFCKASVPNDFNLDGMKI 175

Query: 180 VVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIG 239
           V+DCANGA+Y +AP VF ELGA V+  G +PNG+NIN +CG+T++  L + V E +AD+G
Sbjct: 176 VLDCANGATYHIAPYVFKELGAKVIKTGVEPNGLNINHECGATHLEPLCKAVVEHQADLG 235

Query: 240 IALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAG 299
           IA DGDGDR+++VD  G ++NGDQ+M L+A            G+V T+M+N+ +E  +  
Sbjct: 236 IAFDGDGDRLMMVDANGTVINGDQLMFLMAYHLQQK-GQLKGGVVGTLMTNMAIENALIE 294

Query: 300 LGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYD 359
           L +  +R++VGDRY+ME ++ N + +GGE SGH+I  DY STGDG+VAALQVLR +++ +
Sbjct: 295 LDIPFERSKVGDRYVMESLQKNDWLIGGESSGHLIHLDYNSTGDGIVAALQVLRVVREQE 354

Query: 360 KPVSTICHCFEEYPQFLRSVSVKD-TSILNSSSIVQAIADAESELRGIDRLIVRASGTES 418
           K +  +   F  +PQ + ++ V D  +++   ++ +   + ++EL    R+++RASGTE 
Sbjct: 355 KGIGELVAKFPLFPQTMINIRVTDAKAVIADENLQRLAQEVDAELADQGRVLLRASGTEP 414

Query: 419 LIRIMAEGDDLSRIKRIVDDLAKVIPMI 446
           LIR+M E +D +   ++ + LA+ +  I
Sbjct: 415 LIRVMVEANDANLATKMAEKLAQKVRNI 442


>gi|294676761|ref|YP_003577376.1| phosphoglucosamine mutase [Rhodobacter capsulatus SB 1003]
 gi|294475581|gb|ADE84969.1| phosphoglucosamine mutase [Rhodobacter capsulatus SB 1003]
          Length = 448

 Score =  272 bits (695), Expect = 7e-71,   Method: Composition-based stats.
 Identities = 229/450 (50%), Positives = 317/450 (70%), Gaps = 4/450 (0%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHR-RVVIGKDTRLSGYMLE 59
           M R+ FGTDG+RG++N++P+T    +++G A G  FR   ++  RVVIGKDTRLSGYMLE
Sbjct: 1   MTRKLFGTDGVRGEANSWPMTAEMALKLGAAAGRYFRRDGRNGHRVVIGKDTRLSGYMLE 60

Query: 60  NSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGY 119
           N+L AG T+ GM+  +LGP+P+PAV  LTRS+RAD+G+MISASHNP +DNGIK FGPDG+
Sbjct: 61  NALTAGLTSTGMNVLLLGPVPTPAVGYLTRSMRADLGIMISASHNPAKDNGIKFFGPDGF 120

Query: 120 KVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRI 179
           K+S + E  IE L+  ++   L+   +IG AKR+D    RY+E+ K T P    L GL++
Sbjct: 121 KLSDEAELEIEALVAGEI--RLAQPMNIGRAKRIDDGLGRYVEYAKTTFPARDRLAGLKV 178

Query: 180 VVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIG 239
           V+DCA+GA+YK AP+V WELG +V+ IG KPNG+NIN  CGST+  +    V    AD+G
Sbjct: 179 VIDCAHGAAYKAAPQVLWELGCEVIEIGTKPNGLNINDKCGSTHTRAAAEAVVAHGADLG 238

Query: 240 IALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAG 299
           I+LDGD DRV+I+DE G + +GDQIMAL A  W    LLRG  +V TVMSN+GLERF+ G
Sbjct: 239 ISLDGDADRVMILDENGLVADGDQIMALFAARWAEAGLLRGGALVATVMSNLGLERFLTG 298

Query: 300 LGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYD 359
            GL+L+RT VGDRY++E M+  GFN+GGEQSGHI+++DY +TGDGL+A LQ L  + +  
Sbjct: 299 RGLALERTAVGDRYVVERMRAGGFNLGGEQSGHIVMTDYATTGDGLMAGLQFLAAMAETG 358

Query: 360 KPVSTICHCFEEYPQFLRSVSVK-DTSILNSSSIVQAIADAESELRGIDRLIVRASGTES 418
           KP S +   FE  PQ L++V  K   + L++ ++ + IA+AE ++ G  R+++R SGTE 
Sbjct: 359 KPASELTRQFETVPQMLKNVKFKAGQAPLDNENVRKVIAEAEGKIAGQGRILIRKSGTEP 418

Query: 419 LIRIMAEGDDLSRIKRIVDDLAKVIPMIDS 448
           LIR+MAE +D   +   V+ +   +    +
Sbjct: 419 LIRVMAECEDAGLLTETVEGIVAAVEQATA 448


>gi|323698293|ref|ZP_08110205.1| phosphoglucosamine mutase [Desulfovibrio sp. ND132]
 gi|323458225|gb|EGB14090.1| phosphoglucosamine mutase [Desulfovibrio desulfuricans ND132]
          Length = 450

 Score =  272 bits (695), Expect = 8e-71,   Method: Composition-based stats.
 Identities = 215/447 (48%), Positives = 305/447 (68%), Gaps = 2/447 (0%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           MK+R FGTDG+RG+ N FP+TP   +R+G+A G  FR   KH RVVIGKDTRLSGY+ E 
Sbjct: 1   MKQRLFGTDGLRGQGNIFPMTPEIALRLGLAAGQYFRNGDKHHRVVIGKDTRLSGYVFET 60

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +L +G  A GMD F++GP+P+PA++ LTR++RAD+GV+ISASHNP+ DNGIK F  +G+K
Sbjct: 61  ALTSGLCANGMDVFLVGPMPTPAISFLTRNMRADLGVVISASHNPFMDNGIKFFDRNGFK 120

Query: 121 VSTDIEDRI-ETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRI 179
           +  ++ED I E +L  D        + +G A R+     RYI ++K +    +TL GL+I
Sbjct: 121 LPDEVEDEISELVLGQDTKWDYPPAEDVGRAHRIADARGRYIVYLKNSFSPHLTLDGLKI 180

Query: 180 VVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIG 239
           V+DCA+GA+Y VAP+V  ELGA+VV +G  P+G+NIN  CGS     + R V E  AD+G
Sbjct: 181 VLDCAHGAAYGVAPDVLEELGAEVVKVGVNPDGLNINRKCGSLYPEVIARMVVEEGADLG 240

Query: 240 IALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAG 299
           IALDGD DR+I+ DE G I++GDQIMAL A E M    L GN +V TVMSN+ LE F+  
Sbjct: 241 IALDGDADRLIVCDENGRILDGDQIMALCALELMEKDRLPGNMLVATVMSNMALELFMTE 300

Query: 300 LGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYD 359
            G  L RT+VGDRY++E M+  G  +GGEQSGH+I  D+ +TGDGL+AALQ+LR +++ +
Sbjct: 301 HGGRLLRTDVGDRYVVEAMRREGATLGGEQSGHLIFMDHATTGDGLLAALQLLRIMRERE 360

Query: 360 KPVSTICHCFEEYPQFLRSVSVKDTSILN-SSSIVQAIADAESELRGIDRLIVRASGTES 418
           +P+S +    E +PQ LR+V VK     + +  + +A+   E+ L+G  R+++R SGTE+
Sbjct: 361 RPLSELAGLLEPFPQVLRNVHVKRKVPFDQAPEVQEAVRRVEAALKGKGRVLLRYSGTEA 420

Query: 419 LIRIMAEGDDLSRIKRIVDDLAKVIPM 445
           + R+M EG D   ++++  D+ +    
Sbjct: 421 VCRVMVEGQDPELVEKLTGDIVEACEK 447


>gi|92116692|ref|YP_576421.1| phosphoglucosamine mutase [Nitrobacter hamburgensis X14]
 gi|122418355|sp|Q1QP86|GLMM_NITHX RecName: Full=Phosphoglucosamine mutase
 gi|91799586|gb|ABE61961.1| phosphoglucosamine mutase [Nitrobacter hamburgensis X14]
          Length = 448

 Score =  272 bits (694), Expect = 1e-70,   Method: Composition-based stats.
 Identities = 255/443 (57%), Positives = 332/443 (74%), Gaps = 1/443 (0%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M R++FGTDGIRG++N   ITP   M++G A G +F+  +   RVVIGKDTRLSGYM+E 
Sbjct: 1   MSRKYFGTDGIRGRAN-GLITPELAMKVGQAAGLVFQRGEYRHRVVIGKDTRLSGYMIEY 59

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +LVAGFT+ GMD  +LGP+P+PAVAMLT+S+RAD+GVMISASHN ++DNGIK+FGP G+K
Sbjct: 60  ALVAGFTSVGMDVLLLGPMPTPAVAMLTKSMRADLGVMISASHNLFEDNGIKMFGPRGFK 119

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +S  +E +IE LL+++L   L+    +G A+R+DGVHDRYIE  KRTLPR+++L GLR+V
Sbjct: 120 LSDAVEKQIEQLLDENLDKKLAQSTGLGRARRIDGVHDRYIEFAKRTLPRELSLDGLRVV 179

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           VDCANGA+Y+V PE  WELGADVV I  +P+G NIN +CGST   +L RKV E+RADIGI
Sbjct: 180 VDCANGAAYRVVPEALWELGADVVPISVEPDGFNINKECGSTAPEALCRKVREMRADIGI 239

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           ALDGD DRVIIVDE+G +V+GDQ++A+IA  W     L   GIV TVMSN+GLERF+ G 
Sbjct: 240 ALDGDADRVIIVDERGHVVDGDQLLAVIAESWKEDGRLTKPGIVATVMSNLGLERFLEGQ 299

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
            LSL RT VGDRY++E M   G+N+GGEQSGHIILSDY +TGDG V+ALQVL  +++  +
Sbjct: 300 ELSLVRTPVGDRYVLEQMLKQGYNLGGEQSGHIILSDYATTGDGFVSALQVLAVVQKLGR 359

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
           PVS +CH FE  PQ L++   +    L+ + +  AI   E  L G  RL+VR+SGTE +I
Sbjct: 360 PVSEVCHKFEPLPQILKNYRYRSGKPLDRAEVKSAITAGEKRLNGHGRLLVRSSGTEPVI 419

Query: 421 RIMAEGDDLSRIKRIVDDLAKVI 443
           R+M EGDD   ++ +VD +   +
Sbjct: 420 RVMGEGDDRILVEDVVDTIVSAL 442


>gi|158422599|ref|YP_001523891.1| phosphoglucosamine mutase [Azorhizobium caulinodans ORS 571]
 gi|172047840|sp|A8HUR7|GLMM_AZOC5 RecName: Full=Phosphoglucosamine mutase
 gi|158329488|dbj|BAF86973.1| phosphoglucosamine mutase [Azorhizobium caulinodans ORS 571]
          Length = 447

 Score =  272 bits (694), Expect = 1e-70,   Method: Composition-based stats.
 Identities = 257/448 (57%), Positives = 343/448 (76%), Gaps = 1/448 (0%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M R++FGTDG+RG++N   +T +  +R+G+A G  FR  +   RVVIGKDTRLSGYM+EN
Sbjct: 1   MARKYFGTDGVRGRANA-TLTADLALRVGMAAGLAFRRGEHRHRVVIGKDTRLSGYMIEN 59

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +LVAGFT+ GMD  +LGP+P+PAV MLTRS+RAD+GVMISASHNP+ DNGIKLFGPDG+K
Sbjct: 60  ALVAGFTSVGMDVLLLGPMPTPAVGMLTRSMRADLGVMISASHNPFDDNGIKLFGPDGFK 119

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +S  IE  IE L+++DL+  L+    IG A+RV+GVH RYIE+ KRTLPRD + +GLR+V
Sbjct: 120 LSDQIEHEIEELIDEDLSKKLAQPMDIGRARRVEGVHARYIEYAKRTLPRDQSFEGLRVV 179

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           VDCANGA+Y+VAP+  WELGA+V+ +G +P+G+NIN D GST+  +L  KV EVRAD+GI
Sbjct: 180 VDCANGAAYRVAPDALWELGAEVISMGVEPDGLNINRDVGSTSPAALSAKVREVRADVGI 239

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           ALDGD DRVIIVDEKG +V+GDQIMA++A  +     L  +GIV TVMSN+GLER++   
Sbjct: 240 ALDGDADRVIIVDEKGHVVDGDQIMAVVAHSFKEDGRLSRDGIVATVMSNLGLERYLKDE 299

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           GL+L RT VGDRY++E M+++G+NVGGEQSGHIILSDY +TGDGL+AALQVL  + + ++
Sbjct: 300 GLTLARTSVGDRYVLERMRSDGYNVGGEQSGHIILSDYSTTGDGLLAALQVLAVVARSER 359

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
           PVS +CH F+  PQ L++V       L   ++  AIADAE  L    RL++R SGTE +I
Sbjct: 360 PVSEVCHRFDPLPQVLKNVRYSSGKPLEHENVQSAIADAERRLANHGRLLIRPSGTEPVI 419

Query: 421 RIMAEGDDLSRIKRIVDDLAKVIPMIDS 448
           R+M EGDD   ++ +VD++ + +  + +
Sbjct: 420 RVMGEGDDFELVEGVVDEVIEALRKVAA 447


>gi|91775138|ref|YP_544894.1| phosphoglucosamine mutase [Methylobacillus flagellatus KT]
 gi|123254701|sp|Q1H384|GLMM_METFK RecName: Full=Phosphoglucosamine mutase
 gi|91709125|gb|ABE49053.1| phosphoglucosamine mutase [Methylobacillus flagellatus KT]
          Length = 453

 Score =  272 bits (694), Expect = 1e-70,   Method: Composition-based stats.
 Identities = 205/452 (45%), Positives = 294/452 (65%), Gaps = 10/452 (2%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKH------RRVVIGKDTRLS 54
           M R++FGTDG+RGK  TFPITP+F+MR+G A G +      H        V+IGKDTR+S
Sbjct: 1   MSRKYFGTDGVRGKVGTFPITPDFVMRLGYAAGRVLTRMDHHLVPGTKPLVIIGKDTRIS 60

Query: 55  GYMLENSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLF 114
           GYM E +LV+G  A G++  I GP+P+PA+A +TR+ RA  G++ISASHNP+ DNGIK F
Sbjct: 61  GYMFETALVSGLCAGGVNVRITGPLPTPAIAHVTRAQRAQAGIVISASHNPFDDNGIKFF 120

Query: 115 GPDGYKVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTL 174
              G K+  ++E  IE  L+  +   L   + IG  KR+D    RYIE  K T P  + L
Sbjct: 121 SAQGTKLPDEVELAIEAELDQPME--LVPTEQIGRVKRIDDAAGRYIEFCKSTFPNALDL 178

Query: 175 QGLRIVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEV 234
           +GL+IV+DCANGA+Y VAP VF ELGA+V+ IG +PNG+NINL+ GST+  SLQ+ V E 
Sbjct: 179 RGLKIVLDCANGATYHVAPPVFHELGAEVISIGTQPNGLNINLNVGSTHPESLQQAVVEH 238

Query: 235 RADIGIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLE 294
           +AD+GIA DGDGDRV++ D +G +++GDQ++ +IA        L G  + T  M+N+ LE
Sbjct: 239 QADLGIAFDGDGDRVVMADNQGQLLDGDQLLYIIASHRHQRGRLGGGVVGTL-MTNLALE 297

Query: 295 RFIAGLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRY 354
             +   G+  +R +VGDRY++E +  N + +GGE SGHI+  D  S+GDG++AALQVL  
Sbjct: 298 HALGKEGIPFQRAKVGDRYVLELLNANEWQLGGENSGHILCLDKHSSGDGIIAALQVLHA 357

Query: 355 IKQYDKPVSTICHCFEEYPQFLRSVSVKDTSILNSS-SIVQAIADAESELRGIDRLIVRA 413
           ++     ++        YPQ L +V V     L+S+ ++  A+  AE  L+G  R+++RA
Sbjct: 358 LRASGLSLADWAKRLPLYPQVLINVKVAQRIDLDSNTALQAAVTSAEGALKGTGRVLLRA 417

Query: 414 SGTESLIRIMAEGDDLSRIKRIVDDLAKVIPM 445
           SGTE  IR+M EG D   ++R+ +++A V+  
Sbjct: 418 SGTEPKIRVMVEGQDRPLVQRLAEEIAAVVQQ 449


>gi|258543657|ref|YP_003189090.1| phosphoglucosamine mutase [Acetobacter pasteurianus IFO 3283-01]
 gi|256634735|dbj|BAI00711.1| phosphoglucosamine mutase [Acetobacter pasteurianus IFO 3283-01]
 gi|256637791|dbj|BAI03760.1| phosphoglucosamine mutase [Acetobacter pasteurianus IFO 3283-03]
 gi|256640845|dbj|BAI06807.1| phosphoglucosamine mutase [Acetobacter pasteurianus IFO 3283-07]
 gi|256643900|dbj|BAI09855.1| phosphoglucosamine mutase [Acetobacter pasteurianus IFO 3283-22]
 gi|256646955|dbj|BAI12903.1| phosphoglucosamine mutase [Acetobacter pasteurianus IFO 3283-26]
 gi|256650008|dbj|BAI15949.1| phosphoglucosamine mutase [Acetobacter pasteurianus IFO 3283-32]
 gi|256652998|dbj|BAI18932.1| phosphoglucosamine mutase [Acetobacter pasteurianus IFO
           3283-01-42C]
 gi|256656052|dbj|BAI21979.1| phosphoglucosamine mutase [Acetobacter pasteurianus IFO 3283-12]
          Length = 452

 Score =  271 bits (693), Expect = 1e-70,   Method: Composition-based stats.
 Identities = 234/448 (52%), Positives = 323/448 (72%), Gaps = 2/448 (0%)

Query: 1   MKR--RFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYML 58
           M R  RFFGTDGIRG +N  P+T     ++G A G  F+       V++GKDTRLSGYM+
Sbjct: 1   MSRMKRFFGTDGIRGTANVAPMTVEVAQKLGQAAGLHFKRGDHRHSVLLGKDTRLSGYMI 60

Query: 59  ENSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDG 118
           E+++V+GF +AGMD  ++GP+P+PA+AMLTRSLRAD+GVMISASHNP+ DNGIKLFGPDG
Sbjct: 61  ESAMVSGFLSAGMDVTLVGPLPTPAIAMLTRSLRADLGVMISASHNPFGDNGIKLFGPDG 120

Query: 119 YKVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLR 178
           +K+S   E  IE L+E DLT+YL+  + IG A R++    RYIE  K + PR + L G++
Sbjct: 121 FKLSDQDESEIEALMEKDLTAYLAKPEHIGRASRLNDAAGRYIESAKASFPRKLRLDGMK 180

Query: 179 IVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADI 238
           IV+DCANG++Y+VAP   WELGA+V+ IG +PNG+NIN  CGST+  +L   V + +AD+
Sbjct: 181 IVIDCANGSAYRVAPTALWELGAEVIRIGCEPNGVNINEKCGSTHPEALCAAVVKHKADL 240

Query: 239 GIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIA 298
           GIALDGD DRV+I DE G +++GDQI+ALIA+ W+    L GN +V TVMSN+GLERF+ 
Sbjct: 241 GIALDGDADRVLIADETGRLIDGDQILALIAQSWVREGRLMGNSVVATVMSNMGLERFLE 300

Query: 299 GLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQY 358
            LGLSL+RT VGDRY++E M     N+GGEQSGH++L+D+ +TGDGL+AALQ+L  + Q 
Sbjct: 301 NLGLSLERTAVGDRYVVERMLERQANIGGEQSGHMVLTDFATTGDGLIAALQILAVLVQD 360

Query: 359 DKPVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTES 418
            +P S +C  F+ +PQ L++V  K    L+ + +    A+ E +L G  RL++R SGTE 
Sbjct: 361 GRPASEVCQLFQPFPQKLKNVRYKGACPLDMAEVKSRQAEVERKLAGRGRLVLRKSGTEP 420

Query: 419 LIRIMAEGDDLSRIKRIVDDLAKVIPMI 446
           L+R+MAE +D + +  +VD +  V+  +
Sbjct: 421 LVRVMAEAEDANLVDEVVDQMCDVLEQV 448


>gi|82701619|ref|YP_411185.1| phosphoglucosamine mutase [Nitrosospira multiformis ATCC 25196]
 gi|123545044|sp|Q2YBS8|GLMM_NITMU RecName: Full=Phosphoglucosamine mutase
 gi|82409684|gb|ABB73793.1| phosphoglucosamine mutase [Nitrosospira multiformis ATCC 25196]
          Length = 463

 Score =  271 bits (693), Expect = 1e-70,   Method: Composition-based stats.
 Identities = 201/455 (44%), Positives = 291/455 (63%), Gaps = 10/455 (2%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRG------KKKHRRVVIGKDTRLS 54
           M R++FGTDGIRG+    PITP F++ +G + G +         K +   V+IGKDTR+S
Sbjct: 1   MTRKYFGTDGIRGRVGEAPITPEFVIHLGYSAGKVLTSSDWHLSKGERPAVLIGKDTRIS 60

Query: 55  GYMLENSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLF 114
           GYMLE++L AG +AAG+D  + GP+P+PAVA LTR+LR   G++ISASHNP++DNGIK F
Sbjct: 61  GYMLESALQAGLSAAGVDVLLSGPMPTPAVAYLTRALRLQAGIVISASHNPFEDNGIKFF 120

Query: 115 GPDGYKVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTL 174
              G K+    E  IE  L   L +       +G A+RV+    RYIE  K T P  + L
Sbjct: 121 SALGAKLPDATEQEIEAGLNAPLKA--MPSAQLGKARRVNDARGRYIEFCKSTFPNHLDL 178

Query: 175 QGLRIVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEV 234
           +GLR+VVDCA+GA+Y++A  V  ELGA+VV IG  P+G+NIN +CG+T+  +LQ  V   
Sbjct: 179 RGLRVVVDCAHGATYQIAGPVLHELGAEVVAIGIHPDGLNINHECGATHGAALQEAVRHH 238

Query: 235 RADIGIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLE 294
           RADIG+ALDGDGDRVI+ D +G + +GDQ++ L+A+     + L   G+  T+M+N+ +E
Sbjct: 239 RADIGVALDGDGDRVIMTDGEGMLYDGDQLIYLVAKHR-KQNGLLKGGVAGTLMTNLAIE 297

Query: 295 RFIAGLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRY 354
             +  L +   R  VGDRY++E ++   + +GGE SGHII  D  +TGDG+++ALQVL  
Sbjct: 298 NGLKKLDIPFARANVGDRYVLELLQIKNWQLGGEGSGHIICLDKHTTGDGIISALQVLYA 357

Query: 355 IKQYDKPVSTICHCFEEYPQFLRSVSV-KDTSILNSSSIVQAIADAESELRGIDRLIVRA 413
           ++   K ++ +      YPQ L +V V K     NS +I  A A+AE +L    R+++RA
Sbjct: 358 MRDSGKTLTELASDVTLYPQQLINVRVPKGFDAHNSLAIKTAQAEAERDLDTTGRVLLRA 417

Query: 414 SGTESLIRIMAEGDDLSRIKRIVDDLAKVIPMIDS 448
           SGTE LIR+M EG+   ++K   + +A+V+    +
Sbjct: 418 SGTEPLIRVMVEGESGQKVKHWAEKIAEVVRNAAA 452


>gi|295687565|ref|YP_003591258.1| phosphoglucosamine mutase [Caulobacter segnis ATCC 21756]
 gi|295429468|gb|ADG08640.1| phosphoglucosamine mutase [Caulobacter segnis ATCC 21756]
          Length = 448

 Score =  271 bits (693), Expect = 1e-70,   Method: Composition-based stats.
 Identities = 247/447 (55%), Positives = 325/447 (72%), Gaps = 2/447 (0%)

Query: 1   MKRR-FFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRR-VVIGKDTRLSGYML 58
           M +R +FGTDGIRG++N  P+T    +R+G+A G LFR +   R  VVIGKDTRLSGYM+
Sbjct: 1   MSKRAYFGTDGIRGQANKHPMTAEVALRVGLAAGKLFRSQDARRHLVVIGKDTRLSGYMI 60

Query: 59  ENSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDG 118
           E +LVAG T+ G+D  + GP+P+PAVAM+TRS+RAD+GVMISASHN + DNGIKLFGPDG
Sbjct: 61  EPALVAGLTSVGLDVRLFGPLPTPAVAMMTRSMRADLGVMISASHNNFADNGIKLFGPDG 120

Query: 119 YKVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLR 178
           YK+S + E +IE L+++ L   L+    +G  KR+D    RY+E VK T PR   L GLR
Sbjct: 121 YKLSDEQELKIEALMDEGLQEGLAAPRELGRVKRIDDAQARYVEIVKATFPRHRNLSGLR 180

Query: 179 IVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADI 238
           IV+DCANGA+YKVAP   +ELGA+V+ +G  P+G NIN +CGST+  ++ + V E RADI
Sbjct: 181 IVIDCANGAAYKVAPTALYELGAEVISLGVSPDGTNINEECGSTHPETMAKMVREYRADI 240

Query: 239 GIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIA 298
           GIALDGD DR++I DEKG +V+GDQIMA+IA        L+G G+V TVMSN+GLER + 
Sbjct: 241 GIALDGDADRLVICDEKGVVVDGDQIMAIIAGALAKAGTLKGGGVVATVMSNLGLERCLN 300

Query: 299 GLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQY 358
           G GLSL+RT VGDRY+M+ M+  GFNVGGEQSGH+ILSD+ +TGDGL+AALQVL  + + 
Sbjct: 301 GQGLSLERTAVGDRYVMQRMREGGFNVGGEQSGHLILSDFSTTGDGLIAALQVLAVMVET 360

Query: 359 DKPVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTES 418
            +P+S +   FE  PQ L +V       L + ++  AIAD E++L G  R++VRASGTE 
Sbjct: 361 GQPMSALGRQFEPVPQLLENVRFAGGKPLEAKTVKDAIADGEAQLNGAGRIVVRASGTEP 420

Query: 419 LIRIMAEGDDLSRIKRIVDDLAKVIPM 445
           LIRIMAEGDD + +K++V  +   +  
Sbjct: 421 LIRIMAEGDDPALVKKVVKSIVGAVKA 447


>gi|49476133|ref|YP_034174.1| phosphoglucomutase /phosphomannomutasefamily protein mrsa
           [Bartonella henselae str. Houston-1]
 gi|81648447|sp|Q6G5P7|GLMM_BARHE RecName: Full=Phosphoglucosamine mutase
 gi|49238941|emb|CAF28237.1| Phosphoglucomutase /phosphomannomutasefamily protein mrsa
           [Bartonella henselae str. Houston-1]
          Length = 459

 Score =  271 bits (693), Expect = 1e-70,   Method: Composition-based stats.
 Identities = 266/443 (60%), Positives = 348/443 (78%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M +++FGTDGIRGK+N FP+TP+F M++G+AVG LFR + + RRVVIGKDTRLSGYMLEN
Sbjct: 1   MPQKYFGTDGIRGKANVFPMTPDFAMKVGMAVGILFRSQNQSRRVVIGKDTRLSGYMLEN 60

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +LV+GFTAAGM+AF+LGP+P+PAVAML RSLRAD+GVMISASHNP+ DNGIKLFGPDG+K
Sbjct: 61  ALVSGFTAAGMEAFLLGPVPTPAVAMLCRSLRADLGVMISASHNPFYDNGIKLFGPDGFK 120

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +S +IE++IE L++ DL+  L+    IG+AKRV+G   RYIE+ KRTLPRDV L  LRIV
Sbjct: 121 LSDEIEEKIEQLIDTDLSKSLASCAEIGYAKRVEGDIYRYIEYAKRTLPRDVRLDNLRIV 180

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           VDCANGA+YK AP   WELGA+V  I D PNG NIN  CGST++ SL++KVHEVRAD+GI
Sbjct: 181 VDCANGAAYKAAPRALWELGAEVFAINDTPNGTNINHKCGSTDLASLKQKVHEVRADVGI 240

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           ALDGDGDRV++VDEK   V+GDQ++A+IA  W  +  L+  G+VTT+MSN+GLERF+   
Sbjct: 241 ALDGDGDRVLLVDEKAQTVDGDQLIAVIAEHWHKNGRLQSKGVVTTIMSNLGLERFLNSK 300

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           GL L RT+VGDRY+++ M+  G+NVGGE SGHI+LSD+G+TGDGLVAALQ+L  +++   
Sbjct: 301 GLDLVRTKVGDRYVVDAMRKKGYNVGGEASGHIVLSDFGTTGDGLVAALQILACMQEIQI 360

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
           P+S +C  FE  PQ  ++V +K+ ++L  + +  AI  A   L    RL++RASGTE +I
Sbjct: 361 PMSHLCQRFEPVPQIFKNVMIKNKNVLKKNPVKTAIEQATQRLGKKARLVIRASGTEPVI 420

Query: 421 RIMAEGDDLSRIKRIVDDLAKVI 443
           RIM EGD+   +  +V ++  +I
Sbjct: 421 RIMGEGDEREMLDAVVTEMVDII 443


>gi|332704378|ref|ZP_08424466.1| phosphoglucosamine mutase [Desulfovibrio africanus str. Walvis Bay]
 gi|332554527|gb|EGJ51571.1| phosphoglucosamine mutase [Desulfovibrio africanus str. Walvis Bay]
          Length = 450

 Score =  271 bits (693), Expect = 1e-70,   Method: Composition-based stats.
 Identities = 212/447 (47%), Positives = 308/447 (68%), Gaps = 2/447 (0%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M ++ FGTDG+RG  NT+P+ P   +R+G+A G  FR   +  +VVIGKDTRLSGY+ E 
Sbjct: 1   MAKKLFGTDGMRGTVNTYPMVPEIALRLGLAAGKYFRNGARRHKVVIGKDTRLSGYVFET 60

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +L +G  A+GM   ++GP+P+PA++ LTR++RAD+G++ISASHNP+QDNGIK F  +G+K
Sbjct: 61  ALTSGLCASGMHVMLVGPMPTPAISFLTRNMRADIGIVISASHNPFQDNGIKFFDRNGFK 120

Query: 121 VSTDIEDRIETL-LEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRI 179
           +  ++E+ I  + L +         D +G A +++    RYI  +K +LP+ VTL G RI
Sbjct: 121 LPDEVEEEITAMVLAEGTDWDYPSSDKVGRAFKIEDSPGRYIVSLKNSLPQAVTLDGFRI 180

Query: 180 VVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIG 239
           V+DCANGA+YKVAP +F ELGA+V+ +G +PNG+NIN  CGS +   L  KV E ++ IG
Sbjct: 181 VLDCANGATYKVAPLLFEELGAEVIKLGVEPNGLNINEKCGSLHPEVLAAKVRETQSGIG 240

Query: 240 IALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAG 299
           +ALDGDGDR+I+VDEKG +++GDQIMA+ A++      L GN +V TVMSN+ LE F+  
Sbjct: 241 LALDGDGDRLIVVDEKGTVLDGDQIMAICAKDLAERGELPGNLLVATVMSNMALEVFMQD 300

Query: 300 LGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYD 359
           LG  L RT VGDRY+ E ++     +GGEQSGHII S Y +TGDG++AALQ+LR +++  
Sbjct: 301 LGGRLLRTPVGDRYVAEALRRENGVLGGEQSGHIIFSRYATTGDGILAALQLLRIMQERG 360

Query: 360 KPVSTICHCFEEYPQFLRSVSVKDTSIL-NSSSIVQAIADAESELRGIDRLIVRASGTES 418
           KP+S +    E YPQ L +V V   +      ++ +A+ DAE +L G  R+++R SGTE 
Sbjct: 361 KPLSELAKLLEPYPQTLINVRVVRKTPFEEVPAVQKALVDAEQKLGGRGRVLLRYSGTEP 420

Query: 419 LIRIMAEGDDLSRIKRIVDDLAKVIPM 445
           L R+M EG+D + +K++ ++L  V+  
Sbjct: 421 LARVMVEGEDKALVKQLSEELVGVVEA 447


>gi|224823867|ref|ZP_03696976.1| phosphoglucosamine mutase [Lutiella nitroferrum 2002]
 gi|224604322|gb|EEG10496.1| phosphoglucosamine mutase [Lutiella nitroferrum 2002]
          Length = 445

 Score =  271 bits (693), Expect = 1e-70,   Method: Composition-based stats.
 Identities = 200/446 (44%), Positives = 296/446 (66%), Gaps = 7/446 (1%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKK--HRRVVIGKDTRLSGYML 58
           M R++FGTDGIRG+   FPITP F++++G A G +    +   H  V+IGKDTR+SGYML
Sbjct: 1   MARKYFGTDGIRGEVGQFPITPEFVLKLGYAAGRVLVNHENDLHPTVLIGKDTRISGYML 60

Query: 59  ENSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDG 118
           E +L AG TAAG++  + GP+P+P +A LTR+LR   GVMISASHNPY DNGIK F   G
Sbjct: 61  EAALQAGLTAAGVNVLLTGPLPTPGIAYLTRALRLSAGVMISASHNPYHDNGIKFFAEGG 120

Query: 119 YKVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLR 178
            K+   IE  IE +LE  + +       +G A+R+DG  +RYIE  K T P D  L+GL+
Sbjct: 121 KKLDDAIELEIEAMLEQPMETRP--SRELGRARRIDGAAERYIEFCKSTFPNDRNLKGLK 178

Query: 179 IVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADI 238
           +VVDCA+GA+Y +AP+VF ELGA+VV IG +P G NIN   G+T   +LQ  V +  AD 
Sbjct: 179 LVVDCAHGATYHIAPKVFHELGAEVVTIGGEPTGYNINDKVGATYTKTLQAAVLQHEADY 238

Query: 239 GIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIA 298
           G+ALDGDGDR+++VD KG + +GDQ++ +IA+   +       G+V TVM+N+G+E  + 
Sbjct: 239 GVALDGDGDRLMMVDRKGQVYDGDQLIYVIAK-ARAAKGELKGGVVGTVMTNMGMELALQ 297

Query: 299 GLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQY 358
            + +   R +VGDRY++E + NNG+ VGGE SGH++  D  +TGDG+++ LQVL  + + 
Sbjct: 298 KMAVPFGRAKVGDRYVLEMLHNNGWLVGGEASGHVLCLDKHNTGDGIISCLQVLTALAEL 357

Query: 359 DKPVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTES 418
            + ++++C  ++ +PQ L +V +K       ++ V  +  AE+ L+G  R+++R SGTE 
Sbjct: 358 GQDLASVCRDWQPFPQTLINVRLKGQDW--KAASVDVLTAAETALQGRGRVVLRPSGTEP 415

Query: 419 LIRIMAEGDDLSRIKRIVDDLAKVIP 444
           ++R+M E DD +  ++   ++A VI 
Sbjct: 416 VVRVMVEADDHALSEKWAREIAAVIE 441


>gi|302038044|ref|YP_003798366.1| phosphoglucosamine mutase [Candidatus Nitrospira defluvii]
 gi|300606108|emb|CBK42441.1| Phosphoglucosamine mutase [Candidatus Nitrospira defluvii]
          Length = 449

 Score =  271 bits (693), Expect = 2e-70,   Method: Composition-based stats.
 Identities = 223/445 (50%), Positives = 300/445 (67%), Gaps = 2/445 (0%)

Query: 3   RRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSL 62
           R+ FGTDG+RG +N  P+T    M++G A  ++F  +    +VVIGKDTRLSGYMLE++L
Sbjct: 2   RKLFGTDGVRGVANLEPMTSEIAMQLGRAAAHMFMRRAGRHQVVIGKDTRLSGYMLESAL 61

Query: 63  VAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVS 122
            +G  + G+D  ++GP+P+PA+A LTRSLRAD GV+ISASHNPYQDNGIK F  +G+K+ 
Sbjct: 62  TSGICSMGVDVLLVGPLPTPAIAFLTRSLRADAGVVISASHNPYQDNGIKFFSNEGFKLP 121

Query: 123 TDIEDRIET-LLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVV 181
            ++E RIE  ++ D++       D+IG A R+D    RYIE VKR+LPRD+  QG+++VV
Sbjct: 122 DELEARIEQLIISDEIKHLRPTADAIGKAYRIDDAEGRYIEFVKRSLPRDLDFQGIKLVV 181

Query: 182 DCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIA 241
           DCANGA+YKVAP VF ELGA++ VI + P+G+NIN  CG+ +   LQ  V    A IGIA
Sbjct: 182 DCANGAAYKVAPAVFRELGAEIEVIANTPDGMNINDGCGAVHPERLQEAVRRHGAHIGIA 241

Query: 242 LDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLG 301
           LDGD DR I V E+G I++GD +MA +  +  +   L    +V TVMSN GLE  +   G
Sbjct: 242 LDGDADRAIFVCEQGTIIDGDHVMAALGLDLHAQGQLACQTVVGTVMSNFGLEIAMKKAG 301

Query: 302 LSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKP 361
           + L RT VGDRY+ME M  +G+N GGEQSGH I  D+ +TGDGL++ALQ+L  +K+  KP
Sbjct: 302 IQLMRTPVGDRYLMERMLADGYNFGGEQSGHFIFLDHNTTGDGLISALQILSLMKRTGKP 361

Query: 362 VSTICHCFEEYPQFLRSVSVKDTSILN-SSSIVQAIADAESELRGIDRLIVRASGTESLI 420
           +S +       PQ L +V VK    LN    I QAI  AE  L G  R++VR SGTESL+
Sbjct: 362 LSELAKAMTAVPQILLNVKVKHKPDLNQIPDIQQAIKSAEVTLNGSGRVLVRYSGTESLL 421

Query: 421 RIMAEGDDLSRIKRIVDDLAKVIPM 445
           RIM EG+  S I+ + D LA+++  
Sbjct: 422 RIMVEGERDSTIREVADHLAEIVRA 446


>gi|225077423|ref|ZP_03720622.1| hypothetical protein NEIFLAOT_02484 [Neisseria flavescens
           NRL30031/H210]
 gi|224951241|gb|EEG32450.1| hypothetical protein NEIFLAOT_02484 [Neisseria flavescens
           NRL30031/H210]
          Length = 445

 Score =  271 bits (693), Expect = 2e-70,   Method: Composition-based stats.
 Identities = 201/446 (45%), Positives = 295/446 (66%), Gaps = 6/446 (1%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKH--RRVVIGKDTRLSGYML 58
           M +++FGTDG+RG+   FPI P+F++++G A G +    K      V+IGKDTR+SGYML
Sbjct: 1   MAKKYFGTDGVRGEVGQFPINPDFVLKLGYAAGQVLVQHKGEIKPTVLIGKDTRISGYML 60

Query: 59  ENSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDG 118
           E +L+AGFTAAG++    GP+P+P VA LTR+LR   GVMISASHN Y DNGIK F   G
Sbjct: 61  EAALIAGFTAAGVNVIQTGPLPTPGVAYLTRALRLSAGVMISASHNVYSDNGIKFFAEGG 120

Query: 119 YKVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLR 178
            K+S +IE  IE  +++++ +       +G A+R++G  DRYIE  K T P  + L+GL+
Sbjct: 121 VKLSDEIELEIEAKIDEEMKAQP--SSRLGRARRINGADDRYIEFCKSTFPSYLDLRGLK 178

Query: 179 IVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADI 238
           +VVD ANGA Y VAP+VF ELGA VV IGD PNG NIN  CG+T+  +LQ  V +  AD 
Sbjct: 179 LVVDTANGAGYAVAPKVFHELGAQVVSIGDDPNGYNINEKCGATHPKALQAAVLQNEADY 238

Query: 239 GIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIA 298
           GIALDGDGDR+++VD  G + +GD ++ +IA+   +H  +   G+V TVM+N+ +E  + 
Sbjct: 239 GIALDGDGDRLMMVDRNGKVYDGDSLIYVIAK-ARAHEGVEIGGVVGTVMTNMAMEIALK 297

Query: 299 GLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQY 358
             G+   R +VGDRY++E +   G+ +GGE SGHI+  D  +TGDG+++ALQVL  ++  
Sbjct: 298 EQGVDFCRAKVGDRYVLEQLHQRGWLIGGEASGHILCMDKHNTGDGIISALQVLAALQTL 357

Query: 359 DKPVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTES 418
           ++ ++T+C  ++ YPQ + +V +K       +S  +A+A+ E EL G  R+++RASGTE 
Sbjct: 358 NQDLATVCADWQPYPQTMINVRIKKGQNWQDAS-KEALAEVEKELEGKGRVVLRASGTEP 416

Query: 419 LIRIMAEGDDLSRIKRIVDDLAKVIP 444
           ++R+M E       K+  + +A  I 
Sbjct: 417 VVRVMVEAKQADWAKKGAEKIAAAIQ 442


>gi|114766649|ref|ZP_01445590.1| phosphoglucosamine mutase [Pelagibaca bermudensis HTCC2601]
 gi|114541112|gb|EAU44166.1| phosphoglucosamine mutase [Roseovarius sp. HTCC2601]
          Length = 447

 Score =  271 bits (692), Expect = 2e-70,   Method: Composition-based stats.
 Identities = 229/447 (51%), Positives = 309/447 (69%), Gaps = 4/447 (0%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKH-RRVVIGKDTRLSGYMLE 59
           M R+ FGTDG+RG +NTFP+T    + IG A G  FR ++    RVVIGKDTRLSGYM E
Sbjct: 1   MTRKLFGTDGVRGTANTFPMTAEMALMIGAAAGRYFRREQGGVHRVVIGKDTRLSGYMFE 60

Query: 60  NSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGY 119
           N+L AG T+ GM+  +LGP+P+PAV +LT S+RAD+G+MISASHNP  DNGIK FGPDG+
Sbjct: 61  NALTAGLTSTGMNVLLLGPVPTPAVGLLTPSMRADLGIMISASHNPADDNGIKFFGPDGF 120

Query: 120 KVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRI 179
           K+S + E  IE L+E  +        +IG AKR+D    RY E +K TLP  + L G+++
Sbjct: 121 KLSDEAEAEIEALVEAGVAPA--QAGNIGRAKRIDDGRFRYQERLKGTLPHGMRLDGMKV 178

Query: 180 VVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIG 239
           VVDCANGA+YK APEV WELGADV+ +G  PNG+NIN +CGST   +    V    AD+G
Sbjct: 179 VVDCANGAAYKTAPEVLWELGADVIPLGTSPNGLNINDNCGSTKPQAAAEAVVAHGADVG 238

Query: 240 IALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAG 299
           I LDGD DR++++DE G I +GDQIMAL+A  W     L    +V TVMSN+GLERF+ G
Sbjct: 239 ICLDGDADRILLIDETGTIADGDQIMALMAARWAEEDRLVDGTLVATVMSNLGLERFLTG 298

Query: 300 LGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYD 359
            GL L+RT+VGDRY++E M+  G+N+GGEQSGHI+++DY +TGDGL+A +Q L  + +  
Sbjct: 299 RGLRLERTKVGDRYVVEAMRAKGWNLGGEQSGHIVMTDYATTGDGLMAGMQFLAEMVRTG 358

Query: 360 KPVSTICHCFEEYPQFLRSVSV-KDTSILNSSSIVQAIADAESELRGIDRLIVRASGTES 418
           +P S +   FE  PQ L++V      + L ++ +  AIA+AE+ L G  RL++R SGTE 
Sbjct: 359 QPASRLARRFEPVPQLLQNVRFAAGQTPLEAARVQGAIAEAEATLSGKGRLLIRKSGTEP 418

Query: 419 LIRIMAEGDDLSRIKRIVDDLAKVIPM 445
           LIR+MAE +D + + R+V+ +   +  
Sbjct: 419 LIRVMAECEDEALLSRVVEGIVAEVKA 445


>gi|241759823|ref|ZP_04757923.1| phosphoglucosamine mutase [Neisseria flavescens SK114]
 gi|241319831|gb|EER56227.1| phosphoglucosamine mutase [Neisseria flavescens SK114]
          Length = 478

 Score =  271 bits (692), Expect = 2e-70,   Method: Composition-based stats.
 Identities = 200/446 (44%), Positives = 296/446 (66%), Gaps = 6/446 (1%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKH--RRVVIGKDTRLSGYML 58
           M +++FGTDG+RG+   FPI P+F++++G A G +    +      V+IGKDTR+SGYML
Sbjct: 34  MAKKYFGTDGVRGEVGQFPINPDFVLKLGYAAGQVLVQHEGEIKPTVLIGKDTRISGYML 93

Query: 59  ENSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDG 118
           E +L+AGFTAAG++    GP+P+P VA LTR+LR   GVMISASHN Y DNGIK F   G
Sbjct: 94  EAALIAGFTAAGVNVIQTGPLPTPGVAYLTRALRLSAGVMISASHNVYSDNGIKFFAEGG 153

Query: 119 YKVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLR 178
            K+S +IE  IE  +++++ +       +G A+R++G  DRYIE  K T P  + L+GL+
Sbjct: 154 VKLSDEIELEIEAKIDEEMKAQP--SGRLGRARRINGADDRYIEFCKSTFPSHLDLRGLK 211

Query: 179 IVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADI 238
           +VVD ANGA Y VAP+VF ELGA VV IGD+PNG NIN  CG+T+  +LQ  V +  AD 
Sbjct: 212 LVVDTANGAGYAVAPKVFHELGAQVVSIGDEPNGYNINEKCGATHPKALQAAVLQNEADY 271

Query: 239 GIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIA 298
           GIALDGDGDR+++VD  G + +GD ++ +IA+   +H  +   G+V TVM+N+ +E  + 
Sbjct: 272 GIALDGDGDRLMMVDRNGKVYDGDSLIYVIAK-ARAHEGVEIGGVVGTVMTNMAMEIALK 330

Query: 299 GLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQY 358
             G+   R +VGDRY++E +   G+ +GGE SGHI+  D  +TGDG+++ALQVL  ++  
Sbjct: 331 EQGVDFCRAKVGDRYVLEQLHQRGWLIGGEASGHILCMDKHNTGDGIISALQVLAALQTL 390

Query: 359 DKPVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTES 418
           ++ ++T+C  ++ YPQ + +V +K       +S  +A+A+ E EL G  R+++RASGTE 
Sbjct: 391 NQDLATVCADWQPYPQTMINVRIKKGQNWQDAS-KEALAEVEKELEGKGRVVLRASGTEP 449

Query: 419 LIRIMAEGDDLSRIKRIVDDLAKVIP 444
           ++R+M E       K+  + +A  I 
Sbjct: 450 VVRVMVEAKQADWAKKGAEKIAAAIQ 475


>gi|255263894|ref|ZP_05343236.1| phosphoglucosamine mutase [Thalassiobium sp. R2A62]
 gi|255106229|gb|EET48903.1| phosphoglucosamine mutase [Thalassiobium sp. R2A62]
          Length = 446

 Score =  271 bits (692), Expect = 2e-70,   Method: Composition-based stats.
 Identities = 226/445 (50%), Positives = 310/445 (69%), Gaps = 4/445 (0%)

Query: 3   RRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKK-KHRRVVIGKDTRLSGYMLENS 61
           R+ FGTDG+RG +N +P+T    ++IG A G  FR       RVVIGKDTRLSGYM EN+
Sbjct: 2   RKLFGTDGVRGTANQYPMTAEMALKIGAAAGRYFRNDGSNGHRVVIGKDTRLSGYMFENA 61

Query: 62  LVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKV 121
           L AG T+ GM+  +LGP+P+PAV ++T S+RADVGVMISASHNP+ DNGIK FGPDG+K+
Sbjct: 62  LTAGLTSTGMNVLLLGPVPTPAVGLMTTSMRADVGVMISASHNPHHDNGIKFFGPDGFKL 121

Query: 122 STDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVV 181
           S + E  IE L+  DL       ++IG AKRVD    RY E VK T P    L G+++V+
Sbjct: 122 SDEAEAEIEALVFSDLVPA--QANNIGRAKRVDDARFRYQERVKSTFPSGQRLDGMKVVI 179

Query: 182 DCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIA 241
           DCANGA+++ APEV WELGA+V+ +G  PNG NIN +CGST+  +    +    AD+GI 
Sbjct: 180 DCANGAAHRCAPEVLWELGAEVIPVGTSPNGYNINENCGSTSTQTAADAIVSHNADVGIC 239

Query: 242 LDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLG 301
           LDGD DRV+++DE G + +GDQ+MAL+A  W    +LRG  +V TVMSN+GLER +   G
Sbjct: 240 LDGDADRVMVLDENGQVCDGDQLMALMATRWAEMDMLRGGALVATVMSNLGLERHLEAKG 299

Query: 302 LSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKP 361
           L L+RT VGDRY++E M+N G+N+GGEQSGHI+++DY +TGDGL+A LQ L  +++  KP
Sbjct: 300 LRLERTGVGDRYVVEAMRNGGYNLGGEQSGHIVMTDYTTTGDGLIAGLQFLSEMQRSGKP 359

Query: 362 VSTICHCFEEYPQFLRSVSVK-DTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
            S +   FE  PQ L++V     +  LN++ +  AIA AE++L G  RL++R SGTE L+
Sbjct: 360 ASALSRTFEPVPQLLKNVRYDAGSDPLNAALVKAAIAQAEADLVGTGRLLIRKSGTEPLV 419

Query: 421 RIMAEGDDLSRIKRIVDDLAKVIPM 445
           R+MAE +D + ++++VD +   +  
Sbjct: 420 RVMAECEDNALLEQVVDGIVAEVEA 444


>gi|323703227|ref|ZP_08114879.1| phosphoglucosamine mutase [Desulfotomaculum nigrificans DSM 574]
 gi|323531783|gb|EGB21670.1| phosphoglucosamine mutase [Desulfotomaculum nigrificans DSM 574]
          Length = 444

 Score =  271 bits (692), Expect = 2e-70,   Method: Composition-based stats.
 Identities = 199/445 (44%), Positives = 289/445 (64%), Gaps = 5/445 (1%)

Query: 4   RFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSLV 63
           + FGTDG+RG +NT  +T     ++G A  Y+   +   ++VVIG+DTR+SG MLE +LV
Sbjct: 3   KLFGTDGVRGVANT-ELTAELAFQLGRAGAYVLTKQGHPKKVVIGRDTRISGDMLEAALV 61

Query: 64  AGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVST 123
           AG  + G+D + +G +P+PA+A LTR L A  GV+ISASHNP  DNGIK FGP GYK+  
Sbjct: 62  AGICSVGVDVYKVGVLPTPAIAFLTRKLGAGAGVVISASHNPVADNGIKFFGPSGYKLPD 121

Query: 124 DIEDRIETL-LEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVVD 182
           ++E RIE L LE            +G    ++   D+Y+ + K T+  +  LQGL++VVD
Sbjct: 122 ELESRIEKLVLEGGEELPKPTGGDLGRTYTIEDAQDQYVAYAKSTI--NTDLQGLKVVVD 179

Query: 183 CANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIAL 242
           CANGA+Y+VAP V  ELGA+V+ I  +P+G+NIN DCGST+   L   V E  AD+G+A 
Sbjct: 180 CANGAAYQVAPRVLSELGAEVIPICHRPDGVNINADCGSTHPEKLMEAVVEHGADLGLAH 239

Query: 243 DGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLGL 302
           DGD DRV+ VD  G +V+GD IM + A+   +   LR N +  TVMSN+GL + +    +
Sbjct: 240 DGDADRVLAVDSNGKLVDGDHIMVICAKHLKARGKLRKNTVAVTVMSNLGLHKALEKSDI 299

Query: 303 SLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKPV 362
            +  T+VGDRY++E +   G   GGEQSGHII  ++ +TGDG++ ALQ+L  IK+  + +
Sbjct: 300 EVVETKVGDRYVLEKLLETGARFGGEQSGHIIFLEHNTTGDGIITALQLLSVIKETGRSL 359

Query: 363 STICHCFEEYPQFLRSVSVKDTS-ILNSSSIVQAIADAESELRGIDRLIVRASGTESLIR 421
           + +    E+YPQ L++V V D   ++NS  + +AI   E +L G  R++VR SGTE L+R
Sbjct: 360 AELAGQMEQYPQILKNVRVTDKKMVMNSPILTEAIRRFERDLAGQGRILVRPSGTEPLVR 419

Query: 422 IMAEGDDLSRIKRIVDDLAKVIPMI 446
           IM EG D+ +++ IVD +A+++  I
Sbjct: 420 IMVEGKDMEQLQSIVDKMAEIVGSI 444


>gi|288554779|ref|YP_003426714.1| phosphoglucosamine mutase [Bacillus pseudofirmus OF4]
 gi|288545939|gb|ADC49822.1| phosphoglucosamine mutase [Bacillus pseudofirmus OF4]
          Length = 449

 Score =  271 bits (692), Expect = 2e-70,   Method: Composition-based stats.
 Identities = 188/444 (42%), Positives = 277/444 (62%), Gaps = 5/444 (1%)

Query: 4   RFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSLV 63
           ++FGTDG+RG +N   +TP    ++G   GY+   +    RVVIG+DTR+SG MLE++LV
Sbjct: 3   KYFGTDGVRGVANK-DLTPELAFKLGRMGGYVLTKQTDKPRVVIGRDTRISGEMLESALV 61

Query: 64  AGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVST 123
           AG  + G +   LG I +P VA LT++L AD GVMISASHNP  DNGIK FGPDG+K+  
Sbjct: 62  AGLLSIGAEVMRLGVISTPGVAYLTKALSADAGVMISASHNPVPDNGIKFFGPDGFKLLD 121

Query: 124 DIEDRIETLLED-DLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVVD 182
           + E  IE L++  +        D++G          +YI+ +K+T+       G+ I +D
Sbjct: 122 EQEKEIEDLIDQTEDALPRPVGDAVGQVNDYFEGGQKYIQFLKQTVQD--DFSGIHIALD 179

Query: 183 CANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIAL 242
           CANGA+  +AP +F +L AD+  +G  PNGININ DCGST+   L   V E  A +G+A 
Sbjct: 180 CANGAASSLAPHLFADLEADISTMGTSPNGININEDCGSTHPEHLAELVVEKGAQVGLAF 239

Query: 243 DGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLGL 302
           DGD DR+I +DE G IV+GD IM + A+       L    +V+TVMSN+G  + +   G+
Sbjct: 240 DGDADRLIAIDENGQIVDGDHIMFICAKFMKEQGWLNHGTVVSTVMSNLGFYKGLEEAGI 299

Query: 303 SLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKPV 362
             K+T VGDRY+ME M+  G+N+GGEQSGHII  D+ +TGDG+++ALQ++  +K   K +
Sbjct: 300 DTKQTGVGDRYVMEEMRKGGYNLGGEQSGHIIFLDHITTGDGMLSALQLVNIMKVTGKKL 359

Query: 363 STICHCFEEYPQFLRSVSVKDT-SILNSSSIVQAIADAESELRGIDRLIVRASGTESLIR 421
           S +    E +PQ L +V V D  ++ ++  +  +I   E+++ G  R++VR SGTE L+R
Sbjct: 360 SELASEMETFPQTLVNVRVTDKHAVTDNEKVRASIEAVEADMAGEGRVLVRPSGTEPLVR 419

Query: 422 IMAEGDDLSRIKRIVDDLAKVIPM 445
           +M E     + ++ V ++AKV+  
Sbjct: 420 VMVEAKTEEKCEQYVTEIAKVVEA 443


>gi|258592311|emb|CBE68620.1| phosphoglucosamine mutase [NC10 bacterium 'Dutch sediment']
          Length = 449

 Score =  271 bits (691), Expect = 2e-70,   Method: Composition-based stats.
 Identities = 210/445 (47%), Positives = 297/445 (66%), Gaps = 2/445 (0%)

Query: 3   RRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSL 62
           R+ FGTDGIRG +N  P+TP  M+++G A  +L RG  +   +VIGKDTRL+GYMLE +L
Sbjct: 2   RQLFGTDGIRGVANREPMTPETMVKVGRAAAHLLRGATERPTIVIGKDTRLTGYMLETAL 61

Query: 63  VAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVS 122
            AG T+ G+D  ++GP+P+P +A +TRSLRAD GV+ISASHNPY+DNGIK F  +G K+ 
Sbjct: 62  TAGITSMGVDVLLVGPLPTPGIAFITRSLRADAGVVISASHNPYEDNGIKFFSHEGLKLP 121

Query: 123 TDIEDRIETLL-EDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVV 181
             +E RIE L+   ++    +    IG A RV     RYIE  K TLP+ +TL+G+R+VV
Sbjct: 122 DAMEQRIEELIRNGEIDGIRTAPSEIGKAYRVGDAVGRYIEFAKNTLPKGMTLKGMRVVV 181

Query: 182 DCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIA 241
           DCANGA+YKV+P V  EL A+VV +  +P+G NIN  CGS +   ++R V + +A +G A
Sbjct: 182 DCANGAAYKVSPAVLKELNAEVVSLNVEPDGTNINKGCGSLHPEEVRRAVVKHKAHVGFA 241

Query: 242 LDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLG 301
            DGD DRV+ VDE+G +++GD I+AL A +      LR N IV TVMSNIGL+  +   G
Sbjct: 242 HDGDADRVVFVDERGELMDGDHILALCALDLKREGRLRENTIVATVMSNIGLDLAMQEAG 301

Query: 302 LSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKP 361
           + + RT VGDRY++E M    + +GGEQSGHII  ++ +TGDGLV ALQVL  +++  KP
Sbjct: 302 IKIVRTAVGDRYVLEKMLAERYMLGGEQSGHIIFLEHHTTGDGLVTALQVLATMQRCGKP 361

Query: 362 VSTICHCFEEYPQFLRSVSVKDTS-ILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
           +S +  C   YPQ L +  V+  + +     + +AI  AE+ + G  R++VR SGTE + 
Sbjct: 362 LSELKACMTSYPQVLINAPVRRRAVVEELPRVQEAIRSAETSMGGRGRILVRLSGTEPVA 421

Query: 421 RIMAEGDDLSRIKRIVDDLAKVIPM 445
           RIM EG++ ++I+R+  ++A  I  
Sbjct: 422 RIMVEGEESAKIERLAREIALAIEK 446


>gi|319638687|ref|ZP_07993447.1| phosphoglucosamine mutase [Neisseria mucosa C102]
 gi|317400071|gb|EFV80732.1| phosphoglucosamine mutase [Neisseria mucosa C102]
          Length = 445

 Score =  271 bits (691), Expect = 2e-70,   Method: Composition-based stats.
 Identities = 199/446 (44%), Positives = 296/446 (66%), Gaps = 6/446 (1%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKH--RRVVIGKDTRLSGYML 58
           M +++FGTDG+RG+   FPI P+F++++G A G +    +      V+IGKDTR+SGYML
Sbjct: 1   MAKKYFGTDGVRGEVGQFPINPDFVLKLGYAAGQVLVQHEGEIKPTVLIGKDTRISGYML 60

Query: 59  ENSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDG 118
           E +L+AGFTAAG++    GP+P+P VA LTR+LR   GVMISASHN Y DNGIK F   G
Sbjct: 61  EAALIAGFTAAGVNVIQTGPLPTPGVAYLTRALRLSAGVMISASHNVYSDNGIKFFAEGG 120

Query: 119 YKVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLR 178
            K+S +IE  IE  +++++ +       +G A+R++G  DRYIE  K T P  + L+GL+
Sbjct: 121 VKLSDEIELEIEAKIDEEMKTQP--SSRLGRARRINGADDRYIEFCKSTFPSHLDLRGLK 178

Query: 179 IVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADI 238
           +VVD ANGA Y VAP+VF ELGA VV IG++PNG NIN  CG+T+  +LQ  V +  AD 
Sbjct: 179 LVVDTANGAGYAVAPKVFHELGAQVVSIGNEPNGYNINEKCGATHPKALQAAVLQNEADY 238

Query: 239 GIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIA 298
           GIALDGDGDR+++VD  G + +GD ++ +IA+   +H  +   G+V TVM+N+ +E  + 
Sbjct: 239 GIALDGDGDRLMMVDRNGKVYDGDSLIYVIAK-ARAHEGVEIGGVVGTVMTNMAMEVALK 297

Query: 299 GLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQY 358
             G+   R +VGDRY++E +   G+ +GGE SGHI+  D  +TGDG+++ALQVL  ++  
Sbjct: 298 EQGVDFCRAKVGDRYVLEQLHQRGWLIGGEASGHILCMDKHNTGDGIISALQVLAALQTL 357

Query: 359 DKPVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTES 418
           ++ ++T+C  ++ YPQ + +V +K       +S  +A+A+ E EL G  R+++RASGTE 
Sbjct: 358 NQDLATVCADWQPYPQTMINVRIKKGQNWQDAS-KEALAEVEKELEGKGRVVLRASGTEP 416

Query: 419 LIRIMAEGDDLSRIKRIVDDLAKVIP 444
           ++R+M E       K+  + +A  I 
Sbjct: 417 VVRVMVEAKQADWAKKGAEKIAAAIQ 442


>gi|296446364|ref|ZP_06888309.1| phosphoglucosamine mutase [Methylosinus trichosporium OB3b]
 gi|296256137|gb|EFH03219.1| phosphoglucosamine mutase [Methylosinus trichosporium OB3b]
          Length = 449

 Score =  271 bits (691), Expect = 2e-70,   Method: Composition-based stats.
 Identities = 252/449 (56%), Positives = 330/449 (73%), Gaps = 2/449 (0%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHR-RVVIGKDTRLSGYMLE 59
           M R +FGTDGIRG++N   ITP   M++G A G +F    + R RVVIGKDTRLSGYM+E
Sbjct: 1   MTRSYFGTDGIRGRANQK-ITPELAMKVGQAAGLIFNRDGERRHRVVIGKDTRLSGYMIE 59

Query: 60  NSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGY 119
            +LVAGFT+ GMD  +LGP+P+PAVAMLTRS+RAD+GVMISASHN Y+DNGIKLFGPD Y
Sbjct: 60  YALVAGFTSVGMDVLLLGPMPTPAVAMLTRSMRADLGVMISASHNLYEDNGIKLFGPDAY 119

Query: 120 KVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRI 179
           K+S + E  IE L+E DLTS L+    +G AKR++ V  RYIE+ KRTLPR+++ +GLR+
Sbjct: 120 KLSDETELEIEKLIERDLTSRLAGPQELGRAKRIEDVRARYIEYAKRTLPRNMSFEGLRV 179

Query: 180 VVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIG 239
           V+DCANGA+YKVAPE  WELGA+V+ IGD P+G NIN   GST    L+ KV E+RAD+G
Sbjct: 180 VLDCANGAAYKVAPEALWELGAEVITIGDAPDGFNINRAVGSTAPQKLKEKVRELRADVG 239

Query: 240 IALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAG 299
           IALDGD DRVI+VDE G +V+GDQ+MA++AR W     L   G+V T+MSN+GLER++  
Sbjct: 240 IALDGDADRVIMVDELGHVVDGDQLMAVVARSWRDEGWLAKPGVVATIMSNLGLERYLGS 299

Query: 300 LGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYD 359
           LGL+L+RT VGDRY++E M+  G+NVGGEQSGH+ILSDY +TGDGLV A+Q L  +K+  
Sbjct: 300 LGLTLERTAVGDRYVIERMRERGYNVGGEQSGHVILSDYSTTGDGLVTAMQALAAVKKLG 359

Query: 360 KPVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESL 419
           + VS +C  FE  PQ L++V V     L   ++V+AI      L G  RL++R SGTE +
Sbjct: 360 RRVSEVCRVFEPLPQVLKNVRVSGRLALEQDAVVRAIEAGRQRLDGAGRLVIRPSGTEPV 419

Query: 420 IRIMAEGDDLSRIKRIVDDLAKVIPMIDS 448
           IR+M EG++   +  +VDD+   +   ++
Sbjct: 420 IRVMGEGENPDLVTSVVDDICDALTRAEA 448


>gi|261380990|ref|ZP_05985563.1| phosphoglucosamine mutase [Neisseria subflava NJ9703]
 gi|284796020|gb|EFC51367.1| phosphoglucosamine mutase [Neisseria subflava NJ9703]
          Length = 445

 Score =  271 bits (691), Expect = 3e-70,   Method: Composition-based stats.
 Identities = 200/446 (44%), Positives = 296/446 (66%), Gaps = 6/446 (1%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKH--RRVVIGKDTRLSGYML 58
           M +++FGTDG+RG+   FPI P+F++++G A G +    +      V+IGKDTR+SGYML
Sbjct: 1   MAKKYFGTDGVRGEVGQFPINPDFVLKLGYAAGQVLVQHEGEIKPTVLIGKDTRISGYML 60

Query: 59  ENSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDG 118
           E +L+AGFTAAG++    GP+P+P VA LTR+LR   GVMISASHN Y DNGIK F   G
Sbjct: 61  EAALIAGFTAAGVNVIQTGPLPTPGVAYLTRALRLSAGVMISASHNVYSDNGIKFFAEGG 120

Query: 119 YKVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLR 178
            K+S +IE  IE  +++++ +       +G A+R++G  DRYIE  K T P  + L+GL+
Sbjct: 121 VKLSDEIELEIEAKIDEEMKTQP--SSRLGRARRINGADDRYIEFCKSTFPSHLDLRGLK 178

Query: 179 IVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADI 238
           +VVD ANGA Y VAP+VF ELGA VV IGD+PNG NIN  CG+T+  +LQ  V +  AD 
Sbjct: 179 LVVDTANGAGYAVAPKVFHELGAQVVSIGDEPNGYNINEKCGATHPKALQAAVLQNEADY 238

Query: 239 GIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIA 298
           GIALDGDGDR+++VD  G + +GD ++ +IA+   +H  +   G+V TVM+N+ +E  + 
Sbjct: 239 GIALDGDGDRLMMVDRNGKVYDGDSLIYVIAK-ARAHEGVEIGGVVGTVMTNMAMEVALK 297

Query: 299 GLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQY 358
             G+   R +VGDRY++E +   G+ +GGE SGHI+  D  +TGDG+++ALQVL  ++  
Sbjct: 298 EQGVDFCRAKVGDRYVLEQLHQRGWLIGGEASGHILCMDKHNTGDGIISALQVLAALQTL 357

Query: 359 DKPVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTES 418
           ++ ++T+C  ++ YPQ + +V +K       +S  +A+A+ E EL G  R+++RASGTE 
Sbjct: 358 NQDLATVCADWQPYPQTMINVRIKKGQNWQDAS-KEALAEVEKELEGKGRVVLRASGTEP 416

Query: 419 LIRIMAEGDDLSRIKRIVDDLAKVIP 444
           ++R+M E       K+  + +A  I 
Sbjct: 417 VVRVMVEAKQADWAKKGAEKIAAAIQ 442


>gi|307824616|ref|ZP_07654840.1| phosphoglucosamine mutase [Methylobacter tundripaludum SV96]
 gi|307734270|gb|EFO05123.1| phosphoglucosamine mutase [Methylobacter tundripaludum SV96]
          Length = 446

 Score =  270 bits (690), Expect = 3e-70,   Method: Composition-based stats.
 Identities = 196/446 (43%), Positives = 290/446 (65%), Gaps = 5/446 (1%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M +++FGTDGIRGK    PIT +F +++G A G +F  +  H  V++GKDTR+SGYM E+
Sbjct: 1   MIKKYFGTDGIRGKVGEHPITADFFLKLGWAAGRVFANEG-HGFVLVGKDTRISGYMFES 59

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +L AG TAAG+D  +LGP+P+P +A LTR+LRA  G++ISASHNPY DNG+K F   G K
Sbjct: 60  ALEAGLTAAGVDTRLLGPMPTPGIAYLTRTLRAQAGIVISASHNPYYDNGVKFFSVQGTK 119

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +  +IE +IE  ++  +T+       +G AKR+     RYIE  K ++P  +   G+RI+
Sbjct: 120 LPDEIEQKIEEYIDSPMTTV--ESSKLGKAKRLVDAPGRYIEFCKASVPTRLDFSGMRII 177

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           +DCA+GA+Y +AP VF E+GA+VV IG +P+G+NIN +CG+T    L   V   RAD+GI
Sbjct: 178 IDCAHGATYHIAPHVFSEVGAEVVTIGAEPDGLNINDECGATKPEKLAATVLSYRADLGI 237

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           ALDGDGDR+++VD KG IV+GD+++ +IA+  +    L    +V T+M+N+G+E  +  L
Sbjct: 238 ALDGDGDRLVMVDHKGEIVDGDELIYIIAKARLDA-GLMSGPVVGTLMTNLGMEHGLKKL 296

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           GL+L R  VGDRY+ME +  +   +GGE SGHII  D  +TGDG++AALQ++  ++   K
Sbjct: 297 GLNLLRANVGDRYVMEMLTEHQGILGGENSGHIICLDRTTTGDGIIAALQIMAEMQSSGK 356

Query: 361 PVSTICHCFEEYPQFLRSVSVKDT-SILNSSSIVQAIADAESELRGIDRLIVRASGTESL 419
            +  +    ++YPQ L +V      +   + SI +A+   E +L    R+++RASGTE L
Sbjct: 357 NLHELKSGMQKYPQVLVNVKTDKKINPDENESIQKAVKAIEKKLGDNGRVLLRASGTEPL 416

Query: 420 IRIMAEGDDLSRIKRIVDDLAKVIPM 445
           IR+M EG     +K     +A  +  
Sbjct: 417 IRVMVEGQQAELVKNYAHQIADDVKK 442


>gi|84029237|sp|Q89DN1|GLMM_BRAJA RecName: Full=Phosphoglucosamine mutase
          Length = 447

 Score =  270 bits (690), Expect = 3e-70,   Method: Composition-based stats.
 Identities = 258/443 (58%), Positives = 338/443 (76%), Gaps = 1/443 (0%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M R++FGTDGIRG++N   ITP   +++G A G  F+      RVVIGKDTRLSGYM+E 
Sbjct: 1   MSRKYFGTDGIRGRAN-GLITPELALKVGQAAGLAFQRGDHRHRVVIGKDTRLSGYMIEY 59

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           ++VAGFT+ GMD  ++GP+P+PAVAMLT+S+RAD+GVMISASHN ++DNGIKLFGP G+K
Sbjct: 60  AMVAGFTSVGMDVLLVGPMPTPAVAMLTKSMRADLGVMISASHNLFEDNGIKLFGPQGFK 119

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +S D+E +IE LL++ +   L+   S+G A+R+DGVHDRYIE  KRTLPRD++L GLR+V
Sbjct: 120 LSDDVEKQIEQLLDEPIDKRLAQSASLGRARRIDGVHDRYIEFAKRTLPRDLSLDGLRVV 179

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           VDCANGA+YKV PE  WELGADVV IG +P+G NIN DCGST+  +L +KV E+RADIGI
Sbjct: 180 VDCANGAAYKVVPEALWELGADVVPIGVEPDGFNINKDCGSTSPEALSKKVREMRADIGI 239

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           ALDGD DRVI+VDE+G +V+GDQ++A+IA+ W     L   GIV TVMSN+GLERF+ G 
Sbjct: 240 ALDGDADRVILVDERGHVVDGDQLLAVIAQSWKEDGRLSRPGIVATVMSNLGLERFLKGQ 299

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           GL L RT VGDRY++E M + G+N+GGEQSGHIILSDY +TGDG VAALQVL  +++  +
Sbjct: 300 GLDLVRTPVGDRYVLEQMLSGGYNLGGEQSGHIILSDYATTGDGFVAALQVLAVVQKSRR 359

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
           PVS +CH F+  PQ L++V  K    L+ S +  AI+D E  L G  RL++R+SGTE +I
Sbjct: 360 PVSEVCHRFDPLPQILKNVRHKGGKPLDDSDVKSAISDGEKRLNGHGRLLIRSSGTEPVI 419

Query: 421 RIMAEGDDLSRIKRIVDDLAKVI 443
           R+M EG+D   ++ +VD +   +
Sbjct: 420 RVMGEGEDRILVEDVVDTIVSAL 442


>gi|27382519|ref|NP_774048.1| phosphoglucosamine mutase [Bradyrhizobium japonicum USDA 110]
 gi|27355691|dbj|BAC52673.1| phosphoglucomutase/phosphomannomutase [Bradyrhizobium japonicum
           USDA 110]
          Length = 451

 Score =  270 bits (690), Expect = 3e-70,   Method: Composition-based stats.
 Identities = 258/443 (58%), Positives = 338/443 (76%), Gaps = 1/443 (0%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M R++FGTDGIRG++N   ITP   +++G A G  F+      RVVIGKDTRLSGYM+E 
Sbjct: 5   MSRKYFGTDGIRGRAN-GLITPELALKVGQAAGLAFQRGDHRHRVVIGKDTRLSGYMIEY 63

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           ++VAGFT+ GMD  ++GP+P+PAVAMLT+S+RAD+GVMISASHN ++DNGIKLFGP G+K
Sbjct: 64  AMVAGFTSVGMDVLLVGPMPTPAVAMLTKSMRADLGVMISASHNLFEDNGIKLFGPQGFK 123

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +S D+E +IE LL++ +   L+   S+G A+R+DGVHDRYIE  KRTLPRD++L GLR+V
Sbjct: 124 LSDDVEKQIEQLLDEPIDKRLAQSASLGRARRIDGVHDRYIEFAKRTLPRDLSLDGLRVV 183

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           VDCANGA+YKV PE  WELGADVV IG +P+G NIN DCGST+  +L +KV E+RADIGI
Sbjct: 184 VDCANGAAYKVVPEALWELGADVVPIGVEPDGFNINKDCGSTSPEALSKKVREMRADIGI 243

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           ALDGD DRVI+VDE+G +V+GDQ++A+IA+ W     L   GIV TVMSN+GLERF+ G 
Sbjct: 244 ALDGDADRVILVDERGHVVDGDQLLAVIAQSWKEDGRLSRPGIVATVMSNLGLERFLKGQ 303

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           GL L RT VGDRY++E M + G+N+GGEQSGHIILSDY +TGDG VAALQVL  +++  +
Sbjct: 304 GLDLVRTPVGDRYVLEQMLSGGYNLGGEQSGHIILSDYATTGDGFVAALQVLAVVQKSRR 363

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
           PVS +CH F+  PQ L++V  K    L+ S +  AI+D E  L G  RL++R+SGTE +I
Sbjct: 364 PVSEVCHRFDPLPQILKNVRHKGGKPLDDSDVKSAISDGEKRLNGHGRLLIRSSGTEPVI 423

Query: 421 RIMAEGDDLSRIKRIVDDLAKVI 443
           R+M EG+D   ++ +VD +   +
Sbjct: 424 RVMGEGEDRILVEDVVDTIVSAL 446


>gi|254419315|ref|ZP_05033039.1| phosphoglucosamine mutase [Brevundimonas sp. BAL3]
 gi|196185492|gb|EDX80468.1| phosphoglucosamine mutase [Brevundimonas sp. BAL3]
          Length = 449

 Score =  270 bits (690), Expect = 3e-70,   Method: Composition-based stats.
 Identities = 252/444 (56%), Positives = 321/444 (72%), Gaps = 1/444 (0%)

Query: 3   RRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRR-VVIGKDTRLSGYMLENS 61
           R++FGTDGIRG++NT+P+T    +R+G+A G LFR     R  VVIGKDTRLSGY +E +
Sbjct: 4   RKYFGTDGIRGRANTYPMTAEVALRVGLAAGKLFRTGDDRRHLVVIGKDTRLSGYTIEPA 63

Query: 62  LVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKV 121
           LVAGF + GMD    GP+P+P VAMLTRS+RAD+GVMISASHN Y DNGIKLFGPDGYK+
Sbjct: 64  LVAGFASVGMDVRTFGPVPTPGVAMLTRSMRADLGVMISASHNDYADNGIKLFGPDGYKL 123

Query: 122 STDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVV 181
           S +IE +IE L++D L   L+  + +G  KR+D    RYIE  K+  P+ +TLQGLRI V
Sbjct: 124 SDEIELKIEALMDDGLDQGLAPSNRLGRVKRIDDAQARYIEIAKQAFPKRLTLQGLRIAV 183

Query: 182 DCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIA 241
           DCANGA YKVAP   +ELGA+V  +G  PNG NIN +CGST+  +L   V   RADIGIA
Sbjct: 184 DCANGAGYKVAPTTLFELGAEVFPVGVTPNGTNINAECGSTHPATLVEAVKRYRADIGIA 243

Query: 242 LDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLG 301
           LDGD DR+II DEKG +V+GDQIMAL+  +W    LL G G+V TVMSN+GLER +   G
Sbjct: 244 LDGDADRLIICDEKGQVVDGDQIMALVGLDWARRGLLTGGGVVATVMSNLGLERRLKAEG 303

Query: 302 LSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKP 361
           L+L+RT+VGDRY+ME M+  GFN+GGEQSGHIIL D+ +TGDGL+AALQVL  +    KP
Sbjct: 304 LTLERTKVGDRYVMERMREGGFNIGGEQSGHIILHDHATTGDGLMAALQVLAVLVDSGKP 363

Query: 362 VSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLIR 421
           +S +   F+  PQ L +V       L S ++  AIA+AE+ L G  RL+VR SGTE LIR
Sbjct: 364 MSELARQFDPVPQRLENVRYTAGKPLESDTVKTAIAEAEATLNGQGRLLVRPSGTEKLIR 423

Query: 422 IMAEGDDLSRIKRIVDDLAKVIPM 445
           +MAEGDD + +KR+V +++  +  
Sbjct: 424 VMAEGDDAALVKRVVSEVSAAVKA 447


>gi|149192457|ref|ZP_01870650.1| phosphomannomutase [Vibrio shilonii AK1]
 gi|148833708|gb|EDL50752.1| phosphomannomutase [Vibrio shilonii AK1]
          Length = 445

 Score =  270 bits (690), Expect = 3e-70,   Method: Composition-based stats.
 Identities = 203/445 (45%), Positives = 295/445 (66%), Gaps = 5/445 (1%)

Query: 2   KRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENS 61
           +RR+FGTDGIRGK   FPITP+F++++G A G +   +   ++V+IGKDTR+SGYMLE++
Sbjct: 3   QRRYFGTDGIRGKVGQFPITPDFVLKLGWAAGRVLAKQG-TKKVIIGKDTRISGYMLESA 61

Query: 62  LVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKV 121
           L AG +AAG+ A   GP+P+PAVA LT++ RA+ G++ISASHNPY DNGIK F  +G K+
Sbjct: 62  LEAGLSAAGLKAIFTGPLPTPAVAYLTQTFRAEAGIVISASHNPYYDNGIKFFSSEGTKL 121

Query: 122 STDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVV 181
              IE  IE  L+ D+         +G A R++    RYIE  K T P D++L GL+IV+
Sbjct: 122 PDAIELAIEEELDKDIE--CVESAELGKASRLNDAAGRYIEFCKSTFPHDLSLAGLKIVL 179

Query: 182 DCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIA 241
           DCA+GA+YK+AP VF ELGAD++ +G +PNG NIN + G+T+V +LQ +V   +ADIG+A
Sbjct: 180 DCAHGATYKIAPSVFAELGADIITMGVEPNGTNINHEVGATDVRALQARVVAEKADIGLA 239

Query: 242 LDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLG 301
            DGDGDR+I+VD  G  V+GDQI  +IAR+ +    L+G  + T  M+N+G+E  +  LG
Sbjct: 240 FDGDGDRIIMVDHLGNKVDGDQIAYIIARDALRRGELKGGVVGTL-MTNLGMENGLKQLG 298

Query: 302 LSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKP 361
           +   R  VGDRY+ME +   G+ +G E SGH+IL D  +TGD +VAALQVL  I      
Sbjct: 299 IPFVRAAVGDRYVMEQLLEKGWRIGAENSGHVILLDKVTTGDAIVAALQVLASIVGAKMS 358

Query: 362 VSTICHCFEEYPQFLRSVSVK-DTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
           ++ +      YPQ L +V    D + L + +++ A+  AE++L    R+++R SGTE L+
Sbjct: 359 LNELASGMMLYPQVLINVRFSGDANPLEADAVIAAVKKAEADLGDKGRVLLRKSGTEPLL 418

Query: 421 RIMAEGDDLSRIKRIVDDLAKVIPM 445
           R+M EG+D + +      +A ++  
Sbjct: 419 RVMVEGEDETLVNDSAQYIADIVKE 443


>gi|240949732|ref|ZP_04754064.1| phosphoglucosamine mutase [Actinobacillus minor NM305]
 gi|240295764|gb|EER46451.1| phosphoglucosamine mutase [Actinobacillus minor NM305]
          Length = 443

 Score =  270 bits (690), Expect = 3e-70,   Method: Composition-based stats.
 Identities = 194/445 (43%), Positives = 289/445 (64%), Gaps = 5/445 (1%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M R++FGTDG+RG+   FPITP F +++G A G +   +   ++V+IGKDTR+SGYMLE+
Sbjct: 1   MARKYFGTDGVRGEVGKFPITPEFALKLGWAAGKVLATQG-TKKVLIGKDTRISGYMLES 59

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +L AG TAAG+ A  +GP+P+PA+A LTR+ RA+ G++ISASHNPY DNGIK F   G K
Sbjct: 60  ALEAGLTAAGLSAVFVGPMPTPAIAYLTRTFRAEAGIVISASHNPYYDNGIKFFSAVGEK 119

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +  ++E+ IE +L++ +        ++G A R++    RYIE  K   P  ++L G +IV
Sbjct: 120 LPDEVEEAIEAMLDEPMD--CVDSANLGKASRINDAAGRYIEFCKAGFPSHLSLDGYKIV 177

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           VDCANGA+Y +AP V  ELGA+V+ IG  PNG+NIN  CG+T++ +LQ+ V E  ADIG+
Sbjct: 178 VDCANGATYHIAPNVMRELGAEVIEIGTHPNGLNINEKCGATDIKALQKVVVEAGADIGL 237

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           A DGDGDR+++VD  G  V+GDQI+ ++ARE +    L+G  + T  MSN+ LE  +  L
Sbjct: 238 AYDGDGDRIMMVDHLGNKVDGDQILFILAREALRAGKLQGGVVGTL-MSNMSLEIALKEL 296

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
            +   R  VGDRY++E +K  G+ +GGE SGHII+ D  +TGDG++A+L+VL  +  +  
Sbjct: 297 AIPFSRANVGDRYVLEQLKEKGWKLGGENSGHIIVLDKNTTGDGIIASLEVLAAMVSHKM 356

Query: 361 PVSTICHCFEEYPQFLRSVSVK-DTSILNSSSIVQAIADAESELRGIDRLIVRASGTESL 419
            ++ +      +PQ L +V      + L S  +       E  L G  R+++R SGTE L
Sbjct: 357 TLNELAKAVPLFPQVLINVRFSGGNNPLESEEVKAVAKSVEERLAGKGRILLRKSGTEPL 416

Query: 420 IRIMAEGDDLSRIKRIVDDLAKVIP 444
           IR+M E +D +  +   +++A+ + 
Sbjct: 417 IRVMVECEDGTLAQSCAEEIAEAVK 441


>gi|110833185|ref|YP_692044.1| phosphoglucosamine mutase [Alcanivorax borkumensis SK2]
 gi|122959686|sp|Q0VSS6|GLMM_ALCBS RecName: Full=Phosphoglucosamine mutase
 gi|110646296|emb|CAL15772.1| phosphoglucosamine mutase [Alcanivorax borkumensis SK2]
          Length = 444

 Score =  270 bits (690), Expect = 3e-70,   Method: Composition-based stats.
 Identities = 200/446 (44%), Positives = 296/446 (66%), Gaps = 6/446 (1%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M R++FGTDG+RG    FPITP+F++++G A G +   +    +++IGKDTR+SGYM E+
Sbjct: 1   MTRKYFGTDGVRGTVGEFPITPDFVLKLGWAAGKVLGARGG-SKILIGKDTRISGYMFES 59

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +L AG +AAG+D  +LGP+P+P +A LTR+L A  G++ISASHNPY DNGIK FG DG K
Sbjct: 60  ALEAGISAAGVDVRLLGPLPTPGIAYLTRTLSAQAGIVISASHNPYTDNGIKFFGADGRK 119

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           ++ +IE  IE LL++ ++   +  D IG  +R+D    RYIE  K T P  + L G++IV
Sbjct: 120 LNDEIELEIERLLDEQMSVVST--DQIGKVRRIDDARGRYIEFCKSTAPG-LDLNGMKIV 176

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           VD ANGA+Y +AP+VF ELGA VV + ++P+G NIN DCGST+  +LQRKV E +AD+G+
Sbjct: 177 VDTANGAAYHIAPDVFEELGATVVPLANQPDGFNINRDCGSTHPEALQRKVVEEKADLGV 236

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           ALDGD DR+++VD  G +V+GDQ++ ++AR+   +       + T  MSN GLE  +   
Sbjct: 237 ALDGDADRLLMVDHAGNLVDGDQLLFVVARDRKENGAEMDGVVGTL-MSNFGLELALQAE 295

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           G+   R +VGDRY+ME +   G+N+GGE SGH++  D  +TGDG V+ALQVL  + +  +
Sbjct: 296 GIEFVRAKVGDRYVMEQLDKRGWNIGGESSGHLVCLDCTTTGDGTVSALQVLAALSRRKQ 355

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTSIL-NSSSIVQAIADAESELRGIDRLIVRASGTESL 419
            ++         PQ + +V   +      +  +  A+AD E  L G  R+++R SGTE L
Sbjct: 356 GLAESVADVSMLPQKMINVRGPNRDGFMENGDVQAAMADVEDRLAGNGRILLRPSGTEPL 415

Query: 420 IRIMAEGDDLSRIKRIVDDLAKVIPM 445
           +R+M EG D+ R++ +  +LA+V+  
Sbjct: 416 VRVMIEGKDVDRVESLCRELAEVVEK 441


>gi|77918607|ref|YP_356422.1| phosphoglucosamine mutase [Pelobacter carbinolicus DSM 2380]
 gi|123574577|sp|Q3A5V5|GLMM_PELCD RecName: Full=Phosphoglucosamine mutase
 gi|77544690|gb|ABA88252.1| phosphoglucosamine mutase [Pelobacter carbinolicus DSM 2380]
          Length = 460

 Score =  270 bits (690), Expect = 3e-70,   Method: Composition-based stats.
 Identities = 214/447 (47%), Positives = 298/447 (66%), Gaps = 3/447 (0%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHR-RVVIGKDTRLSGYMLE 59
           MK++ FGTDG+RG +N +P+T    M++G A  ++F+     R R+VIGKDTRLSGYM+E
Sbjct: 4   MKKKLFGTDGVRGVANIYPMTTEIAMQLGRAAAHIFKKDHTRRHRIVIGKDTRLSGYMIE 63

Query: 60  NSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGY 119
           N+LVAG  + G+D  ++GP+P+P +A +T S+RAD GV+ISASHNPYQDNGIK F  DG+
Sbjct: 64  NALVAGICSMGVDVLLVGPLPTPGIAFITSSMRADAGVVISASHNPYQDNGIKFFSADGF 123

Query: 120 KVSTDIEDRIETLLE-DDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLR 178
           K+    E  IE L+  +++ S     D +G A R+D    RYI  +K + P+D+ L GL+
Sbjct: 124 KLPDTTELEIEKLIFGNEIDSLRPVADEVGKAFRMDDAGGRYIVFLKNSFPQDLDLNGLK 183

Query: 179 IVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADI 238
           IV+DCANGA+YKVAP V  ELGA+VV +G KPNG NIN  CGS    SL + V E  A +
Sbjct: 184 IVLDCANGAAYKVAPAVLEELGAEVVTLGVKPNGSNINAGCGSLYPESLAKAVKEHGAHL 243

Query: 239 GIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIA 298
           G+ALDGD DRVI VDE+G  V+GDQIMA+ + + M    L  N +V+TVMSN+GL+  + 
Sbjct: 244 GMALDGDADRVIFVDEQGQEVDGDQIMAICSLDMMKQGKLAHNTLVSTVMSNMGLDIALR 303

Query: 299 GLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQY 358
             G  + +T VGDRY++E M+  G+N+GGEQSGH+I  DY +TGDG+V+ALQ+L  +++ 
Sbjct: 304 NAGGQVVKTAVGDRYVVEEMRRGGYNLGGEQSGHMIFLDYNTTGDGMVSALQLLAIMQRT 363

Query: 359 DKPVSTICHCFEEYPQFLRSVSVKDTSILN-SSSIVQAIADAESELRGIDRLIVRASGTE 417
            KP+S +       PQ L +V V     +N    I + +   E +L    R+++R SGTE
Sbjct: 364 GKPLSELAGVMTALPQVLINVRVASRQDINIVPEIARTVKAVEEKLADTGRVLIRYSGTE 423

Query: 418 SLIRIMAEGDDLSRIKRIVDDLAKVIP 444
            L+RIM EG D + I  +  ++A VI 
Sbjct: 424 PLLRIMLEGQDEAEITGLAQEIADVIE 450


>gi|227524773|ref|ZP_03954822.1| phosphomannomutase [Lactobacillus hilgardii ATCC 8290]
 gi|227088080|gb|EEI23392.1| phosphomannomutase [Lactobacillus hilgardii ATCC 8290]
          Length = 449

 Score =  270 bits (689), Expect = 4e-70,   Method: Composition-based stats.
 Identities = 175/446 (39%), Positives = 271/446 (60%), Gaps = 7/446 (1%)

Query: 4   RFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLF--RGKKKHRRVVIGKDTRLSGYMLENS 61
           ++FGTDG+RG +N   +TP    + G A GY+     ++K  +V++ +DTR+SG ML+ +
Sbjct: 2   KYFGTDGVRGIANK-ELTPELAFQCGRAGGYVLTHHSERKQPQVLVARDTRISGQMLQEA 60

Query: 62  LVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKV 121
           L+AG  + G++   LG I +P VA L R+  AD GVMI+ASHNP + NGIK FG DGYK+
Sbjct: 61  LIAGLLSVGIEVLNLGIITTPGVAYLVRNQGADAGVMITASHNPVEYNGIKFFGADGYKL 120

Query: 122 STDIEDRIETLLE-DDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           S ++E+ IET+LE  +        + +G          +YI  +++T+     L G+++ 
Sbjct: 121 SDEMEEEIETILERQEDILPRPAAEGLGVVGDYFEGSQKYIHFLEQTISE--DLSGIKVC 178

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           VD ANG++ K+   ++ +LG D   +   P+G+NIN   GST+  +LQ+ V E     GI
Sbjct: 179 VDSANGSTSKLVTTLYADLGIDFETLATTPDGLNINDHVGSTHPENLQKMVVEKGVQAGI 238

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           A DGDGDR I VDE G +V+GD IM +  +       L+ N IVTT+MSN+G+ + +   
Sbjct: 239 AFDGDGDRCIAVDENGQLVDGDAIMYICGKYMAERGRLKKNTIVTTIMSNLGMYKAMERA 298

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           G++  +T+VGDRY++E M  +G+N+GGEQSGHI+  D+ +TGDG++ ++Q+L  +K   K
Sbjct: 299 GMTSVKTQVGDRYVVEKMNADGYNLGGEQSGHIVFLDFNTTGDGMLTSIQLLSVMKSTGK 358

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTSI-LNSSSIVQAIADAESELRGIDRLIVRASGTESL 419
            +S +    ++YPQ L +V V+D    L +  I  AI + E E+ G  R++VR SGTE L
Sbjct: 359 KLSELASEIKKYPQRLINVKVRDKKDGLQNEKIQAAIKEVEEEMHGDGRVLVRPSGTEPL 418

Query: 420 IRIMAEGDDLSRIKRIVDDLAKVIPM 445
           +R+M E      +      +A V+  
Sbjct: 419 LRVMTEAPTQDLVDEYTQKIADVVRE 444


>gi|257465213|ref|ZP_05629584.1| phosphoglucosamine mutase [Actinobacillus minor 202]
 gi|257450873|gb|EEV24916.1| phosphoglucosamine mutase [Actinobacillus minor 202]
          Length = 443

 Score =  270 bits (689), Expect = 4e-70,   Method: Composition-based stats.
 Identities = 194/445 (43%), Positives = 290/445 (65%), Gaps = 5/445 (1%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M R++FGTDG+RG+   FPITP F +++G A G +   +   ++V+IGKDTR+SGYMLE+
Sbjct: 1   MARKYFGTDGVRGEVGKFPITPEFALKLGWAAGKVLATQG-TKKVLIGKDTRISGYMLES 59

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +L AG TAAG+ A  +GP+P+PA+A LTR+ RA+ G++ISASHNPY DNGIK F   G K
Sbjct: 60  ALEAGLTAAGLSAVFVGPMPTPAIAYLTRTFRAEAGIVISASHNPYYDNGIKFFSAVGEK 119

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +  ++E+ IE +L++ +        ++G A R++    RYIE  K   P  ++L+G +IV
Sbjct: 120 LPDEVEEAIEAMLDEPMD--CVDSANLGKASRINDAAGRYIEFCKAGFPSHLSLEGYKIV 177

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           VDCANGA+Y +AP V  ELGA+V+ IG  PNG+NIN  CG+T++ +LQ+ V E  ADIG+
Sbjct: 178 VDCANGATYHIAPNVMRELGAEVIEIGTHPNGLNINEKCGATDIKALQKVVVEAGADIGL 237

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           A DGDGDR+++VD  G  V+GDQI+ ++ARE +    L+G  + T  MSN+ LE  +  L
Sbjct: 238 AYDGDGDRIMMVDHLGNKVDGDQILFILAREALRAGKLQGGVVGTL-MSNMSLEIALKEL 296

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
            +   R  VGDRY++E +K  G+ +GGE SGHII+ D  +TGDG++A+L+VL  +  +  
Sbjct: 297 AIPFSRANVGDRYVLEQLKEKGWKLGGENSGHIIVLDKNTTGDGIIASLEVLAAMVSHKM 356

Query: 361 PVSTICHCFEEYPQFLRSVSVK-DTSILNSSSIVQAIADAESELRGIDRLIVRASGTESL 419
            ++ +      +PQ L +V      + L S  +       E  L G  R+++R SGTE L
Sbjct: 357 TLNELAKAVPLFPQVLINVRFSGGNNPLESEEVKAVAKAVEERLAGKGRILLRKSGTEPL 416

Query: 420 IRIMAEGDDLSRIKRIVDDLAKVIP 444
           IR+M E +D +  +   +++A+ + 
Sbjct: 417 IRVMVECEDGTLAQSCAEEIAEAVK 441


>gi|145298039|ref|YP_001140880.1| phosphoglucosamine mutase [Aeromonas salmonicida subsp. salmonicida
           A449]
 gi|158705794|sp|A4SJR0|GLMM_AERS4 RecName: Full=Phosphoglucosamine mutase
 gi|142850811|gb|ABO89132.1| phosphoglucosamine mutase [Aeromonas salmonicida subsp. salmonicida
           A449]
          Length = 444

 Score =  270 bits (689), Expect = 4e-70,   Method: Composition-based stats.
 Identities = 205/445 (46%), Positives = 302/445 (67%), Gaps = 5/445 (1%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M R++FGTDG+RGK   FPITP+F+M++G A G +   KK  ++V+IGKDTR+SGYMLE+
Sbjct: 1   MARKYFGTDGVRGKVGEFPITPDFVMKLGWAAGKVL-SKKGTKKVLIGKDTRISGYMLES 59

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +L AG +AAG+ A ++GP+P+PAVA LTR+ RA+ G++ISASHNP+ DNGIK F  DG K
Sbjct: 60  ALEAGLSAAGLKAILMGPMPTPAVAYLTRTFRAEAGIVISASHNPFYDNGIKFFSADGTK 119

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +  D+E  IE  L+ ++         +G A R++    RYIE  K T P +++L+GL++V
Sbjct: 120 LPDDVEMAIEAELDHEIK--CVESADLGKAVRIEDAAGRYIEFCKSTFPSNLSLEGLKMV 177

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           VDC NGA+Y +AP VF ELGA+V+ IG  P+G+NIN   GST   +L  KV E +AD+G+
Sbjct: 178 VDCGNGATYHIAPSVFRELGAEVIAIGCSPDGLNINDGVGSTAPDALAAKVLECKADLGV 237

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           A DGDGDR+++VD  G I++GD+I+ +IAR+ + +  L+G  + T  M+N+GLE  +  L
Sbjct: 238 AFDGDGDRLVMVDHTGYIIDGDEILYIIARDALRNGRLKGGVVGTL-MANMGLELALQTL 296

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           G+   R +VGDRY++E M   G+ +GGE SGHII  D  +TGDG+VAALQVL  I   + 
Sbjct: 297 GIPFARAKVGDRYVLEMMNEKGWRIGGENSGHIICLDQTTTGDGIVAALQVLMAICTAEM 356

Query: 361 PVSTICHCFEEYPQFLRSVSVKD-TSILNSSSIVQAIADAESELRGIDRLIVRASGTESL 419
           P++ +     ++PQ L +V   +    L + ++ Q +A  E EL G  R+++R SGTE L
Sbjct: 357 PLAKLRSGMSKFPQVLVNVRFAEGKDPLAADAVNQEVAKVEQELAGRGRVLLRKSGTEPL 416

Query: 420 IRIMAEGDDLSRIKRIVDDLAKVIP 444
           IR+M EG+   +++ +   +A+ + 
Sbjct: 417 IRVMVEGEHEQQVRDMAQRIAQQVE 441


>gi|329113824|ref|ZP_08242595.1| Phosphoglucosamine mutase [Acetobacter pomorum DM001]
 gi|326696834|gb|EGE48504.1| Phosphoglucosamine mutase [Acetobacter pomorum DM001]
          Length = 452

 Score =  270 bits (689), Expect = 4e-70,   Method: Composition-based stats.
 Identities = 233/448 (52%), Positives = 320/448 (71%), Gaps = 2/448 (0%)

Query: 1   MKR--RFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYML 58
           M R  RFFGTDGIRG +N  P+T     ++G A G  F+       V++GKDTRLSGYM+
Sbjct: 1   MSRMKRFFGTDGIRGTANVAPMTVEIAQKLGQAAGLHFKRGDHRHSVLLGKDTRLSGYMI 60

Query: 59  ENSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDG 118
           E+++V+GF +AGMD  ++GP+P+PA+AMLTRSLRAD+GVMISASHNP+ DNGIKLFGPDG
Sbjct: 61  ESAMVSGFLSAGMDVTLVGPLPTPAIAMLTRSLRADLGVMISASHNPFGDNGIKLFGPDG 120

Query: 119 YKVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLR 178
           +K+S   E  IE L+E DLT+YL+  + IG A R++    RYIE  K + PR + L G++
Sbjct: 121 FKLSDQDESEIEALMEKDLTAYLATPEHIGRASRLNDAAGRYIESAKASFPRKLRLDGMK 180

Query: 179 IVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADI 238
           IV+DCANG++Y+VAP   WELGA+V+ IG +PNG+NIN  CGST+  +L   V + +AD+
Sbjct: 181 IVIDCANGSAYRVAPTALWELGAEVIRIGCEPNGVNINEKCGSTHPEALCAAVVKHKADL 240

Query: 239 GIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIA 298
           GIALDGD DRV+I DE G +++GDQI+ALIA+ W     L G  +V TVMSN+GLERF+ 
Sbjct: 241 GIALDGDADRVLIADETGRLIDGDQILALIAQSWAREGRLVGKAVVATVMSNMGLERFLE 300

Query: 299 GLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQY 358
            LGL+L+RT VGDRY++E M     N+GGEQSGH++L+D+ +TGDGL+AALQ+L  + Q 
Sbjct: 301 NLGLNLERTAVGDRYVVERMLERQANIGGEQSGHMVLTDFATTGDGLIAALQILAVLVQD 360

Query: 359 DKPVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTES 418
            +P S +C  F+ +PQ L++V  K    L+   +    AD E +L G  RL++R SGTE 
Sbjct: 361 GRPASEVCRLFQPFPQKLKNVRYKGVCPLDVDEVKSRQADVERKLAGRGRLVLRKSGTEP 420

Query: 419 LIRIMAEGDDLSRIKRIVDDLAKVIPMI 446
           L+R+MAE +D + +  +VD +  V+  +
Sbjct: 421 LVRVMAEAEDANLVDEVVDQMCDVLEQV 448


>gi|227510613|ref|ZP_03940662.1| phosphomannomutase [Lactobacillus brevis subsp. gravesensis ATCC
           27305]
 gi|227190265|gb|EEI70332.1| phosphomannomutase [Lactobacillus brevis subsp. gravesensis ATCC
           27305]
          Length = 449

 Score =  270 bits (689), Expect = 4e-70,   Method: Composition-based stats.
 Identities = 176/446 (39%), Positives = 270/446 (60%), Gaps = 7/446 (1%)

Query: 4   RFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLF--RGKKKHRRVVIGKDTRLSGYMLENS 61
           ++FGTDG+RG +N   +TP    + G A GY+     ++K  +V++ +DTR+SG ML+ +
Sbjct: 2   KYFGTDGVRGIANK-ELTPELAFQCGRAGGYVLTHHSERKQPQVLVARDTRISGQMLQEA 60

Query: 62  LVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKV 121
           L+AG  + G++   LG I +P VA L R+  AD GVMI+ASHNP + NGIK FG DGYK+
Sbjct: 61  LIAGLLSVGIEVLNLGIITTPGVAYLVRNQGADAGVMITASHNPVEYNGIKFFGADGYKL 120

Query: 122 STDIEDRIETLLE-DDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           S ++E+ IE +LE  +        + +G          +YI  +++T+     L G+++ 
Sbjct: 121 SDEMEEEIEAILERQEDILPRPAAEGLGVVGDYFEGSQKYIHFLEQTISE--DLSGIKVC 178

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           VD ANG++ K+   ++ +LG D   +   P+G+NIN   GST+  +LQ+ V E     GI
Sbjct: 179 VDSANGSTSKLVTTLYADLGIDFETLATTPDGLNINDHVGSTHPENLQKMVVEKGVQAGI 238

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           A DGDGDR I VDE G +V+GD IM +  +       L+ N IVTTVMSN+G+ + +   
Sbjct: 239 AFDGDGDRCIAVDENGQLVDGDAIMYICGKYMAERGRLKKNTIVTTVMSNLGMYKAMERA 298

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           G++  +T+VGDRY++E M  +G+N+GGEQSGHI+  D+ +TGDG++ +LQ+L  +K   K
Sbjct: 299 GMTSVKTQVGDRYVVEKMNADGYNLGGEQSGHIVFLDFNTTGDGMLTSLQLLSVMKSTGK 358

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTSI-LNSSSIVQAIADAESELRGIDRLIVRASGTESL 419
            +S +    ++YPQ L +V V+D    L +  I  AI + E E+ G  R++VR SGTE L
Sbjct: 359 KLSELASEIKKYPQRLINVKVRDKKDGLQNEKIQAAIKEVEEEMHGDGRVLVRPSGTEPL 418

Query: 420 IRIMAEGDDLSRIKRIVDDLAKVIPM 445
           +R+M E      +      +A V+  
Sbjct: 419 LRVMTEAPTQDLVDEYTQKIADVVRE 444


>gi|119774093|ref|YP_926833.1| phosphoglucosamine mutase [Shewanella amazonensis SB2B]
 gi|158705789|sp|A1S457|GLMM1_SHEAM RecName: Full=Phosphoglucosamine mutase 1
 gi|119766593|gb|ABL99163.1| phosphoglucosamine mutase [Shewanella amazonensis SB2B]
          Length = 445

 Score =  270 bits (689), Expect = 4e-70,   Method: Composition-based stats.
 Identities = 203/445 (45%), Positives = 301/445 (67%), Gaps = 5/445 (1%)

Query: 2   KRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENS 61
           +R+FFGTDGIRGK     +TP   +++G A G +   +   ++V+IGKDTR+SGYM E++
Sbjct: 3   QRKFFGTDGIRGKVGADQMTPELALKLGWAAGRVL-ARTGTKKVIIGKDTRISGYMFESA 61

Query: 62  LVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKV 121
           L AGF++AG++  ++GP+P+PAVA LTR+ RA+ GV+ISASHNPY DNGIK F  DG K+
Sbjct: 62  LEAGFSSAGLNVLLMGPMPTPAVAYLTRTFRAEAGVVISASHNPYYDNGIKFFSNDGSKL 121

Query: 122 STDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVV 181
             +IE  IE  LE  L    S +  +G   R+D    RYIE+ K   P D TL GL+IVV
Sbjct: 122 DDEIELAIEAELEKPLICAESQF--LGKVSRIDDARGRYIEYCKGNFPADQTLSGLKIVV 179

Query: 182 DCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIA 241
           DCA+GA+Y +AP VF ELGA+VV IG +PNG+NIN  CG+T++ +++ KV EV AD+GIA
Sbjct: 180 DCAHGATYHIAPAVFRELGAEVVAIGVEPNGMNINDKCGATSMGAIRDKVLEVNADLGIA 239

Query: 242 LDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLG 301
           LDGDGDR+++V ++G I++GDQI+ ++A +      L   G+V T M+N+GLE  +   G
Sbjct: 240 LDGDGDRIMMVTQEGDIIDGDQILYILALDAKER-GLLKGGVVGTQMANLGLELALKDEG 298

Query: 302 LSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKP 361
           +   R++VGDRY+ME +K  G+ +GGE SGHI+  D+G+TGDG+VA + VL  +++  K 
Sbjct: 299 IPFARSKVGDRYVMELLKELGWRIGGENSGHILNLDHGTTGDGIVAGILVLAAMRRSGKG 358

Query: 362 VSTICHCFEEYPQFLRSVSVK-DTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
           +  +    + +PQ L +V  + D + L + ++   +A+ E EL    R+++R SGTE L+
Sbjct: 359 LQQLIAKLKMFPQVLVNVRFEGDKNPLEADTVTAKVAEVERELGERGRVLLRKSGTEPLL 418

Query: 421 RIMAEGDDLSRIKRIVDDLAKVIPM 445
           R+M EG+D   + R+ + +A  +  
Sbjct: 419 RVMVEGEDKETVTRLANAIADAVKA 443


>gi|227513628|ref|ZP_03943677.1| phosphomannomutase [Lactobacillus buchneri ATCC 11577]
 gi|227083144|gb|EEI18456.1| phosphomannomutase [Lactobacillus buchneri ATCC 11577]
          Length = 449

 Score =  269 bits (688), Expect = 4e-70,   Method: Composition-based stats.
 Identities = 177/446 (39%), Positives = 271/446 (60%), Gaps = 7/446 (1%)

Query: 4   RFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLF--RGKKKHRRVVIGKDTRLSGYMLENS 61
           ++FGTDG+RG +N   +TP    + G A GY+     ++K  +V++ +DTR+SG ML+ +
Sbjct: 2   KYFGTDGVRGIANK-ELTPELAFQCGRAGGYVLTHHSERKQPQVLVARDTRISGQMLQEA 60

Query: 62  LVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKV 121
           L+AG  + G++   LG I +P VA L R+  AD GVMI+ASHNP + NGIK FG DGYK+
Sbjct: 61  LIAGLLSVGIEVLNLGIITTPGVAYLVRNQGADAGVMITASHNPVEYNGIKFFGADGYKL 120

Query: 122 STDIEDRIETLLE-DDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           S ++E+ IET+LE  +        + +G          +YI  +++T+     L G+++ 
Sbjct: 121 SDEMEEEIETILERQEDILPRPAAEGLGVVGDYFEGSQKYIHFLEQTISE--DLSGIKVC 178

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           VD ANG++ K+   ++ +LG D   +   P+G+NIN   GST+  +LQ+ V E     GI
Sbjct: 179 VDSANGSTSKLVTTLYADLGIDFETLATTPDGLNINDHVGSTHPENLQKMVVEKGVQAGI 238

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           A DGDGDR I VDE G +V+GD IM +  +       L+ N IVTTVMSN+G+ + +   
Sbjct: 239 AFDGDGDRCIAVDENGQLVDGDAIMYICGKYMAERGRLKKNTIVTTVMSNLGMYKAMERA 298

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           G++  +T+VGDRY++E M  +G+N+GGEQSGHI+  D+ +TGDG++ +LQ+L  +K   K
Sbjct: 299 GMTSVKTQVGDRYVVEKMNADGYNLGGEQSGHIVFLDFNTTGDGMLTSLQLLSVMKSTGK 358

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTSI-LNSSSIVQAIADAESELRGIDRLIVRASGTESL 419
            +S +    ++YPQ L +V V+D    L +  I  AI + E E+ G  R++VR SGTE L
Sbjct: 359 KLSELASEIKKYPQRLINVKVRDKKDGLQNEKIQAAIKEVEEEMHGDGRVLVRPSGTEPL 418

Query: 420 IRIMAEGDDLSRIKRIVDDLAKVIPM 445
           +R+M E      +      +A V+  
Sbjct: 419 LRVMTEAPTQDLVDEYTQKIADVVRE 444


>gi|254479657|ref|ZP_05092958.1| phosphoglucosamine mutase [Carboxydibrachium pacificum DSM 12653]
 gi|214034411|gb|EEB75184.1| phosphoglucosamine mutase [Carboxydibrachium pacificum DSM 12653]
          Length = 447

 Score =  269 bits (688), Expect = 5e-70,   Method: Composition-based stats.
 Identities = 202/447 (45%), Positives = 276/447 (61%), Gaps = 7/447 (1%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M R  FGTDG+RG +N   +TP     +G A  Y+        +VV+GKD+R+S  MLE 
Sbjct: 1   MGR-LFGTDGVRGIANK-ELTPQLAFELGRAGAYVLTEGSHRPKVVVGKDSRISSDMLEC 58

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +L+AG T+ G +   +G IP+PAVA LTR  +AD GVMISASHNP + NGIK F   GYK
Sbjct: 59  ALIAGLTSLGAEVVSVGIIPTPAVAYLTRLYKADAGVMISASHNPIEYNGIKFFDKFGYK 118

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +   +EDRIE ++ +     +     IG  K     H  YIE +K T+     L+GL+IV
Sbjct: 119 LPDKLEDRIEEIINEKKELPVPTGIGIGRRKESLTSHRDYIEFLKSTID--TDLKGLKIV 176

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           +DCA GAS  VAP +F ELGA+V+    +P G  IN+ CGST+   LQ+ V E +AD+G+
Sbjct: 177 IDCAYGASSTVAPILFKELGAEVIAYAAEPLGEKINVGCGSTHPEKLQQLVVEHKADLGL 236

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           A DGD DR+I VDEKG IV+GD IMA+ A +  S   L+ N +V TVMSNIG E  +   
Sbjct: 237 AFDGDADRLIAVDEKGNIVDGDHIMAICAIDMKSKGKLKHNTVVATVMSNIGFEIALKEH 296

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           G+ L RT+VGDRY++E M   G+++GGEQSGHII  D  +TGDG + AL++   +K   K
Sbjct: 297 GIKLIRTKVGDRYVLEEMIKGGYSIGGEQSGHIIFIDDNTTGDGEITALKLCSIMKHTGK 356

Query: 361 PVSTICHCFEEYPQFLRSVSVKD---TSILNSSSIVQAIADAESELRGIDRLIVRASGTE 417
            +S +  C   YPQ L +  VK+      L    I + I   E E+ G  R+++R SGTE
Sbjct: 357 KLSELASCMTTYPQVLVNAKVKNELKEKYLEDEDIKREIEKLEKEMEGKGRVLIRPSGTE 416

Query: 418 SLIRIMAEGDDLSRIKRIVDDLAKVIP 444
            LIR+M EG+D ++I ++  +LA +I 
Sbjct: 417 PLIRVMVEGEDYAKISQMAKELADLIE 443


>gi|218885167|ref|YP_002434488.1| phosphoglucosamine mutase [Desulfovibrio vulgaris str. 'Miyazaki
           F']
 gi|226722735|sp|B8DN76|GLMM_DESVM RecName: Full=Phosphoglucosamine mutase
 gi|218756121|gb|ACL07020.1| phosphoglucosamine mutase [Desulfovibrio vulgaris str. 'Miyazaki
           F']
          Length = 450

 Score =  269 bits (687), Expect = 6e-70,   Method: Composition-based stats.
 Identities = 213/447 (47%), Positives = 311/447 (69%), Gaps = 2/447 (0%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M +R FGTDG+RG+ N +P+T +  +R+G+A G  FR   +  RVVIGKDTRLSGY+ E+
Sbjct: 1   MGKRLFGTDGLRGQVNIYPMTADVALRLGLAAGTHFRNGNRRHRVVIGKDTRLSGYVFES 60

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +L AG  AAGMD +++GP+P+PA+A LTR++RAD+GV+ISASHNP+ DNGIK F  DG+K
Sbjct: 61  ALTAGLCAAGMDVYLVGPLPTPAIAFLTRNMRADLGVVISASHNPFMDNGIKFFDKDGFK 120

Query: 121 VSTDIEDRI-ETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRI 179
           +  ++E++I + +L+ D        + +G A +++    RYI ++K + P  +TL G+R+
Sbjct: 121 LPDEMENKITDMVLDPDWQWDYPAPERVGRAAKIEDSPGRYIVYLKNSFPAHLTLDGMRV 180

Query: 180 VVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIG 239
           V+DCANGA+YKVAP    ELGA+V+ IG +PNG+NIN  CGS        KV E RAD+G
Sbjct: 181 VLDCANGANYKVAPLALEELGAEVIKIGTEPNGLNINHQCGSLYPGVAAGKVLETRADVG 240

Query: 240 IALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAG 299
           +ALDGD DR+I+VDEKG +++GDQIMAL A + +    LR N +V TVMSN+ LE ++  
Sbjct: 241 LALDGDADRLIVVDEKGTVLDGDQIMALCADDMLRRGALRNNTLVATVMSNMALEVYMKE 300

Query: 300 LGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYD 359
            G  L RT VGDRY++E M+  G N+GGEQSGH+I  D+G+TGDGL+AALQ+LR +++ D
Sbjct: 301 RGCKLLRTPVGDRYVVEAMRREGANLGGEQSGHLIFMDHGTTGDGLMAALQILRIMRERD 360

Query: 360 KPVSTICHCFEEYPQFLRSVSVKDTSILNS-SSIVQAIADAESELRGIDRLIVRASGTES 418
           +P+S +    + +PQ L +V V+          ++  +A  E+EL    R+++R SGTE+
Sbjct: 361 RPLSELAGQLQLFPQELINVHVERKIPFEQCQPVLDGVAKVEAELGDRGRVLLRYSGTEA 420

Query: 419 LIRIMAEGDDLSRIKRIVDDLAKVIPM 445
           + R+M EG+D  ++KR+   LA+ +  
Sbjct: 421 VCRVMVEGEDPEQVKRLASLLAETVQK 447


>gi|75377913|sp|Q70GH6|GLMM_NEISU RecName: Full=Phosphoglucosamine mutase
 gi|34481903|emb|CAE46488.1| phosphoglucomutase/phosphomannomutase family protein [Neisseria
           subflava]
          Length = 445

 Score =  269 bits (687), Expect = 7e-70,   Method: Composition-based stats.
 Identities = 199/445 (44%), Positives = 293/445 (65%), Gaps = 6/445 (1%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKH--RRVVIGKDTRLSGYML 58
           M +++FGTDG+RG+   FPITP+F++++G A G +           V+IGKDTR+SGYML
Sbjct: 1   MAKKYFGTDGVRGEVGQFPITPDFVLKLGYAAGQVLVQHDGGQKPTVLIGKDTRISGYML 60

Query: 59  ENSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDG 118
           E +LVAGFTAAG++    GP+P+P VA LTR+LR   GVMISASHN Y DNGIK F   G
Sbjct: 61  EAALVAGFTAAGVNVIQTGPLPTPGVAYLTRALRLSAGVMISASHNVYSDNGIKFFAEGG 120

Query: 119 YKVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLR 178
            K+S +IE  IE  +++++ +       +G A+R++G  DRYIE  K T P  + L+GL+
Sbjct: 121 VKLSDEIELEIEAKIDEEMKTQP--SARLGRARRINGADDRYIEFCKSTFPSHLDLRGLK 178

Query: 179 IVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADI 238
           +VVD A+GA Y VAP+VF ELGA VV IGD+PNG NIN  CG+T+  +LQ  V +  AD 
Sbjct: 179 LVVDTAHGAGYDVAPKVFHELGAQVVSIGDEPNGYNINEKCGATHPKALQAAVLQNEADY 238

Query: 239 GIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIA 298
           GIALDGDGDR+++VD  G + +GD ++ +IA+   +   +   G+V TVM+N+ +E  + 
Sbjct: 239 GIALDGDGDRLMMVDRNGKVYDGDSLIYVIAK-ARAREGINIGGVVGTVMTNMAMEIALK 297

Query: 299 GLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQY 358
             G+   R +VGDRY++E +   G+ +GGE SGHI+  D  +TGDG+++ALQVL  ++  
Sbjct: 298 EQGVDFCRAKVGDRYVLEQLNQRGWLIGGEASGHILCMDKHNTGDGIISALQVLAALQML 357

Query: 359 DKPVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTES 418
           ++ ++TIC  ++ YPQ + +V ++       +S    +A+ E EL G  R+++RASGTE 
Sbjct: 358 NQDLATICADWQPYPQTMINVRIQKGQKWQEAS-KDVLAEVEKELEGKGRVVLRASGTEP 416

Query: 419 LIRIMAEGDDLSRIKRIVDDLAKVI 443
           ++R+M E       K+  + +A  I
Sbjct: 417 VVRVMVEARQADWAKKGAERIAAAI 441


>gi|91784535|ref|YP_559741.1| phosphoglucosamine mutase [Burkholderia xenovorans LB400]
 gi|123168243|sp|Q13W50|GLMM_BURXL RecName: Full=Phosphoglucosamine mutase
 gi|91688489|gb|ABE31689.1| phosphoglucosamine mutase [Burkholderia xenovorans LB400]
          Length = 452

 Score =  269 bits (687), Expect = 7e-70,   Method: Composition-based stats.
 Identities = 197/455 (43%), Positives = 287/455 (63%), Gaps = 10/455 (2%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRG------KKKHRRVVIGKDTRLS 54
           M RR+FGTDGIRGK    PITP F++R+G A G +  G            V+IGKDTR+S
Sbjct: 1   MARRYFGTDGIRGKVGEGPITPEFVLRLGYAAGKVLAGADRWAKTGTRPTVLIGKDTRVS 60

Query: 55  GYMLENSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLF 114
           GYMLE +L AGF+AAG+D  + GP+P+P +A LTR+LR   GV+ISASHNPY DNGIK F
Sbjct: 61  GYMLEAALEAGFSAAGVDVMLAGPMPTPGIAYLTRALRLAAGVVISASHNPYYDNGIKFF 120

Query: 115 GPDGYKVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTL 174
             DG K+  ++E +IE  L+  L    +  + +G A+R+D    RYIE  K T P    L
Sbjct: 121 SADGNKLPDEVEAQIEEQLDQPLA--CAASEQLGKARRLDDAAGRYIEFCKSTFPAAFDL 178

Query: 175 QGLRIVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEV 234
           +GL++VVDCA+GA+Y VAP VF ELGADV+ IG  PNG NIN   G+T   +L R V   
Sbjct: 179 RGLKLVVDCAHGAAYDVAPHVFHELGADVIPIGVAPNGFNINDGVGATAPDALVRAVRAN 238

Query: 235 RADIGIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLE 294
            AD+GIALDGD DR+ +VD  G + NGD+++ ++ ++ ++        + T  M+N+ +E
Sbjct: 239 HADLGIALDGDADRLQVVDAAGRLYNGDELLYILVKDRIATEGKVEGAVGTL-MTNMAVE 297

Query: 295 RFIAGLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRY 354
             +   G+   R  VGDRY++E ++ +G+ +G E SGHI+  D  STGDG+V+AL VL  
Sbjct: 298 VALQEAGVKFVRAAVGDRYVLEQLREHGWQLGAEGSGHILSLDRHSTGDGIVSALLVLAA 357

Query: 355 IKQYDKPVSTICHCFEEYPQFLRSVSVKDTSILNSSSIV-QAIADAESELRGIDRLIVRA 413
           +K+ DK ++ +      +PQ L +V +K  +    S ++ +AIA AE  L G  R+++RA
Sbjct: 358 MKRSDKTLAELLGGVTLFPQKLINVRMKPDADWKGSDVIRRAIAKAEDALNGRGRVLIRA 417

Query: 414 SGTESLIRIMAEGDDLSRIKRIVDDLAKVIPMIDS 448
           SGTE ++R+M E ++++   +  + +A  +    +
Sbjct: 418 SGTEPVLRVMVEAENVADAVQYAESIASAVKQATA 452


>gi|307294542|ref|ZP_07574384.1| phosphoglucosamine mutase [Sphingobium chlorophenolicum L-1]
 gi|306879016|gb|EFN10234.1| phosphoglucosamine mutase [Sphingobium chlorophenolicum L-1]
          Length = 446

 Score =  269 bits (687), Expect = 7e-70,   Method: Composition-based stats.
 Identities = 256/448 (57%), Positives = 324/448 (72%), Gaps = 2/448 (0%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M R++FGTDGIRG++N +P+T    M++G+A G  F+      RVVIGKDTRLSGYM+EN
Sbjct: 1   MSRKYFGTDGIRGRTNQWPMTAELAMKVGMAAGKHFQRGTHRHRVVIGKDTRLSGYMVEN 60

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +LVAGFTA GMD    GPIP+PAVA+L  S+RAD+GVMISASHNPY DNGIKLFGPDGYK
Sbjct: 61  ALVAGFTAVGMDVVQFGPIPTPAVALLAHSMRADLGVMISASHNPYFDNGIKLFGPDGYK 120

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +S + E +IE +LE D+   L+    IG A+RV+    RYI  VK + P D+ L GL+IV
Sbjct: 121 LSDEDEMKIEAMLEQDI--PLAASQDIGRARRVEDARGRYIHAVKSSFPADLRLDGLKIV 178

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           VDCANGA+Y+VAP   WELGA+VV IG  PNGININ  CGST+   LQ  V    ADIGI
Sbjct: 179 VDCANGAAYQVAPSALWELGAEVVAIGVTPNGININDRCGSTSPQLLQESVVSAGADIGI 238

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           ALDGD DR+I+VDE GAIV+GDQIMALIA  +     LRG G+V TVMSN+GLERF++G 
Sbjct: 239 ALDGDADRLIVVDEHGAIVDGDQIMALIAGNFAKAGTLRGGGLVATVMSNLGLERFLSGQ 298

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           G++L+RT+VGDRY++E M+  GFNVGGEQSGH+ILSDY +TGDG VAALQVL  + +  K
Sbjct: 299 GMALERTKVGDRYVLERMREGGFNVGGEQSGHMILSDYATTGDGTVAALQVLAALVRSGK 358

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
           P S + H F+  PQ L++V       L    + + IA AE+EL G  RL++R SGTE +I
Sbjct: 359 PASEVLHQFDPVPQLLKNVRFSGGKPLEHEDVKRVIAQAEAELNGSGRLVIRPSGTEPVI 418

Query: 421 RIMAEGDDLSRIKRIVDDLAKVIPMIDS 448
           R+MAEGD   ++K +V+ +   +    +
Sbjct: 419 RVMAEGDREDQVKDVVERICDAVAKAAA 446


>gi|20808573|ref|NP_623744.1| phosphomannomutase [Thermoanaerobacter tengcongensis MB4]
 gi|81480779|sp|Q8R840|GLMM_THETN RecName: Full=Phosphoglucosamine mutase
 gi|20517201|gb|AAM25348.1| Phosphomannomutase [Thermoanaerobacter tengcongensis MB4]
          Length = 447

 Score =  269 bits (686), Expect = 8e-70,   Method: Composition-based stats.
 Identities = 201/447 (44%), Positives = 275/447 (61%), Gaps = 7/447 (1%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M R  FGTDG+RG +N   +TP     +G A  Y+        +VV+GKD+R+S  MLE 
Sbjct: 1   MGR-LFGTDGVRGIANK-ELTPQLAFELGRAGAYVLTEGSHRPKVVVGKDSRISSDMLEC 58

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +L+AG T+ G +   +G IP+PAVA LTR  +AD GVMISASHNP + NGIK F   GYK
Sbjct: 59  ALIAGLTSLGAEVVSVGIIPTPAVAYLTRLYKADAGVMISASHNPIEYNGIKFFDKFGYK 118

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +   +EDRIE ++ +     +     IG  K     H  YIE +K T+     L+GL+IV
Sbjct: 119 LPDKLEDRIEEIINEKKELPVPTGIGIGRRKESLTSHRDYIEFLKSTID--TDLKGLKIV 176

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           +DCA GAS  VAP +F ELGA+V+    +  G  IN+ CGST+   LQ+ V E +AD+G+
Sbjct: 177 IDCAYGASSTVAPILFKELGAEVIAYAAELLGEKINVGCGSTHPEKLQQLVVEHKADLGL 236

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           A DGD DR+I VDEKG IV+GD IMA+ A +  S   L+ N +V TVMSNIG E  +   
Sbjct: 237 AFDGDADRLIAVDEKGNIVDGDHIMAICAIDMKSKGKLKHNTVVATVMSNIGFEIALKEH 296

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           G+ L RT+VGDRY++E M   G+++GGEQSGHII  D  +TGDG + AL++   +K   K
Sbjct: 297 GIKLIRTKVGDRYVLEEMIKGGYSIGGEQSGHIIFIDDNTTGDGEITALKLCSIMKHTGK 356

Query: 361 PVSTICHCFEEYPQFLRSVSVKD---TSILNSSSIVQAIADAESELRGIDRLIVRASGTE 417
            +S +  C   YPQ L +  VK+      L    I + I   E E+ G  R+++R SGTE
Sbjct: 357 KLSELASCMTTYPQVLVNAKVKNELKEKYLEDEDIKREIEKLEKEMEGKGRVLIRPSGTE 416

Query: 418 SLIRIMAEGDDLSRIKRIVDDLAKVIP 444
            LIR+M EG+D ++I ++  +LA +I 
Sbjct: 417 PLIRVMVEGEDYAKISQMAKELADLIE 443


>gi|85709355|ref|ZP_01040420.1| phosphomannomutase [Erythrobacter sp. NAP1]
 gi|85688065|gb|EAQ28069.1| phosphomannomutase [Erythrobacter sp. NAP1]
          Length = 445

 Score =  269 bits (686), Expect = 8e-70,   Method: Composition-based stats.
 Identities = 240/445 (53%), Positives = 320/445 (71%), Gaps = 2/445 (0%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M R+FFGTDGIRG++N   +T    M++G A G+ F       RVVIGKDTRLSGYM+E+
Sbjct: 1   MARKFFGTDGIRGRTNAGVMTAATAMKVGQAAGHYFVRGGHRHRVVIGKDTRLSGYMMES 60

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +LVAGFT+ GMD  + GP+P+PA+AMLTR +RAD+GVMISASHN + DNGIKLFGPDG+K
Sbjct: 61  ALVAGFTSVGMDVIMTGPLPTPAIAMLTREMRADLGVMISASHNLFPDNGIKLFGPDGFK 120

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +S + E  IE LL+ +    L   + IG A+R++    RY+  +K+++  D+   GL++V
Sbjct: 121 LSDEAESEIEALLDQE--PQLVEAEKIGRARRIEDARGRYLNAIKQSVGSDIRFDGLKVV 178

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           VDCA+GA+Y+VAP   WELGA+VV +G +PNGININ   GST + ++Q KV E  ADIGI
Sbjct: 179 VDCAHGAAYQVAPSAIWELGAEVVTLGVEPNGININDGVGSTAIEAVQAKVVEEGADIGI 238

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           ALDGD DR+I+VDEKG  V+GDQIMA IA        L G G+V TVMSN+GLER++ GL
Sbjct: 239 ALDGDADRLIVVDEKGRKVDGDQIMAAIATRMHEKGALTGGGVVATVMSNLGLERYLGGL 298

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           GL+L+RT+VGDRY++E MK  GFNVGGEQSGH+IL D+ +TGDG VAAL+V+  + +  K
Sbjct: 299 GLTLERTKVGDRYVLERMKEGGFNVGGEQSGHMILLDHATTGDGTVAALRVIASLVRSGK 358

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
           P S I H FE  PQ L++V     + L + ++   IA+ E EL G  RL++R SGTE +I
Sbjct: 359 PASEILHKFEPVPQLLKNVRYDAGAPLENKTVKAVIAEVEGELEGKGRLVIRPSGTEPVI 418

Query: 421 RIMAEGDDLSRIKRIVDDLAKVIPM 445
           R+MAEGDD S+++ +VD +   +  
Sbjct: 419 RVMAEGDDSSQVENVVDRVCDAVRA 443


>gi|58040124|ref|YP_192088.1| phosphoglucosamine mutase [Gluconobacter oxydans 621H]
 gi|81557002|sp|Q5FQB4|GLMM_GLUOX RecName: Full=Phosphoglucosamine mutase
 gi|58002538|gb|AAW61432.1| MrsA [Gluconobacter oxydans 621H]
          Length = 452

 Score =  269 bits (686), Expect = 8e-70,   Method: Composition-based stats.
 Identities = 246/446 (55%), Positives = 317/446 (71%), Gaps = 1/446 (0%)

Query: 2   KRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLF-RGKKKHRRVVIGKDTRLSGYMLEN 60
           KR  FGTDGIRG +NT P+T     R+G A G  F R + +   VV+GKDTRLSGYMLE 
Sbjct: 4   KRSLFGTDGIRGTANTAPMTVEIAQRLGQAAGLYFMRSQNRRHSVVLGKDTRLSGYMLEC 63

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +LVAGF +AGMD  ++GP+P+PA+AMLTRSLRAD+GVM+SASHNP+ DNGIKLFGPDG+K
Sbjct: 64  ALVAGFLSAGMDVILVGPLPTPAIAMLTRSLRADLGVMVSASHNPFTDNGIKLFGPDGFK 123

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +S ++E  IE L+  DL++ L+    IG A R+     RYIE+ K + PR + L GL+IV
Sbjct: 124 LSDEVEGEIEDLMSQDLSARLASPAQIGRASRLTDAAGRYIENAKASFPRGLRLDGLKIV 183

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           +DCANG++Y+VAP   WELGA+V+ IG  P+G+NIN   GST+  +L   V E  AD GI
Sbjct: 184 IDCANGSAYRVAPTALWELGAEVIKIGCSPDGLNINDGVGSTHPETLCAAVREHGADFGI 243

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           ALDGD DRV+I DE G +V+GDQI+ LIA  W  H  LRGN +VTTVMSN+GLE+ +A  
Sbjct: 244 ALDGDADRVLIADENGNLVDGDQIIGLIAAFWKQHDRLRGNTVVTTVMSNMGLEKALAEN 303

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           GL L+RT VGDRY++E M+  G N+GGEQSGH++LSDY +TGDGL+AALQVL    +  +
Sbjct: 304 GLELQRTAVGDRYVVERMREIGANLGGEQSGHMVLSDYATTGDGLIAALQVLAVSVETKR 363

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
           P S IC  F  YPQ L++V    TS ++S  +  A A A+  L G  RL++RASGTE LI
Sbjct: 364 PASEICRFFTPYPQLLKNVRYSGTSPMSSPDLAAAKAWADERLAGSGRLVLRASGTEPLI 423

Query: 421 RIMAEGDDLSRIKRIVDDLAKVIPMI 446
           R+MAE  D + +  +VD +  VI  I
Sbjct: 424 RVMAEAQDEALVHEVVDHVCDVIRAI 449


>gi|302381599|ref|YP_003817422.1| phosphoglucosamine mutase [Brevundimonas subvibrioides ATCC 15264]
 gi|302192227|gb|ADK99798.1| phosphoglucosamine mutase [Brevundimonas subvibrioides ATCC 15264]
          Length = 449

 Score =  269 bits (686), Expect = 8e-70,   Method: Composition-based stats.
 Identities = 246/445 (55%), Positives = 321/445 (72%), Gaps = 1/445 (0%)

Query: 2   KRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLF-RGKKKHRRVVIGKDTRLSGYMLEN 60
           +R++FGTDGIRGK+N  P+T    +R+G+A G LF  G  +   VVIGKDTRLSGYM+E 
Sbjct: 3   ERKYFGTDGIRGKANASPMTAEIALRVGLAAGKLFMSGDDRRHLVVIGKDTRLSGYMIEP 62

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +LVAGF + GMD    GPIP+P VAM+TRS+RAD+GVMISASHN Y DNGIKLFGPDGYK
Sbjct: 63  ALVAGFASVGMDVRTFGPIPTPGVAMMTRSMRADLGVMISASHNDYADNGIKLFGPDGYK 122

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +S +IE +IE L++  L   L+  + +G  KR+D    RYIE  K   PR ++L GLRI 
Sbjct: 123 LSDEIELKIEALMDAGLDEGLAPSNRLGRVKRIDDAPPRYIEIAKAAFPRHLSLSGLRIA 182

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           VDCANGA Y+VAP   +ELGA+V  +G  PNG NIN +CGST+  +L   V + RADIGI
Sbjct: 183 VDCANGAGYRVAPTTLFELGAEVCAVGVSPNGTNINAECGSTHPETLAAAVKQYRADIGI 242

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           ALDGD DR+I+ DE G +V+GDQIMALI R+W    +L+G G+V TVMSN+GLER +   
Sbjct: 243 ALDGDADRLIVCDENGKVVDGDQIMALIGRDWARRGVLKGGGVVATVMSNLGLERALKAD 302

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           GL+L+RT+VGDRY+ME M++ GFN+GGEQSGH+IL D+ +TGDGL+AALQVL  + +  K
Sbjct: 303 GLTLERTKVGDRYVMERMRSGGFNLGGEQSGHLILHDHATTGDGLMAALQVLAVMVESGK 362

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
           P+S +   F   PQ L++V       L  +++  AIA+ E+ L G  RL+VR SGTE LI
Sbjct: 363 PMSELARQFAPVPQLLQNVRFTGGKPLEDAAVKAAIAEGEAALNGSGRLLVRPSGTEKLI 422

Query: 421 RIMAEGDDLSRIKRIVDDLAKVIPM 445
           R+MAEGDD + +KR+V D++  +  
Sbjct: 423 RVMAEGDDGALVKRVVADVSAAVKA 447


>gi|117619850|ref|YP_857799.1| phosphoglucosamine mutase [Aeromonas hydrophila subsp. hydrophila
           ATCC 7966]
 gi|158705793|sp|A0KNE8|GLMM_AERHH RecName: Full=Phosphoglucosamine mutase
 gi|117561257|gb|ABK38205.1| phosphoglucosamine mutase [Aeromonas hydrophila subsp. hydrophila
           ATCC 7966]
          Length = 444

 Score =  269 bits (686), Expect = 9e-70,   Method: Composition-based stats.
 Identities = 206/445 (46%), Positives = 302/445 (67%), Gaps = 5/445 (1%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M R++FGTDG+RGK   +PITP+F+M++G A G +   KK  R+V+IGKDTR+SGYMLE+
Sbjct: 1   MARKYFGTDGVRGKVGEYPITPDFVMKLGWAAGKVL-SKKGTRKVLIGKDTRISGYMLES 59

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +L AG +AAG+ A ++GP+P+PAVA LTR+ RA+ G++ISASHNPY DNGIK F  DG K
Sbjct: 60  ALEAGLSAAGLKAILMGPMPTPAVAYLTRTFRAEAGIVISASHNPYYDNGIKFFSADGTK 119

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +  ++E  IE  L+ +L         +G A R+D    RYIE  K T P +++L+GL++V
Sbjct: 120 LPDEVEMAIEAELDHELK--CVESAELGKALRIDDAAGRYIEFCKSTFPSNLSLEGLKMV 177

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           VDC +GA+Y +AP VF ELGA+V+ IG  P+G+NIN   GST   +L  KV E +AD+G+
Sbjct: 178 VDCGHGATYHIAPSVFRELGAEVIAIGCSPDGLNINDGVGSTAPEALAAKVLECKADLGV 237

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           A DGDGDR+++VD  G I++GD+I+ +IAR+ + +  L+G  + T  M+N+GLE  +  L
Sbjct: 238 AFDGDGDRLVMVDNTGYIIDGDEILYIIARDALRNGRLKGGVVGTL-MANMGLELALQTL 296

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           G+   R +VGDRY++E M   G+ +GGE SGHII  D  +TGDG+VAALQVL  I   + 
Sbjct: 297 GIPFARAKVGDRYVLEMMNEKGWRIGGENSGHIICLDQTTTGDGIVAALQVLTAICTAEM 356

Query: 361 PVSTICHCFEEYPQFLRSVSVKD-TSILNSSSIVQAIADAESELRGIDRLIVRASGTESL 419
           P++ +     ++PQ L +V   +    L + ++ Q +A  E EL G  R+++R SGTE L
Sbjct: 357 PLAKLRSGMNKFPQVLVNVRFAEGRDPLAADAVQQEVAKVEQELAGRGRVLLRKSGTEPL 416

Query: 420 IRIMAEGDDLSRIKRIVDDLAKVIP 444
           IR+M EG+   +++ +   +A+ + 
Sbjct: 417 IRVMVEGEHEQQVRDMAQRIAQQVE 441


>gi|269797359|ref|YP_003311259.1| phosphoglucosamine mutase [Veillonella parvula DSM 2008]
 gi|269093988|gb|ACZ23979.1| phosphoglucosamine mutase [Veillonella parvula DSM 2008]
          Length = 450

 Score =  269 bits (686), Expect = 9e-70,   Method: Composition-based stats.
 Identities = 193/444 (43%), Positives = 270/444 (60%), Gaps = 3/444 (0%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M R  FGTDG+RG  N F +TP     +G A G  F  +K+H   +IG+DTR+SG MLE+
Sbjct: 1   MAR-LFGTDGVRGVVNEF-LTPELAYHLGRAAGTHFGKEKEHPTFLIGRDTRISGSMLES 58

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +L AG  + G +  I G IP+PAVA L R    D G +ISASHNPY DNGIK F  +GYK
Sbjct: 59  ALAAGICSVGGNVVIAGVIPTPAVAYLVRQQGFDAGAVISASHNPYPDNGIKFFDSNGYK 118

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +  ++ED +E  +     + L+     G  K     +  ++         D +L+GL IV
Sbjct: 119 LPDEVEDELEKYVRQSADNELARPTGNGIGKIEFNSNLAHLYAHFVRHTIDTSLEGLTIV 178

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
            D ANGA+  V PE+   LGA V+ I   P+G+NIN  CGST +  LQ  V +  AD+GI
Sbjct: 179 YDGANGAASSVGPEILSGLGAKVININVNPDGLNINHHCGSTYIEGLQVAVQQHNADLGI 238

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           A DGD DR ++VDEKG +++GDQIM L A +      L+G+ IV TVMSNIG  +    L
Sbjct: 239 ANDGDADRCLLVDEKGQVLDGDQIMLLCALKLKEEGKLKGDTIVGTVMSNIGFHKAAEEL 298

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           G+    T VGDRY++EYM+ +  ++GGEQSGH+I  D+ +TGDG++ A+QV   +K+  +
Sbjct: 299 GMKTVSTAVGDRYVLEYMREHNLSIGGEQSGHVIFLDHNTTGDGMLTAVQVAALMKEKKQ 358

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTS-ILNSSSIVQAIADAESELRGIDRLIVRASGTESL 419
           P+S +     +YPQ L +V V   +   ++  I  AI  AE EL    R++VRASGTE L
Sbjct: 359 PLSELAGIMTKYPQVLVNVRVATKTGWEDNDLIKAAIVTAEGELGDEGRVLVRASGTEPL 418

Query: 420 IRIMAEGDDLSRIKRIVDDLAKVI 443
           IR+MAEG D   ++ + +++A +I
Sbjct: 419 IRVMAEGPDQETLQSLCEEIADII 442


>gi|304310502|ref|YP_003810100.1| Phosphoglucosamine mutase [gamma proteobacterium HdN1]
 gi|301796235|emb|CBL44443.1| Phosphoglucosamine mutase [gamma proteobacterium HdN1]
          Length = 448

 Score =  268 bits (685), Expect = 1e-69,   Method: Composition-based stats.
 Identities = 200/447 (44%), Positives = 296/447 (66%), Gaps = 4/447 (0%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M +R+FGTDGIRG    FPITP+FM+++G A G +F G+    +++IGKDTR+SGYM E+
Sbjct: 1   MSKRYFGTDGIRGAVGQFPITPDFMLKLGWAAGKVFTGQHTRPKILIGKDTRVSGYMFES 60

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +L AG +AAG+D  +LGP+P+P +A LTR+ RA  G++ISASHNP+QDNGIK F  +G K
Sbjct: 61  TLEAGLSAAGVDVVLLGPMPTPGIAYLTRTFRAAAGIVISASHNPHQDNGIKFFSSEGKK 120

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +  +IE  IE +L+ ++T  +   + IG  ++++    RYIE  K T+PR++TL+GL+IV
Sbjct: 121 LDDNIEHAIERMLDAEMT--VVASEEIGKTRKLEDARGRYIEFCKSTMPRELTLKGLKIV 178

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           +DCANGA+Y VAP VF ELGA++V +G KPNG+NIN  CGST+  +LQ+ V E +AD+GI
Sbjct: 179 LDCANGATYHVAPSVFEELGAEIVTLGVKPNGLNINEKCGSTSPKTLQQAVLEHKADLGI 238

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           A DGDGDRV++VD     V     +  I     S     G G+V T+MSN GLE+ +  L
Sbjct: 239 AFDGDGDRVVMVDHD-GEVVDGDELLYIITYGRSVRGELGGGVVGTLMSNFGLEKALVRL 297

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
            +   R +VGDRY+ME +    + +GGE SGH++  D  +TGDG+++ALQVL  +    K
Sbjct: 298 DVPFVRAKVGDRYVMEQLSQRNWLLGGESSGHLVCLDKTTTGDGIISALQVLAVVIGTGK 357

Query: 361 PVSTICHCFEEYPQFLRSVSVKDT-SILNSSSIVQAIADAESELRGIDRLIVRASGTESL 419
           P++ +     + PQ + +V + +   I N  S+  A+AD E  L    R+++R SGTE +
Sbjct: 358 PLALLKRGMTKMPQTMINVRLPEKRDIANEPSVCAAVADVEKRLGSRGRVLLRPSGTEPV 417

Query: 420 IRIMAEGDDLSRIKRIVDDLAKVIPMI 446
           IR+M EG+D   +++    ++  +  +
Sbjct: 418 IRVMVEGEDAVEVQQFAQQISDTVRSV 444


>gi|296158193|ref|ZP_06841025.1| phosphoglucosamine mutase [Burkholderia sp. Ch1-1]
 gi|295891529|gb|EFG71315.1| phosphoglucosamine mutase [Burkholderia sp. Ch1-1]
          Length = 452

 Score =  268 bits (685), Expect = 1e-69,   Method: Composition-based stats.
 Identities = 197/455 (43%), Positives = 287/455 (63%), Gaps = 10/455 (2%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRG------KKKHRRVVIGKDTRLS 54
           M RR+FGTDGIRGK    PITP F++R+G A G +  G            V+IGKDTR+S
Sbjct: 1   MARRYFGTDGIRGKVGEGPITPEFVLRLGYAAGKVLAGADRWAKTGTRPTVLIGKDTRVS 60

Query: 55  GYMLENSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLF 114
           GYMLE +L AGF+AAG+D  + GP+P+P +A LTR+LR   GV+ISASHNPY DNGIK F
Sbjct: 61  GYMLEAALEAGFSAAGVDVMLAGPMPTPGIAYLTRALRLAAGVVISASHNPYYDNGIKFF 120

Query: 115 GPDGYKVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTL 174
             DG K+  ++E +IE  L+  L    +  + +G A+R+D    RYIE  K T P    L
Sbjct: 121 SADGNKLPDEVEAQIEEQLDQPLA--CAASEQLGKARRLDDAAGRYIEFCKSTFPAAFDL 178

Query: 175 QGLRIVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEV 234
           +GL++VVDCA+GA+Y VAP VF ELGADV+ IG  PNG NIN   G+T   +L R V   
Sbjct: 179 RGLKLVVDCAHGAAYDVAPHVFHELGADVIPIGVAPNGFNINDGVGATAPDALVRAVRAN 238

Query: 235 RADIGIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLE 294
            AD+GIALDGD DR+ +VD  G + NGD+++ ++ ++ ++        + T  M+N+ +E
Sbjct: 239 HADLGIALDGDADRLQVVDAAGRLYNGDELLYILVKDRIATEGKVEGAVGTL-MTNMAVE 297

Query: 295 RFIAGLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRY 354
             +   G+   R  VGDRY++E ++ +G+ +G E SGHI+  D  STGDG+V+AL VL  
Sbjct: 298 VALQEAGVKFVRAAVGDRYVLEQLREHGWQLGAEGSGHILSLDRHSTGDGIVSALLVLAA 357

Query: 355 IKQYDKPVSTICHCFEEYPQFLRSVSVKDTSILNSSSIV-QAIADAESELRGIDRLIVRA 413
           +K+ DK ++ +      +PQ L +V +K  +    S ++ +AIA AE  L G  R+++RA
Sbjct: 358 MKRSDKTLAELLGGVTLFPQKLINVRMKPGADWKGSDVIRRAIAKAEDALNGRGRVLIRA 417

Query: 414 SGTESLIRIMAEGDDLSRIKRIVDDLAKVIPMIDS 448
           SGTE ++R+M E ++++   +  + +A  +    +
Sbjct: 418 SGTEPVLRVMVEAENVADAVQYAESIASAVKQATA 452


>gi|121605503|ref|YP_982832.1| phosphoglucosamine mutase [Polaromonas naphthalenivorans CJ2]
 gi|158513870|sp|A1VQI3|GLMM_POLNA RecName: Full=Phosphoglucosamine mutase
 gi|120594472|gb|ABM37911.1| phosphoglucosamine mutase [Polaromonas naphthalenivorans CJ2]
          Length = 443

 Score =  268 bits (684), Expect = 1e-69,   Method: Composition-based stats.
 Identities = 189/445 (42%), Positives = 285/445 (64%), Gaps = 4/445 (0%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M R++FGTDGIRG     PITP+F++R+  AVG + R  +    V+IGKDTR+SGYMLE+
Sbjct: 1   MNRKYFGTDGIRGTVGEAPITPDFVLRLAHAVGRVLRRTEARPTVLIGKDTRISGYMLES 60

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +L +GF +AG+D  +LGP+P+P VA LTR+ RA +GV+ISASHNP+ DNGIK F   G K
Sbjct: 61  ALESGFNSAGVDVVLLGPLPTPGVAYLTRAQRASLGVVISASHNPFADNGIKFFSAQGNK 120

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           ++ + E  +E  L+++     +   S+G  +R+D    RYIE  K T   D+TL+GL+IV
Sbjct: 121 LNDEWEFEVEATLKEE--PVWADSASLGKTRRLDDAAGRYIEFCKSTFAHDLTLKGLKIV 178

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           VD A+GA+Y++AP VF ELGA+V+ IG  P+G+NIN   G+T+  +L   V   +AD GI
Sbjct: 179 VDGAHGAAYQIAPMVFHELGAEVIAIGCAPDGLNINDGVGATHPQALVNAVLANKADYGI 238

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           ALDGD DR+ +VD +G + NGD+++ L+  E +S        + T  M+N+ +E  +   
Sbjct: 239 ALDGDADRLQMVDAQGRLFNGDEVLYLMVNERLSRGEKVPGTVGTL-MTNMAVEVALKAK 297

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           G+   R +VGDRYI+E ++  G+ +GGE SGH++  D  +TGDGL++ALQVL+   + ++
Sbjct: 298 GVEFVRAKVGDRYILEELERRGWLLGGEGSGHMLALDKHTTGDGLISALQVLQACARSNQ 357

Query: 361 PVSTICHCFEEYPQFLRSVSVKD-TSILNSSSIVQAIADAESELRGIDRLIVRASGTESL 419
            ++ +      +PQ L +V +K      NS+ +      AE EL    R+++RASGTE L
Sbjct: 358 TLAQLLSEVVLFPQTLINVRLKPGQDWKNSAELAAQTKAAEIELGDSGRILIRASGTEPL 417

Query: 420 IRIMAEGDDLSRIKRIVDDLAKVIP 444
           +R+M E  D  + +   + +A  + 
Sbjct: 418 LRVMVEARDAEQARACAERVADAVR 442


>gi|152974002|ref|YP_001373519.1| phosphoglucosamine mutase [Bacillus cereus subsp. cytotoxis NVH
           391-98]
 gi|189040775|sp|A7GK66|GLMM_BACCN RecName: Full=Phosphoglucosamine mutase
 gi|152022754|gb|ABS20524.1| phosphoglucosamine mutase [Bacillus cytotoxicus NVH 391-98]
          Length = 448

 Score =  268 bits (684), Expect = 1e-69,   Method: Composition-based stats.
 Identities = 193/444 (43%), Positives = 277/444 (62%), Gaps = 5/444 (1%)

Query: 4   RFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSLV 63
           ++FGTDG+RG +N   +TP    +IG   GY+        +V+IG+DTR+SG+MLE +LV
Sbjct: 3   KYFGTDGVRGVANK-ELTPELAFKIGRFGGYVLTKDTNRPKVIIGRDTRVSGHMLEGALV 61

Query: 64  AGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVST 123
           AG  + G +   LG I +P VA LT++L A  GVMISASHNP QDNGIK FG DG+K++ 
Sbjct: 62  AGLLSIGAEVMRLGVISTPGVAYLTKALDAQAGVMISASHNPVQDNGIKFFGADGFKLTD 121

Query: 124 DIEDRIETLLEDDLTSYLSCYD-SIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVVD 182
           + E  IE LL+ ++         ++G          +Y++++K+T+  +    GL I +D
Sbjct: 122 EQEAEIEALLDKEVDELPRPIGTNLGQVNDYFEGGQKYLQYIKQTV--EEDFSGLHIALD 179

Query: 183 CANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIAL 242
           CA+GA+  +AP +F +L AD+  +G  PNG+NIN   GST+   L   V E  ADIG+A 
Sbjct: 180 CAHGATSSLAPYLFADLEADISTMGTSPNGMNINDGVGSTHPEGLAELVKEKGADIGLAF 239

Query: 243 DGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLGL 302
           DGDGDR+I VDEKG IV+GDQIM + A+       L+ N +V+TVMSN+G  + +   G+
Sbjct: 240 DGDGDRLIAVDEKGNIVDGDQIMYICAKYMKETGQLKHNTVVSTVMSNLGFYKALEANGI 299

Query: 303 SLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKPV 362
           +  +T VGDRY+ME MK  G+N+GGEQSGHII+ DY +TGDG+++ALQ++  +K   KP+
Sbjct: 300 TSDKTAVGDRYVMEEMKRGGYNLGGEQSGHIIMLDYITTGDGMLSALQLVNIMKVTKKPL 359

Query: 363 STICHCFEEYPQFLRSVSVKDTS-ILNSSSIVQAIADAESELRGIDRLIVRASGTESLIR 421
           S +    +++PQ L +V V D    L +  I + I   E E+ G  R++VR SGTE LIR
Sbjct: 360 SELASEMKKFPQLLVNVRVTDKKLALENEKIKEIIRVVEEEMNGDGRVLVRPSGTEPLIR 419

Query: 422 IMAEGDDLSRIKRIVDDLAKVIPM 445
           +MAE          V  +  V+  
Sbjct: 420 VMAEAPTQELCNEYVHRIVDVVKA 443


>gi|254362644|ref|ZP_04978733.1| phosphomannomutase [Mannheimia haemolytica PHL213]
 gi|261492886|ref|ZP_05989432.1| phosphomannomutase [Mannheimia haemolytica serotype A2 str. BOVINE]
 gi|261496764|ref|ZP_05993139.1| phosphomannomutase [Mannheimia haemolytica serotype A2 str. OVINE]
 gi|153094258|gb|EDN75129.1| phosphomannomutase [Mannheimia haemolytica PHL213]
 gi|261307603|gb|EEY08931.1| phosphomannomutase [Mannheimia haemolytica serotype A2 str. OVINE]
 gi|261311427|gb|EEY12584.1| phosphomannomutase [Mannheimia haemolytica serotype A2 str. BOVINE]
          Length = 444

 Score =  268 bits (684), Expect = 1e-69,   Method: Composition-based stats.
 Identities = 198/446 (44%), Positives = 294/446 (65%), Gaps = 6/446 (1%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M R++FGTDG+RG+   FPITP F +++G A G +   +   ++V+IGKDTR+SGYMLE+
Sbjct: 1   MARKYFGTDGVRGEVGKFPITPEFALKLGWAAGKVLATQG-TKKVLIGKDTRISGYMLES 59

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +L AG TAAG+ A  +GP+P+PA+A LTR+ RA+ G++ISASHNPY DNGIK F   G K
Sbjct: 60  ALEAGLTAAGLSAVFVGPMPTPAIAYLTRTFRAEAGIVISASHNPYYDNGIKFFSSVGEK 119

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +  +IE+ IE +L+  +        ++G A R++    RYIE  K T P +++L+G +IV
Sbjct: 120 LPDEIEEAIEAMLDKPMD--CVDSANLGRASRINDAAGRYIEFCKGTFPSELSLEGYKIV 177

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           VDCANGA+Y +AP V  ELGA+V+ IG KP+G+NIN  CG+T++ +LQ+ V E  AD+G+
Sbjct: 178 VDCANGATYHIAPNVMRELGAEVLEIGTKPDGLNINEKCGATDIKALQKVVVEAGADVGL 237

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           A DGDGDR+I+VD  G  V+GDQI+ ++ARE +    L+G  + T  MSN+ LE  +  L
Sbjct: 238 AYDGDGDRLIMVDHLGNKVDGDQILFILAREALRSGKLQGGVVGTL-MSNMSLELALKEL 296

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
            +   R  VGDRY++E +K  G+ +GGE SGHII+ D  +TGDG++A+LQVL  +  +  
Sbjct: 297 AIPFSRANVGDRYVLEQLKEKGWKLGGENSGHIIVLDKNTTGDGIIASLQVLAAMASHKL 356

Query: 361 PVSTICHCFEEYPQFLRSVSVKD--TSILNSSSIVQAIADAESELRGIDRLIVRASGTES 418
            ++ +      +PQ L +V  +    + L S+ +    AD E  L G  R+++R SGTE 
Sbjct: 357 SLNDLAKAVPLFPQVLLNVRFEKGAANPLESNEVKAVAADVEKRLAGKGRILLRKSGTEP 416

Query: 419 LIRIMAEGDDLSRIKRIVDDLAKVIP 444
           LIR+M E +D    +   +++ + + 
Sbjct: 417 LIRVMVECEDAVLAQSCAEEIVEAVK 442


>gi|300703816|ref|YP_003745418.1| phosphoglucosamine mutase [Ralstonia solanacearum CFBP2957]
 gi|299071479|emb|CBJ42801.1| phosphoglucosamine mutase [Ralstonia solanacearum CFBP2957]
          Length = 447

 Score =  268 bits (684), Expect = 2e-69,   Method: Composition-based stats.
 Identities = 190/450 (42%), Positives = 281/450 (62%), Gaps = 9/450 (2%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKK-----KHRRVVIGKDTRLSG 55
           M R++FGTDGIRG+    PITP+F++R+G A G +              V+IGKDTRLSG
Sbjct: 1   MSRKYFGTDGIRGRVGESPITPDFVLRLGYAAGRVLAHGGEAHGHGRPTVLIGKDTRLSG 60

Query: 56  YMLENSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFG 115
           YMLE +L AGFTAAG+D  + GP+P+P VA LTR+LR   GV+ISASHNPY DNGIK F 
Sbjct: 61  YMLEAALEAGFTAAGVDVLMSGPLPTPGVAYLTRALRLSAGVVISASHNPYYDNGIKFFS 120

Query: 116 PDGYKVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQ 175
             G K+  + E +IE  LE  +    +  D++G A+R+D    RYIE  K T P D+ L 
Sbjct: 121 ATGDKLPDETESQIEAELEKPME--YAASDALGRARRIDDAAGRYIEFCKSTFPNDLNLF 178

Query: 176 GLRIVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVR 235
           G++IV+D A+GA+Y +AP VF ELGADVV IG++PNG NIN   G+T    L     +  
Sbjct: 179 GMKIVLDSAHGAAYHIAPHVFHELGADVVSIGNQPNGRNINDGYGATAPAKLVEATRQHG 238

Query: 236 ADIGIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLER 295
           ADIG+A DGD DR+ +VD+ G + NGD+++ ++ +   +        + T  M+N+ +E 
Sbjct: 239 ADIGLAFDGDADRLQVVDKNGRLYNGDELLYVMVQARRAAGQAVPGAVGTL-MTNLAVEL 297

Query: 296 FIAGLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYI 355
            +   G+   R +VGDRY++E ++ +G+ +GGE SGH++  D  STGDG+++ALQVL  +
Sbjct: 298 ALKAQGVDFVRAKVGDRYVLEELRKHGWLLGGEGSGHLLCLDKHSTGDGIISALQVLAAL 357

Query: 356 KQYDKPVSTICHCFEEYPQFLRSVSV-KDTSILNSSSIVQAIADAESELRGIDRLIVRAS 414
           ++  + +  +    + +PQ L +V V K       +++  A+  +E+EL G  R+++R S
Sbjct: 358 RRSGQTLEQVLDGVQLFPQKLINVRVEKGFDWKAHAALQAALKVSEAELNGKGRVLIRPS 417

Query: 415 GTESLIRIMAEGDDLSRIKRIVDDLAKVIP 444
           GTE ++R+M E  D +   +  + LA  I 
Sbjct: 418 GTEPVVRVMVEAQDAALATKHAEQLAATIR 447


>gi|294012732|ref|YP_003546192.1| phosphoglucosamine mutase [Sphingobium japonicum UT26S]
 gi|292676062|dbj|BAI97580.1| phosphoglucosamine mutase [Sphingobium japonicum UT26S]
          Length = 446

 Score =  268 bits (684), Expect = 2e-69,   Method: Composition-based stats.
 Identities = 256/448 (57%), Positives = 323/448 (72%), Gaps = 2/448 (0%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M R +FGTDGIRG++N +P+T    M++G+A G  F+      RVVIGKDTRLSGYM+EN
Sbjct: 1   MSRTYFGTDGIRGRTNQWPMTAELAMKVGMAAGKHFKRGTHRHRVVIGKDTRLSGYMVEN 60

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +LVAGFTA GMD    GPIP+PAVA+L  S+RAD+GVMISASHNPY DNGIKLFGPDGYK
Sbjct: 61  ALVAGFTAVGMDVVQFGPIPTPAVALLAHSMRADLGVMISASHNPYFDNGIKLFGPDGYK 120

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +S + E +IE +LE ++   L+    IG A+RV+    RYI  VK + P D+ L GL+IV
Sbjct: 121 LSDEDEMKIEAMLEQEI--PLAASQDIGRARRVEDARGRYIHAVKSSFPADLRLDGLKIV 178

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           VDCANGA+Y+VAP  FWELGA+VV IG  PNGININ  CGST    LQ  V    ADIGI
Sbjct: 179 VDCANGAAYQVAPSAFWELGAEVVAIGVTPNGININDRCGSTAPQLLQESVVSAGADIGI 238

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           ALDGD DR+I+VDE GAIV+GDQIMALIA  +     LRG G+V TVMSN+GLERF++G 
Sbjct: 239 ALDGDADRLIVVDEHGAIVDGDQIMALIAGNFARAGTLRGGGLVATVMSNLGLERFLSGQ 298

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           G++L+RT+VGDRY++E M+  GFNVGGEQSGH+ILSDY +TGDG VAALQVL  + +  K
Sbjct: 299 GMALERTKVGDRYVLERMREGGFNVGGEQSGHMILSDYATTGDGTVAALQVLAALVRSGK 358

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
           P S + H F+  PQ L++V       L    + + IA AE+EL G  RL++R SGTE +I
Sbjct: 359 PASEVLHQFDPVPQLLKNVRFSGGKPLEHEDVKRVIAQAEAELNGSGRLVIRPSGTEPVI 418

Query: 421 RIMAEGDDLSRIKRIVDDLAKVIPMIDS 448
           R+MAEGD   ++K +V+ +   +    +
Sbjct: 419 RVMAEGDREDQVKDVVERICDAVAKAAA 446


>gi|207723998|ref|YP_002254396.1| phosphoglucosamine mutase (mrsa protein) [Ralstonia solanacearum
           MolK2]
 gi|206589206|emb|CAQ36168.1| phosphoglucosamine mutase (mrsa protein) [Ralstonia solanacearum
           MolK2]
          Length = 447

 Score =  268 bits (684), Expect = 2e-69,   Method: Composition-based stats.
 Identities = 191/450 (42%), Positives = 281/450 (62%), Gaps = 9/450 (2%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKK-----KHRRVVIGKDTRLSG 55
           M R++FGTDGIRG+    PITP+F++R+G A G +              V+IGKDTRLSG
Sbjct: 1   MSRKYFGTDGIRGRVGESPITPDFVLRLGYAAGRVLAHGGEAHGHGRPTVLIGKDTRLSG 60

Query: 56  YMLENSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFG 115
           YMLE +L AGFTAAG+D  + GP+P+P VA LTR+LR   GV+ISASHNPY DNGIK F 
Sbjct: 61  YMLEAALEAGFTAAGVDVLMSGPLPTPGVAYLTRALRLSAGVVISASHNPYYDNGIKFFS 120

Query: 116 PDGYKVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQ 175
             G K+  + E +IE  LE  +    +  D++G A+R+D    RYIE  K T P D+ L 
Sbjct: 121 ATGDKLPDETESQIEAELEKPME--YAASDALGRARRIDDAAGRYIEFCKSTFPNDLNLF 178

Query: 176 GLRIVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVR 235
           G++IV+D A+GA+Y +AP VF ELGADVV IG++PNG NIN   G+T    L     +  
Sbjct: 179 GMKIVLDSAHGAAYHIAPHVFHELGADVVSIGNQPNGRNINDGYGATAPAKLVEATRQHG 238

Query: 236 ADIGIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLER 295
           ADIG+A DGD DR+ +VD+ G + NGD+++ ++ +   +        + T  M+N+ +E 
Sbjct: 239 ADIGLAFDGDADRLQVVDKNGRLYNGDELLYVMVQARRAAGQAVPGAVGTL-MTNLAVEL 297

Query: 296 FIAGLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYI 355
            +   G+   R +VGDRY++E +K +G+ +GGE SGH++  D  STGDG+++ALQVL  +
Sbjct: 298 ALKAQGVDFVRAKVGDRYVLEELKKHGWLLGGEGSGHLLCLDKHSTGDGIISALQVLAAL 357

Query: 356 KQYDKPVSTICHCFEEYPQFLRSVSV-KDTSILNSSSIVQAIADAESELRGIDRLIVRAS 414
           ++  + +  +    + +PQ L +V V K       +++  A+  +E+EL G  R+++R S
Sbjct: 358 RRSGQTLEQVLDGVQLFPQKLINVRVEKGFDWKAHAALQAALKVSEAELNGKGRVLIRPS 417

Query: 415 GTESLIRIMAEGDDLSRIKRIVDDLAKVIP 444
           GTE ++R+M E  D +   +  + LA  I 
Sbjct: 418 GTEPVVRVMVEAQDAALATKHAEQLAATIR 447


>gi|241663314|ref|YP_002981674.1| phosphoglucosamine mutase [Ralstonia pickettii 12D]
 gi|240865341|gb|ACS63002.1| phosphoglucosamine mutase [Ralstonia pickettii 12D]
          Length = 447

 Score =  268 bits (684), Expect = 2e-69,   Method: Composition-based stats.
 Identities = 191/450 (42%), Positives = 280/450 (62%), Gaps = 9/450 (2%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKK-----KHRRVVIGKDTRLSG 55
           M R++FGTDGIRG+    PITP+F++R+G A G +              V+IGKDTRLSG
Sbjct: 1   MSRKYFGTDGIRGRVGESPITPDFVLRLGYAAGRVLAHGGEAHGHGRPTVLIGKDTRLSG 60

Query: 56  YMLENSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFG 115
           YMLE +L AGFTAAG+D  + GP+P+P VA LTR+LR   GV+ISASHNPY DNGIK F 
Sbjct: 61  YMLEAALEAGFTAAGVDVLMSGPLPTPGVAYLTRALRLSAGVVISASHNPYYDNGIKFFS 120

Query: 116 PDGYKVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQ 175
             G K+  + E +IE  LE  +    +  D++G A+R++    RYIE  K T P D+ L 
Sbjct: 121 ATGDKLPDETELQIEAELEKPMA--YAASDALGRARRIEDAAGRYIEFCKSTFPSDLNLF 178

Query: 176 GLRIVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVR 235
           G+++V+D A+GA+Y +AP VF ELGADVV IG++PNG NIN   G+T    L     E R
Sbjct: 179 GMKVVLDSAHGAAYHIAPHVFHELGADVVSIGNQPNGRNINDGYGATAPGKLVEATREHR 238

Query: 236 ADIGIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLER 295
           ADIG+A DGD DR+ +VD  G + NGD+++ ++ +   +        +  T M+N+ +E 
Sbjct: 239 ADIGLAFDGDADRLQVVDRNGRLYNGDELLYVMVQARRAAGQTVPGAVG-TFMTNLAVEL 297

Query: 296 FIAGLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYI 355
            +   G+   R +VGDRY++E +K NG+ +GGE SGH++  D  STGDG+++ALQVL  +
Sbjct: 298 ALKAQGVEFVRAKVGDRYVLEELKKNGWLLGGEGSGHLLCLDKHSTGDGIISALQVLAAL 357

Query: 356 KQYDKPVSTICHCFEEYPQFLRSVSV-KDTSILNSSSIVQAIADAESELRGIDRLIVRAS 414
           ++  + +  +      +PQ L +V V K     + +++  A+  +E+EL G  R+++R S
Sbjct: 358 RRSGQTLDEMLDGVRLFPQKLINVRVEKGFDWKSHAALQAALKTSEAELNGKGRVLIRPS 417

Query: 415 GTESLIRIMAEGDDLSRIKRIVDDLAKVIP 444
           GTE ++R+M E  D     +  + LA  + 
Sbjct: 418 GTEPVVRVMVEAQDAELANQHAERLAATLQ 447


>gi|149375760|ref|ZP_01893528.1| phosphoglucosamine mutase [Marinobacter algicola DG893]
 gi|149359885|gb|EDM48341.1| phosphoglucosamine mutase [Marinobacter algicola DG893]
          Length = 447

 Score =  268 bits (684), Expect = 2e-69,   Method: Composition-based stats.
 Identities = 208/447 (46%), Positives = 305/447 (68%), Gaps = 5/447 (1%)

Query: 1   MK-RRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLE 59
           M  R++FGTDGIRG+   +PITP FM+R+G A G  F+   +   V+IGKDTRLSGYM E
Sbjct: 1   MSDRKYFGTDGIRGRVGEYPITPEFMLRLGWAAGQAFKQDGQRNSVLIGKDTRLSGYMFE 60

Query: 60  NSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGY 119
           ++L AG +AAG+D  +LGP+P+PA+A LTR+ RA  G++ISASHNP+ DNGIK F P G 
Sbjct: 61  SALEAGLSAAGVDVKLLGPMPTPAIAYLTRTFRASAGIVISASHNPHHDNGIKFFSPAGT 120

Query: 120 KVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRI 179
           K+   +E  IE  L+  +   +     +G A RVD    RY+E  K T+P + +L+GL I
Sbjct: 121 KLDDALETEIEKWLDKPIE--VCGSKELGKAFRVDDAPGRYVEFCKSTVPNEFSLEGLHI 178

Query: 180 VVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIG 239
           V+DCA+GA+Y VAP+VF ELGA + V+G +P+G+NINL+ GST++ SL R V E +AD+G
Sbjct: 179 VLDCAHGATYHVAPKVFRELGAKISVVGGEPDGLNINLNVGSTHMESLSRAVLEKQADLG 238

Query: 240 IALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAG 299
           IA DGDGDRV++VD  G+ V+GD+++ +IA +  +       G+V T+M+N+G+E  +  
Sbjct: 239 IAFDGDGDRVLMVDRDGSEVDGDELLYVIAAQRHAA-GTLKGGVVGTLMTNLGVELALRE 297

Query: 300 LGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYD 359
            G+  +R +VGDRY+ME + + G+ +GGE SGH+++ D  STGDG+V+ALQVL  I++  
Sbjct: 298 QGIDFERAKVGDRYVMERLIDRGWLLGGEGSGHMVIRDCTSTGDGIVSALQVLLAIRRSG 357

Query: 360 KPVSTICHCFEEYPQFLRSVSVKDT-SILNSSSIVQAIADAESELRGIDRLIVRASGTES 418
             ++ +     + PQ + +V V      L    IV+A+  AE++L G  R+++RASGTE 
Sbjct: 358 SSLADLRQGMSKLPQKMINVRVDQRFDPLGREDIVRAVESAEAKLGGGGRVLLRASGTEP 417

Query: 419 LIRIMAEGDDLSRIKRIVDDLAKVIPM 445
           LIR+M EG D ++I +I ++LA V+  
Sbjct: 418 LIRVMTEGQDETQIVKIAEELAVVVEN 444


>gi|152980851|ref|YP_001353925.1| phosphoglucomutase/phosphomannomutase [Janthinobacterium sp.
           Marseille]
 gi|158705798|sp|A6T078|GLMM_JANMA RecName: Full=Phosphoglucosamine mutase
 gi|151280928|gb|ABR89338.1| phosphoglucomutase/phosphomannomutase [Janthinobacterium sp.
           Marseille]
          Length = 445

 Score =  267 bits (683), Expect = 2e-69,   Method: Composition-based stats.
 Identities = 194/449 (43%), Positives = 286/449 (63%), Gaps = 8/449 (1%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRR---VVIGKDTRLSGYM 57
           M R++FGTDG+RGK  T PITP+F+MR+G A G +    +K      V+IGKDTR+SGYM
Sbjct: 1   MTRQYFGTDGVRGKVGTSPITPDFVMRLGYAAGTVLTKSRKASSRPVVLIGKDTRISGYM 60

Query: 58  LENSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPD 117
           LE +L AGF+AAG+D  + GP+P+PA+A LTR+LR   GV+ISASHNPY+DNGIK F   
Sbjct: 61  LEAALEAGFSAAGVDVMLAGPMPTPAIAYLTRALRLSAGVVISASHNPYEDNGIKFFSAS 120

Query: 118 GYKVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGL 177
           G K+   IE  IE  L + ++      + +G AKR+D    RYIE  K T P ++ L+G 
Sbjct: 121 GNKLPDAIELEIEAALNEPMSCVA--SEKLGRAKRLDDARGRYIEFCKSTFPNELDLRGT 178

Query: 178 RIVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRAD 237
           ++VVDCA+GA+Y +AP+VF ELGA+V+ IG++PNG NIN   G+T   +L   V   +A 
Sbjct: 179 KLVVDCAHGAAYHIAPDVFHELGAEVIAIGNQPNGFNINEGYGATAPAALVEAVRANQAH 238

Query: 238 IGIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFI 297
           +GIALDGD DR+++VD  G + NGD+++ ++ ++ M    + G   V T+M+N+ LE   
Sbjct: 239 LGIALDGDADRLLVVDAAGRVYNGDELLYIMVKDRMRVRPIEGA--VGTLMTNMALEVAF 296

Query: 298 AGLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQ 357
             +G+   R  VGDRY++E ++  G+ VGGE SGH++  D  +TGDG+V+ALQ+L  +K+
Sbjct: 297 KEMGVGFARANVGDRYVLEVLRERGWQVGGEGSGHMLCLDKHTTGDGIVSALQILSALKR 356

Query: 358 YDKPVSTICHCFEEYPQFLRSVSVKD-TSILNSSSIVQAIADAESELRGIDRLIVRASGT 416
               ++ +    E +PQ L +V V+       +  ++      E+EL    R+++RASGT
Sbjct: 357 SGLSLAELTQDIEMFPQTLINVKVEPGFDWKKNKELLAEKEAVEAELGDKGRVLIRASGT 416

Query: 417 ESLIRIMAEGDDLSRIKRIVDDLAKVIPM 445
           E LIR+M E  D     ++   +A  +  
Sbjct: 417 EPLIRVMVEAKDADIADKMARRIAAKLSK 445


>gi|292493671|ref|YP_003529110.1| phosphoglucosamine mutase [Nitrosococcus halophilus Nc4]
 gi|291582266|gb|ADE16723.1| phosphoglucosamine mutase [Nitrosococcus halophilus Nc4]
          Length = 448

 Score =  267 bits (683), Expect = 2e-69,   Method: Composition-based stats.
 Identities = 210/447 (46%), Positives = 300/447 (67%), Gaps = 9/447 (2%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           MK+++FGTDGIRG+    PIT +F++ +G AVG +   + +  +V+IGKDTR+SGYM E+
Sbjct: 1   MKKKYFGTDGIRGRVGEHPITADFVLHLGWAVGRVL-ARGRQSKVLIGKDTRISGYMFES 59

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +L AG +AAG+D  +LGP+P+PA+A LTR+L A+ G++ISASHNPY DNGIK F   G K
Sbjct: 60  ALQAGLSAAGVDIRLLGPMPTPAIAYLTRTLHAEAGIVISASHNPYYDNGIKFFSSAGTK 119

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDS--IGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLR 178
           +     D IE  +E +L   +   DS  +G A+RV     RYIE  K T P  V L GLR
Sbjct: 120 LP----DEIEFAIEKELEGPMQTVDSSRLGKAERVVDAAGRYIEFCKGTGPASVDLSGLR 175

Query: 179 IVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADI 238
           +VVDCA+GA+Y VA EVF E+GA+V+ IG  PNG+NIN   GS    +LQRKV E +AD+
Sbjct: 176 LVVDCAHGATYHVASEVFAEMGAEVIAIGISPNGLNINEGYGSIAPEALQRKVLECKADV 235

Query: 239 GIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIA 298
           GIALDGDGDRVI+VD +G IV+GD+++  IAR       +    + T  MSN+GLE+ +A
Sbjct: 236 GIALDGDGDRVIMVDHRGEIVDGDEMLYTIARARQRTDRMMEGVVGTL-MSNLGLEKALA 294

Query: 299 GLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQY 358
            LG+ L R +VGDRY++E +++NG+++GGE SGHII  D  +TGDG+V+ALQVL  +   
Sbjct: 295 ALGIPLMRAQVGDRYVLEMLQSNGYSLGGESSGHIICLDRTTTGDGIVSALQVLVEMVAT 354

Query: 359 DKPVSTICHCFEEYPQFLRSVSVKDTSILNSS-SIVQAIADAESELRGIDRLIVRASGTE 417
              +  +     +YPQ L +V V+    L+ + ++  A+ + E++L    R+++R SGTE
Sbjct: 355 GCSLHELKSAMTKYPQCLINVRVEQRVELHGNGAVTSAVKEIENQLGEEGRVLLRPSGTE 414

Query: 418 SLIRIMAEGDDLSRIKRIVDDLAKVIP 444
            ++R+M EG D S++  +   LA+ I 
Sbjct: 415 PVVRVMVEGRDASQVNTLAQQLAQEIA 441


>gi|332798336|ref|YP_004459835.1| phosphoglucosamine mutase [Tepidanaerobacter sp. Re1]
 gi|332696071|gb|AEE90528.1| phosphoglucosamine mutase [Tepidanaerobacter sp. Re1]
          Length = 448

 Score =  267 bits (683), Expect = 2e-69,   Method: Composition-based stats.
 Identities = 193/446 (43%), Positives = 287/446 (64%), Gaps = 2/446 (0%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           MK R FGTDG+RG +N   ++P    ++G A   +     K   +V+GKDTR+SG +LE 
Sbjct: 1   MKSRLFGTDGVRGVANK-DLSPLLAFKLGRAGAQVLSKLHKKPIMVVGKDTRISGDLLEA 59

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +L+AG  + G D   +G +P+PA+A LTR   AD GV+ISASHNP++ NGIK F  +GYK
Sbjct: 60  ALIAGMCSQGADVLKVGIMPTPAIAYLTRHFNADAGVVISASHNPFEYNGIKFFDKNGYK 119

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +   +ED IE LLED      +   S       +     Y++ +K  + + +  +GL++ 
Sbjct: 120 LPDAMEDEIEALLEDTNGEIKNPIGSDVGKTYTEDAIRPYVDFIKSVIDKKLKFRGLKVA 179

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           +DCANGASY+VAP +  ELGADV +I ++P+G NIN++CGST+  SL + V E+RAD+G+
Sbjct: 180 LDCANGASYQVAPIILEELGADVHIINNQPDGTNINVNCGSTHPESLCKYVREIRADVGL 239

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           + DGD DR+I VDEKG IV+GD IMA+      S  LL+   +V+TVMSN+GLE  +   
Sbjct: 240 SFDGDADRLIAVDEKGEIVDGDHIMAICGVHLKSRGLLKNETVVSTVMSNMGLEVALKNA 299

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           G+ + R +VGDRY++E M ++G+N GGEQSGHII  DY +TGDG++  ++++  +   +K
Sbjct: 300 GIQMMRAKVGDRYVLEEMLSSGYNFGGEQSGHIIFLDYNTTGDGILTGVKLIDVMVNENK 359

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTSILNSSS-IVQAIADAESELRGIDRLIVRASGTESL 419
            +S +    + YPQ L +V+V D S  +S+  I + IA+ +  L    R++VR SGTE L
Sbjct: 360 TLSELRQIMKVYPQILINVTVADKSGYDSNKRIQEIIAENQELLGEKGRILVRPSGTEPL 419

Query: 420 IRIMAEGDDLSRIKRIVDDLAKVIPM 445
           IR+M EG+    I+++   +A+VI  
Sbjct: 420 IRVMVEGEQQDLIEKVAKSVAEVIEQ 445


>gi|138893830|ref|YP_001124283.1| phosphoglucosamine mutase [Geobacillus thermodenitrificans NG80-2]
 gi|196250596|ref|ZP_03149286.1| phosphoglucosamine mutase [Geobacillus sp. G11MC16]
 gi|158513828|sp|A4IJN4|GLMM_GEOTN RecName: Full=Phosphoglucosamine mutase
 gi|134265343|gb|ABO65538.1| Phosphoglucosamine mutase [Geobacillus thermodenitrificans NG80-2]
 gi|196209945|gb|EDY04714.1| phosphoglucosamine mutase [Geobacillus sp. G11MC16]
          Length = 448

 Score =  267 bits (683), Expect = 2e-69,   Method: Composition-based stats.
 Identities = 193/443 (43%), Positives = 282/443 (63%), Gaps = 5/443 (1%)

Query: 4   RFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSLV 63
           ++FGTDG+RG +N   +TP    +IG   GY+     +  +V+IG+DTR+SG+MLE +LV
Sbjct: 3   KYFGTDGVRGVANR-ELTPELAFKIGRCGGYVLTKSAERPKVLIGRDTRISGHMLEGALV 61

Query: 64  AGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVST 123
           AG  + G +   LG I +P VA LT++L A  G+MISASHNP QDNGIK FGPDG+K+S 
Sbjct: 62  AGLLSIGAEVMRLGVISTPGVAYLTKALGAQAGIMISASHNPVQDNGIKFFGPDGFKLSD 121

Query: 124 DIEDRIETLLEDDLTSYLSCYD-SIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVVD 182
           + E  IETL++            S+G          +Y++++K+T+       G++I +D
Sbjct: 122 EQEQEIETLIDSPEDMLPRPIGSSLGQVNDYFEGGQKYLQYLKQTIDE--DFSGMKIALD 179

Query: 183 CANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIAL 242
           CA+GA+  +A  +F +L ADV+ +G  PNG+NIN   GST+  +L   V E  AD+G+A 
Sbjct: 180 CAHGATSSLATYLFADLEADVITMGASPNGLNINEGVGSTHPEALAAFVKEKGADVGLAF 239

Query: 243 DGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLGL 302
           DGDGDR+I VDE+G IV+GDQIM + A+       L+   +V+TVMSN+G  + +   G+
Sbjct: 240 DGDGDRLIAVDERGNIVDGDQIMYICAKYLKETGRLKQQTVVSTVMSNLGFYKALEAQGI 299

Query: 303 SLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKPV 362
           S  +T VGDRY++E MK NG+N+GGEQSGHII  DY +TGDG++ ALQ++  +K   KP+
Sbjct: 300 SSVQTAVGDRYVVEEMKKNGYNLGGEQSGHIIFLDYNTTGDGMLTALQLVNIMKIKGKPL 359

Query: 363 STICHCFEEYPQFLRSVSVKDTSI-LNSSSIVQAIADAESELRGIDRLIVRASGTESLIR 421
           S +    ++YPQ L +V V D    +    + + IA+ E+E+ G  R++VR SGTE L+R
Sbjct: 360 SELAGEMKKYPQLLVNVRVTDKEKAMEHEQVKKVIAEVEAEMNGNGRVLVRPSGTEPLVR 419

Query: 422 IMAEGDDLSRIKRIVDDLAKVIP 444
           +MAE       +  V+ +A VI 
Sbjct: 420 VMAEAPTEEACRTYVERIADVIR 442


>gi|187924836|ref|YP_001896478.1| phosphoglucosamine mutase [Burkholderia phytofirmans PsJN]
 gi|226722720|sp|B2SZR6|GLMM_BURPP RecName: Full=Phosphoglucosamine mutase
 gi|187716030|gb|ACD17254.1| phosphoglucosamine mutase [Burkholderia phytofirmans PsJN]
          Length = 452

 Score =  267 bits (683), Expect = 2e-69,   Method: Composition-based stats.
 Identities = 198/455 (43%), Positives = 287/455 (63%), Gaps = 10/455 (2%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRG------KKKHRRVVIGKDTRLS 54
           M RR+FGTDGIRGK    PITP F++R+G A G +  G            V+IGKDTR+S
Sbjct: 1   MARRYFGTDGIRGKVGEGPITPEFVLRLGYAAGKVLAGADRWAKSGTRPTVLIGKDTRVS 60

Query: 55  GYMLENSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLF 114
           GYMLE +L +GF+AAG+D  + GP+P+P +A LTR+LR   GV+ISASHNPY DNGIK F
Sbjct: 61  GYMLEAALESGFSAAGVDVMLAGPMPTPGIAYLTRALRLAAGVVISASHNPYYDNGIKFF 120

Query: 115 GPDGYKVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTL 174
             DG K+  ++E +IE  L  DL    +  + +G A+R+D    RYIE  K T P    L
Sbjct: 121 SADGNKLPDEVESQIEEQL--DLPLACAASEQLGKARRLDDAAGRYIEFCKSTFPAAFDL 178

Query: 175 QGLRIVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEV 234
            GL++VVDCA+GA+Y VAP VF ELGA+V+ IG  PNG NIN   G+T   +L R V   
Sbjct: 179 HGLKLVVDCAHGAAYDVAPHVFHELGAEVIPIGVAPNGFNINDGVGATAPDALVRAVRAN 238

Query: 235 RADIGIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLE 294
            AD+GIALDGD DR+ +VD  G + NGD+++ ++ ++ ++        + T  M+N+ +E
Sbjct: 239 HADLGIALDGDADRLQVVDAAGRLYNGDELLYILVKDRVATDGKVDGAVGTL-MTNMAVE 297

Query: 295 RFIAGLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRY 354
             +   G+   R  VGDRY++E ++ +G+ +G E SGHI+  D  STGDG+V+AL VL  
Sbjct: 298 VALQEAGVKFVRAAVGDRYVLEQLREHGWQLGAEGSGHILSLDRHSTGDGIVSALLVLAA 357

Query: 355 IKQYDKPVSTICHCFEEYPQFLRSVSVK-DTSILNSSSIVQAIADAESELRGIDRLIVRA 413
           +K+ +K ++ +      +PQ L +V +K D    +S +I +AIA AES L G  R+++RA
Sbjct: 358 MKRSEKTLADLLDGVTLFPQKLINVRMKPDADWKSSDAIRRAIAKAESALNGRGRVLIRA 417

Query: 414 SGTESLIRIMAEGDDLSRIKRIVDDLAKVIPMIDS 448
           SGTE ++R+M E ++ +   +  + +A  +    +
Sbjct: 418 SGTEPVLRVMVEAENAADALQYAESIAGAVKEATA 452


>gi|187929106|ref|YP_001899593.1| phosphoglucosamine mutase [Ralstonia pickettii 12J]
 gi|309782471|ref|ZP_07677195.1| phosphoglucosamine mutase [Ralstonia sp. 5_7_47FAA]
 gi|226723907|sp|B2UGP7|GLMM_RALPJ RecName: Full=Phosphoglucosamine mutase
 gi|187725996|gb|ACD27161.1| phosphoglucosamine mutase [Ralstonia pickettii 12J]
 gi|308918808|gb|EFP64481.1| phosphoglucosamine mutase [Ralstonia sp. 5_7_47FAA]
          Length = 447

 Score =  267 bits (683), Expect = 2e-69,   Method: Composition-based stats.
 Identities = 190/450 (42%), Positives = 278/450 (61%), Gaps = 9/450 (2%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKK-----KHRRVVIGKDTRLSG 55
           M R++FGTDGIRG+    PITP+F++R+G A G +              V+IGKDTRLSG
Sbjct: 1   MSRKYFGTDGIRGRVGESPITPDFVLRLGYAAGRVLAHGGEAHGHGRPTVLIGKDTRLSG 60

Query: 56  YMLENSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFG 115
           YMLE +L AGFTAAG+D  + GP+P+P VA LTR+LR   GV+ISASHNPY DNGIK F 
Sbjct: 61  YMLEAALEAGFTAAGVDVLMSGPLPTPGVAYLTRALRLSAGVVISASHNPYYDNGIKFFS 120

Query: 116 PDGYKVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQ 175
             G K+  + E +IE  LE  +    +  D++G A+R++    RYIE  K T P D+ L 
Sbjct: 121 ATGDKLPDETELQIEAELEKPMA--YAASDALGRARRIEDAAGRYIEFCKSTFPSDLNLF 178

Query: 176 GLRIVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVR 235
           G+++V+D A+GA+Y +AP VF ELGADVV IG++PNG NIN   G+T    L     E  
Sbjct: 179 GMKVVLDSAHGAAYHIAPHVFHELGADVVSIGNQPNGRNINDGYGATAPGKLVEATREHG 238

Query: 236 ADIGIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLER 295
           ADIG+A DGD DR+ +VD  G + NGD+++ ++ +   +        + T  M+N+ +E 
Sbjct: 239 ADIGLAFDGDADRLQVVDRNGRLYNGDELLYVMVQARRAAGQTVPGAVGTL-MTNLAVEL 297

Query: 296 FIAGLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYI 355
            +   G+   R +VGDRY++E +K NG+ +GGE SGH++  D  STGDG+++ALQVL  +
Sbjct: 298 ALKAQGVEFVRAKVGDRYVLEELKKNGWLLGGEGSGHLLCLDKHSTGDGIISALQVLAAL 357

Query: 356 KQYDKPVSTICHCFEEYPQFLRSVSVKDTSILNSSS-IVQAIADAESELRGIDRLIVRAS 414
           ++  + +  +      +PQ L +V V+      S + +  A+  +E+EL G  R+++R S
Sbjct: 358 RRSGQTLDEMLDGVRLFPQKLINVRVEKGFDWKSHAGLQAALKTSEAELDGKGRVLIRPS 417

Query: 415 GTESLIRIMAEGDDLSRIKRIVDDLAKVIP 444
           GTE ++R+M E  D     +  + LA  + 
Sbjct: 418 GTEPVVRVMVEAQDAELANQHAERLAATLQ 447


>gi|29654647|ref|NP_820339.1| phosphoglucosamine mutase [Coxiella burnetii RSA 493]
 gi|161830736|ref|YP_001597191.1| phosphoglucosamine mutase [Coxiella burnetii RSA 331]
 gi|81628793|sp|Q83BY7|GLMM_COXBU RecName: Full=Phosphoglucosamine mutase
 gi|189040782|sp|A9N8M1|GLMM_COXBR RecName: Full=Phosphoglucosamine mutase
 gi|29541915|gb|AAO90853.1| phosphoglucosamine mutase [Coxiella burnetii RSA 493]
 gi|161762603|gb|ABX78245.1| phosphoglucosamine mutase [Coxiella burnetii RSA 331]
          Length = 446

 Score =  267 bits (683), Expect = 2e-69,   Method: Composition-based stats.
 Identities = 198/446 (44%), Positives = 300/446 (67%), Gaps = 4/446 (0%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M++++FGTDGIRGK     I   FM+++G AVG +         V+IGKDTR+SGYM+E+
Sbjct: 1   MQKKYFGTDGIRGKVGNSLINAEFMLKLGWAVGRVLAN-SHSATVLIGKDTRISGYMIES 59

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +L AG +AAG++  + GP+P+PA+A LT S+RAD G++ISASHN Y DNG+K F  DG+K
Sbjct: 60  ALQAGLSAAGVNIKLTGPMPTPAIAYLTHSVRADAGIVISASHNHYPDNGVKFFNKDGFK 119

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +S ++E  IE  ++  + + +   D +G A R++  H RYIE  K T P ++TL+GL+IV
Sbjct: 120 LSDELELAIEKQIDKPMKTVV--ADRLGKAARMNEAHGRYIEFCKSTFPSNLTLKGLKIV 177

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           VDCANGA+Y VAP +F ELGA+VV I D P+G NIN  CG+T+   LQ  V +  AD+GI
Sbjct: 178 VDCANGAAYAVAPSIFHELGAEVVAIADDPDGFNINQTCGATDTAHLQEMVVKHNADVGI 237

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           A DGDGDR+I+VD  G  V+GD+++ ++A +          G+V T+MSN+GLE  +   
Sbjct: 238 AFDGDGDRLIMVDHHGLRVDGDELLCIMAIDRFYLKENAPLGVVGTIMSNLGLEHTLKRH 297

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
            ++ +R+ VGDRY+++ M+  G+ +GGE SGHI+   + +TGDG++ ALQ+LR ++Q +K
Sbjct: 298 HIAFERSPVGDRYVLDLMQQKGWFLGGESSGHIVDLGFTTTGDGVITALQILRIMQQAEK 357

Query: 361 PVSTICHCFEEYPQFLRSVSVKD-TSILNSSSIVQAIADAESELRGIDRLIVRASGTESL 419
           P++ +     ++PQ L +V +K    I  + +I +AI +AE +L G  R+++R SGTE +
Sbjct: 358 PLADLKKVMVKHPQVLINVPIKGILDIAQNPNIKKAITEAEKQLNGAGRILLRPSGTEPV 417

Query: 420 IRIMAEGDDLSRIKRIVDDLAKVIPM 445
           IR+M EG D   +++  + LA  +  
Sbjct: 418 IRVMVEGSDEGIVRQTAEMLAAAVQQ 443


>gi|320353175|ref|YP_004194514.1| phosphoglucosamine mutase [Desulfobulbus propionicus DSM 2032]
 gi|320121677|gb|ADW17223.1| phosphoglucosamine mutase [Desulfobulbus propionicus DSM 2032]
          Length = 450

 Score =  267 bits (683), Expect = 2e-69,   Method: Composition-based stats.
 Identities = 210/447 (46%), Positives = 299/447 (66%), Gaps = 2/447 (0%)

Query: 3   RRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSL 62
           ++ FGTDG+RG +N +P+T    M+IG A+ ++ + + K   +VIGKDTRLSGYM+EN+L
Sbjct: 2   KKLFGTDGVRGVANIYPMTSEIAMQIGRAIAFIVKNQVKGNTIVIGKDTRLSGYMIENAL 61

Query: 63  VAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVS 122
            AG  + G++  ++GP+P+P +A +T S+RAD GV+ISASHNP+QDNGIK+F  DGYK+ 
Sbjct: 62  AAGICSMGVNVQLVGPLPTPGIAFITTSMRADAGVVISASHNPFQDNGIKIFSADGYKLP 121

Query: 123 TDIEDRIETLL-EDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVV 181
            ++E  IE L+    + +     D IG A R++    RYI ++K T PRD  L    IV+
Sbjct: 122 DELEADIEDLIFSQKMAALRPVADEIGKASRIEDAGGRYIVYLKNTFPRDYVLDDFHIVL 181

Query: 182 DCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIA 241
           DCA+GA+YKVAP VF ELGA V  IG  P+G NIN +CG+ +   +  KV ++ ADIG+A
Sbjct: 182 DCAHGATYKVAPHVFTELGARVTAIGVDPDGKNINHECGALHPEVMAAKVKQLGADIGLA 241

Query: 242 LDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLG 301
           LDGDGDR+I+ DE G IV+GD IMA+ A + M    L+   +V TVMSN+GLE+ I  +G
Sbjct: 242 LDGDGDRLIVCDEHGTIVDGDHIMAICAADLMHRRKLKKKTLVATVMSNMGLEQAIKSMG 301

Query: 302 LSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKP 361
             L RT+VGDRY++E M+  G+N GGEQSGH++  D+ +TGDG +AALQ+L  + + +KP
Sbjct: 302 GQLVRTQVGDRYVVEAMRAKGYNFGGEQSGHLVFLDHNTTGDGTLAALQLLAIMIKKNKP 361

Query: 362 VSTICHCFEEYPQFLRSVSV-KDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
           +S +      +PQ L++V +       +     +A+  AE +L G  R++VRASGTE +I
Sbjct: 362 LSELATIMATFPQVLQNVRMATRIPPEHIPGFPEALDKAERKLEGRGRILVRASGTEPVI 421

Query: 421 RIMAEGDDLSRIKRIVDDLAKVIPMID 447
           R+M EG+D   I  I  DL +VI   D
Sbjct: 422 RVMTEGEDEQEITAIAHDLCEVIRKAD 448


>gi|255065041|ref|ZP_05316896.1| phosphoglucosamine mutase [Neisseria sicca ATCC 29256]
 gi|261365203|ref|ZP_05978086.1| phosphoglucosamine mutase [Neisseria mucosa ATCC 25996]
 gi|255050462|gb|EET45926.1| phosphoglucosamine mutase [Neisseria sicca ATCC 29256]
 gi|288566464|gb|EFC88024.1| phosphoglucosamine mutase [Neisseria mucosa ATCC 25996]
          Length = 445

 Score =  267 bits (682), Expect = 2e-69,   Method: Composition-based stats.
 Identities = 198/445 (44%), Positives = 293/445 (65%), Gaps = 6/445 (1%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKH--RRVVIGKDTRLSGYML 58
           M +++FGTDG+RG+   FPITP+F++++G A G +           V+IGKDTR+SGYML
Sbjct: 1   MAKKYFGTDGVRGEVGQFPITPDFVLKLGYAAGQVLVQHDGGQKPTVLIGKDTRISGYML 60

Query: 59  ENSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDG 118
           E +LVAGFTAAG++    GP+P+P VA LTR+LR   GVMISASHN Y DNGIK F   G
Sbjct: 61  EAALVAGFTAAGVNVIQTGPLPTPGVAYLTRALRLSAGVMISASHNVYSDNGIKFFAEGG 120

Query: 119 YKVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLR 178
            K+S +IE  IE  +++++ +       +G A+R++G  DRYIE  K T P  + L+GL+
Sbjct: 121 VKLSDEIELEIEAKIDEEMKTQP--SARLGRARRINGADDRYIEFCKSTFPSHLDLRGLK 178

Query: 179 IVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADI 238
           +VVD A+GA Y VAP+VF ELGA VV IGD+PNG NIN  CG+T+  +LQ  V +  AD 
Sbjct: 179 LVVDTAHGAGYDVAPKVFHELGAQVVSIGDEPNGYNINEKCGATHPKALQAAVLQNEADY 238

Query: 239 GIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIA 298
           GIALDGDGDR+++VD  G + +GD ++ +IA+   +   +   G+V TVM+N+ +E  + 
Sbjct: 239 GIALDGDGDRLMMVDRNGKVYDGDSLIYVIAK-ARAREGINIGGVVGTVMTNMAMEIALK 297

Query: 299 GLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQY 358
             G+   R +VGDRY++E +   G+ +GGE SGHI+  D  +TGDG+++ALQVL  ++  
Sbjct: 298 EQGVDFCRAKVGDRYVLEQLNQRGWLIGGEASGHILCMDKHNTGDGIISALQVLAALQIL 357

Query: 359 DKPVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTES 418
           ++ ++T+C  ++ YPQ + +V ++       +S    +A+ E EL G  R+++RASGTE 
Sbjct: 358 NQDLATVCADWQPYPQTMINVRIQKGQKWQEAS-KDVLAEVEKELEGKGRVVLRASGTEP 416

Query: 419 LIRIMAEGDDLSRIKRIVDDLAKVI 443
           ++R+M E       K+  + +A  I
Sbjct: 417 VVRVMVEARQADWAKKGAERIAAAI 441


>gi|294793057|ref|ZP_06758203.1| phosphoglucosamine mutase [Veillonella sp. 6_1_27]
 gi|294794904|ref|ZP_06760039.1| phosphoglucosamine mutase [Veillonella sp. 3_1_44]
 gi|294454266|gb|EFG22640.1| phosphoglucosamine mutase [Veillonella sp. 3_1_44]
 gi|294456002|gb|EFG24366.1| phosphoglucosamine mutase [Veillonella sp. 6_1_27]
          Length = 450

 Score =  267 bits (682), Expect = 2e-69,   Method: Composition-based stats.
 Identities = 194/444 (43%), Positives = 269/444 (60%), Gaps = 3/444 (0%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M R  FGTDG+RG  N F +TP     +G A G  F  KK H   +IG+DTR+SG MLE+
Sbjct: 1   MAR-LFGTDGVRGVVNEF-LTPELAYHLGRAAGTHFGKKKDHPTFLIGRDTRISGSMLES 58

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +L AG  + G +  I G IP+PAVA L R    D G +ISASHNPY DNGIK F  +GYK
Sbjct: 59  ALAAGICSVGGNVVIAGVIPTPAVAYLVRQQGFDAGAVISASHNPYPDNGIKFFDGNGYK 118

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +  ++ED +E  +     + L+     G  K     +  ++         D +L+GL IV
Sbjct: 119 LPDEVEDELEKYVRQSADNELARPTGDGIGKIEFNSNLAHLYAHFVRHTIDTSLEGLTIV 178

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
            D ANGA+  V PE+   LGA V+ I   P+G+NIN  CGST++  LQ  V +  AD+GI
Sbjct: 179 YDGANGAASSVGPEILSGLGAKVININVNPDGLNINHHCGSTHIEGLQVAVQQHNADLGI 238

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           A DGD DR ++VDEKG +++GDQIM L A +      L+G+ IV TVMSNIG  +    L
Sbjct: 239 ANDGDADRCLLVDEKGQVLDGDQIMLLCALKLKEEGKLKGDTIVGTVMSNIGFHKAAEEL 298

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           G+    T VGDRY++EYM+ +  +VGGEQSGH+I  D+ +TGDG++ A+QV   +K+  +
Sbjct: 299 GMKTVSTAVGDRYVLEYMREHNLSVGGEQSGHVIFLDHNTTGDGMLTAVQVAALMKEKKQ 358

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTS-ILNSSSIVQAIADAESELRGIDRLIVRASGTESL 419
           P+S +     +YPQ L +V V   +   ++  I  AI  AE EL    R++VRASGTE L
Sbjct: 359 PLSELAGIMTKYPQVLVNVRVATKTGWEDNDLIKAAIVTAEGELGDEGRVLVRASGTEPL 418

Query: 420 IRIMAEGDDLSRIKRIVDDLAKVI 443
           IR+MAEG +   ++ +  ++A +I
Sbjct: 419 IRVMAEGPNQEELQSLCQEIADII 442


>gi|90416127|ref|ZP_01224059.1| phosphoglucosamine mutase [marine gamma proteobacterium HTCC2207]
 gi|90331852|gb|EAS47066.1| phosphoglucosamine mutase [marine gamma proteobacterium HTCC2207]
          Length = 451

 Score =  267 bits (682), Expect = 2e-69,   Method: Composition-based stats.
 Identities = 198/447 (44%), Positives = 299/447 (66%), Gaps = 5/447 (1%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLF-RGKKKHRRVVIGKDTRLSGYMLE 59
           M R++FGTDGIRG+    PIT +F +++G A G +  R     +RV+IGKDTR+SGYM E
Sbjct: 1   MTRKYFGTDGIRGRVGEAPITADFFLKLGWAAGTVLTRNAVGKKRVLIGKDTRVSGYMFE 60

Query: 60  NSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGY 119
           ++L AG  AAG+D  +LGP+P+PA+A LTR+ RA  G++ISASHN  +DNGIK FG DGY
Sbjct: 61  SALEAGLIAAGVDVDMLGPMPTPAIAYLTRTFRAAAGIVISASHNAVEDNGIKFFGADGY 120

Query: 120 KVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRI 179
           K+  +IE  IE LL+  L +  +  + +G A+R+     RY+E  K +LP    L+G+++
Sbjct: 121 KLPDEIELEIEALLDQPLVT--NGSNDLGKARRIGDAAGRYVEFCKGSLPSGFNLRGMKV 178

Query: 180 VVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIG 239
           V+DCA+GA+Y V P+VF ELGA    +G++PNG NIN  CGST+ + L   V + +AD+G
Sbjct: 179 VLDCAHGATYDVGPKVFKELGATTTTMGNQPNGFNINDQCGSTHTVGLSAAVLDQQADLG 238

Query: 240 IALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAG 299
           IA DGDGDRV+ +D+KG +V+GD+++ +IA+          NG+  T MSN+GLE  +A 
Sbjct: 239 IAFDGDGDRVLFIDDKGDLVDGDELLFIIAQHRHEFQG-GCNGVAGTQMSNLGLELALAD 297

Query: 300 LGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYD 359
           + +   RT+VGDRY++E MK + + +GGE SGH++ SD  +TGDG+V+ALQVLR +    
Sbjct: 298 MNIPFVRTKVGDRYVVEAMKEHNWMLGGEGSGHVLCSDLNTTGDGIVSALQVLRAVVDSG 357

Query: 360 KPVSTICHCFEEYPQFLRSVSVKDTSILNS-SSIVQAIADAESELRGIDRLIVRASGTES 418
           K +  + +   + P  + +V +     L+   +I +A+A+AE +L G  R+++R SGTE 
Sbjct: 358 KSLRELKNGMSKLPMLMINVRLTQKIDLSGDEAINRAVAEAEEKLAGRGRVLLRTSGTEP 417

Query: 419 LIRIMAEGDDLSRIKRIVDDLAKVIPM 445
           LIR+M EG+D + ++     +A+++  
Sbjct: 418 LIRVMVEGEDSALVESSAAAIAEIVKQ 444


>gi|149186420|ref|ZP_01864733.1| phosphoglucosamine mutase [Erythrobacter sp. SD-21]
 gi|148830009|gb|EDL48447.1| phosphoglucosamine mutase [Erythrobacter sp. SD-21]
          Length = 445

 Score =  267 bits (682), Expect = 2e-69,   Method: Composition-based stats.
 Identities = 242/445 (54%), Positives = 318/445 (71%), Gaps = 2/445 (0%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M R +FGTDGIRG++N   +T    M++G A G  F       RVVIGKDTRLSGYM+E+
Sbjct: 1   MARTYFGTDGIRGRTNEGVMTAETAMKVGQAAGTHFLRGGHKHRVVIGKDTRLSGYMVES 60

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +LVAGFT+ GMD  + GP+P+PA+A+LTR +RAD+GVMISASHNP++DNGIKLFGPDGYK
Sbjct: 61  ALVAGFTSVGMDVIMTGPLPTPAIALLTREMRADLGVMISASHNPFEDNGIKLFGPDGYK 120

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +S + E  IETL+       L   + IG A+R+D    RYI  VK+++  DV   GL++V
Sbjct: 121 LSDEAEMAIETLMTQQ--PLLVSPERIGRARRIDDASGRYIHAVKQSVASDVRFDGLKVV 178

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           VDCANGA+YKVAP   WELGA V+ +G +PNG NIN D GST++ +++ +V E  A IGI
Sbjct: 179 VDCANGAAYKVAPSAIWELGAQVIAMGVEPNGTNINRDVGSTSLDAIKARVVEEGAHIGI 238

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           ALDGD DR+I++DEKG  V+GDQIM LIA        LRG G+V TVMSN+GLER++A  
Sbjct: 239 ALDGDADRLIVIDEKGNTVDGDQIMGLIATRLKERGDLRGGGVVATVMSNLGLERYLASQ 298

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           GL+L+RT VGDRY++E M+  GFNVGGEQSGH+ILSDYG+TGDG VAAL+VL  + ++ K
Sbjct: 299 GLTLERTRVGDRYVLERMRQGGFNVGGEQSGHMILSDYGTTGDGTVAALRVLASVVRFGK 358

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
           P S + H F+  PQ L++V       L + S+   I +AE EL G  RL++R SGTE +I
Sbjct: 359 PASELLHVFDPVPQLLKNVRYSGGKPLENESVKAVIVEAEKELEGKGRLVIRPSGTEPVI 418

Query: 421 RIMAEGDDLSRIKRIVDDLAKVIPM 445
           R+MAEGDD  +++ +VD +   +  
Sbjct: 419 RVMAEGDDARQVETVVDRICDAVRE 443


>gi|170695461|ref|ZP_02886606.1| phosphoglucosamine mutase [Burkholderia graminis C4D1M]
 gi|170139652|gb|EDT07835.1| phosphoglucosamine mutase [Burkholderia graminis C4D1M]
          Length = 452

 Score =  267 bits (682), Expect = 3e-69,   Method: Composition-based stats.
 Identities = 199/455 (43%), Positives = 284/455 (62%), Gaps = 10/455 (2%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLF------RGKKKHRRVVIGKDTRLS 54
           M RR+FGTDGIRGK    PITP F++R+G A G +               V+IGKDTR+S
Sbjct: 1   MARRYFGTDGIRGKVGEGPITPEFVLRLGYAAGKVLVGADRWARTGTRPTVLIGKDTRVS 60

Query: 55  GYMLENSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLF 114
           GYMLE +L AGF+AAG+D  + GP+P+P +A LTR+LR   GV+ISASHNPY DNGIK F
Sbjct: 61  GYMLEAALEAGFSAAGVDVMLAGPMPTPGIAYLTRALRLAAGVVISASHNPYYDNGIKFF 120

Query: 115 GPDGYKVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTL 174
             DG K+  D+E +IE  LE  L    +  + +G A+R+D    RYIE  K T P    L
Sbjct: 121 SADGNKLPDDVESQIEEHLE--LPLACAASEQLGKARRLDDAAGRYIEFCKSTFPAAFDL 178

Query: 175 QGLRIVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEV 234
           +GL++VVDCA+GA+Y VAP VF ELGA+V+ IG  PNG NIN   G+T   +L R V   
Sbjct: 179 RGLKLVVDCAHGAAYDVAPHVFHELGAEVIPIGVAPNGFNINDGVGATAPDALVRAVRAN 238

Query: 235 RADIGIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLE 294
            AD+GIALDGD DR+ +VD  G + NGD+++ ++ ++ ++        + T  M+N+ +E
Sbjct: 239 HADLGIALDGDADRLQVVDAAGRLYNGDELLYVLVKDRIATDGKVEGAVGTL-MTNMAVE 297

Query: 295 RFIAGLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRY 354
             +   G+   R  VGDRY++E ++ +G+ +G E SGHI+  D  STGDG+V+AL VL  
Sbjct: 298 VALQAAGVKFVRAAVGDRYVLEQLREHGWQLGAEGSGHILSLDRHSTGDGIVSALLVLAA 357

Query: 355 IKQYDKPVSTICHCFEEYPQFLRSVSVK-DTSILNSSSIVQAIADAESELRGIDRLIVRA 413
           +K+ ++ +S +      +PQ L +V +K D     S +I +AIA AE  L G  R+++RA
Sbjct: 358 MKRSERTLSELLDGVTLFPQKLINVRMKPDADWKGSDAIRRAIASAEDALNGRGRVLIRA 417

Query: 414 SGTESLIRIMAEGDDLSRIKRIVDDLAKVIPMIDS 448
           SGTE ++R+M E + +    R  + +A  +    +
Sbjct: 418 SGTEPVLRVMVEAEHVDDALRHAEAIAAAVKQATA 452


>gi|83747760|ref|ZP_00944794.1| Phosphoglucosamine mutase [Ralstonia solanacearum UW551]
 gi|207742908|ref|YP_002259300.1| phosphoglucosamine mutase (mrsa protein) [Ralstonia solanacearum
           IPO1609]
 gi|83725532|gb|EAP72676.1| Phosphoglucosamine mutase [Ralstonia solanacearum UW551]
 gi|206594303|emb|CAQ61230.1| phosphoglucosamine mutase (mrsa protein) [Ralstonia solanacearum
           IPO1609]
          Length = 447

 Score =  267 bits (682), Expect = 3e-69,   Method: Composition-based stats.
 Identities = 191/450 (42%), Positives = 281/450 (62%), Gaps = 9/450 (2%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKK-----KHRRVVIGKDTRLSG 55
           M R++FGTDGIRG+    PITP+F++R+G A G +              V+IGKDTRLSG
Sbjct: 1   MSRKYFGTDGIRGRVGESPITPDFVLRLGYAAGRVLAHGSEAHGHGRPTVLIGKDTRLSG 60

Query: 56  YMLENSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFG 115
           YMLE +L AGFTAAG+D  + GP+P+P VA LTR+LR   GV+ISASHNPY DNGIK F 
Sbjct: 61  YMLEAALEAGFTAAGVDVLMSGPLPTPGVAYLTRALRLSAGVVISASHNPYYDNGIKFFS 120

Query: 116 PDGYKVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQ 175
             G K+  + E +IE  LE  +    +  D++G A+R+D    RYIE  K T P D+ L 
Sbjct: 121 ATGDKLPDETESQIEAELEKPME--YAASDALGRARRIDDAAGRYIEFCKSTFPNDLNLF 178

Query: 176 GLRIVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVR 235
           G++IV+D A+GA+Y +AP VF ELGADVV IG++PNG NIN   G+T    L     +  
Sbjct: 179 GMKIVLDSAHGAAYHIAPHVFHELGADVVSIGNQPNGRNINDGYGATAPAKLVEATRQHG 238

Query: 236 ADIGIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLER 295
           ADIG+A DGD DR+ +VD+ G + NGD+++ ++ +   +        + T  M+N+ +E 
Sbjct: 239 ADIGLAFDGDADRLQVVDKNGRLYNGDELLYVMVQARRAAGQAVPGAVGTL-MTNLAVEL 297

Query: 296 FIAGLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYI 355
            +   G+   R +VGDRY++E +K +G+ +GGE SGH++  D  STGDG+++ALQVL  +
Sbjct: 298 ALKAQGVDFVRAKVGDRYVLEELKKHGWLLGGEGSGHLLCLDKHSTGDGIISALQVLAAL 357

Query: 356 KQYDKPVSTICHCFEEYPQFLRSVSV-KDTSILNSSSIVQAIADAESELRGIDRLIVRAS 414
           ++  + +  +    + +PQ L +V V K       +++  A+  +E+EL G  R+++R S
Sbjct: 358 RRSGQTLEQVLDGVQLFPQKLINVRVEKGFDWKAHAALQAALKVSEAELNGKGRVLIRPS 417

Query: 415 GTESLIRIMAEGDDLSRIKRIVDDLAKVIP 444
           GTE ++R+M E  D +   +  + LA  I 
Sbjct: 418 GTEPVVRVMVEAQDAALATKHAEQLAATIR 447


>gi|308048829|ref|YP_003912395.1| phosphoglucosamine mutase [Ferrimonas balearica DSM 9799]
 gi|307631019|gb|ADN75321.1| phosphoglucosamine mutase [Ferrimonas balearica DSM 9799]
          Length = 446

 Score =  267 bits (681), Expect = 3e-69,   Method: Composition-based stats.
 Identities = 193/449 (42%), Positives = 295/449 (65%), Gaps = 5/449 (1%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M R++FGTDG+RG    +PITP+F +++G A G +   +   R V+IGKDTR+SGY+LE+
Sbjct: 1   MSRKYFGTDGVRGLVGQYPITPDFALKLGYAAGQVMAAEG-TREVIIGKDTRISGYLLES 59

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           ++ +G  AAG++  + GP+P+PA+A L ++ RAD GV+ISASHNPY DNGIK F  +G K
Sbjct: 60  AMESGLIAAGVNVALTGPLPTPAIAYLAQTFRADAGVVISASHNPYHDNGIKFFSNNGTK 119

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           ++   E  IE  L+  +        ++G  +R+     RYIE  K T     +L+GL IV
Sbjct: 120 LTDANELAIEAALDQPM--GCVDSANLGKVRRIHDAAGRYIEFCKSTFDHGASLEGLNIV 177

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           +DCA+GA+Y +AP VF ELGA++ VIGDKPNG NIN  CG+T++ +L  KV  + AD+GI
Sbjct: 178 LDCAHGATYHIAPAVFRELGAEITVIGDKPNGTNINDHCGATHLDALVDKVLTIGADMGI 237

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           A DGDGDRV++VD  GA+V+GD+I+ +IAR W +       G+V T+M+N+GLE  +  L
Sbjct: 238 AFDGDGDRVMMVDHTGAVVDGDEILYIIARHWQAT-GQMEGGVVGTLMANLGLELALKAL 296

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
            +   R++VGDRY++E +   G+ +GGE SGHI+   + STGDG++AALQVL  ++  D+
Sbjct: 297 DIPFARSKVGDRYVVEMLNEKGWMLGGENSGHILSLKHHSTGDGIIAALQVLNALRYLDQ 356

Query: 361 PVSTICHCFEEYPQFLRSVSVK-DTSILNSSSIVQAIADAESELRGIDRLIVRASGTESL 419
            ++       + PQ L +V    +++ L   +++  +A  E+E+    R+++R SGTE L
Sbjct: 357 SLADARSGMTKLPQVLINVRFSGNSAPLEHETVLAEVAAVEAEMGDKGRVLLRKSGTEPL 416

Query: 420 IRIMAEGDDLSRIKRIVDDLAKVIPMIDS 448
           IR+M EGD+   ++ +   +A  +  +D+
Sbjct: 417 IRVMVEGDNSLDVRGLAQRIADAVQAVDA 445


>gi|114563986|ref|YP_751500.1| phosphoglucosamine mutase [Shewanella frigidimarina NCIMB 400]
 gi|122299120|sp|Q07ZA3|GLMM2_SHEFN RecName: Full=Phosphoglucosamine mutase 2
 gi|114335279|gb|ABI72661.1| phosphoglucosamine mutase [Shewanella frigidimarina NCIMB 400]
          Length = 450

 Score =  267 bits (681), Expect = 3e-69,   Method: Composition-based stats.
 Identities = 203/449 (45%), Positives = 293/449 (65%), Gaps = 8/449 (1%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M R++FGTDG+RG+  TFPITP+F M++G A G +       + V+IGKDTR SGYMLE+
Sbjct: 1   MSRKYFGTDGVRGRVGTFPITPDFAMKLGWAAGKVLAS-TGTQEVLIGKDTRSSGYMLES 59

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           ++ AG +AAG++  ++GP+P+PAVA L  + RAD GV+ISASHNP+ DNGIK F   G K
Sbjct: 60  AIEAGLSAAGVNVALIGPMPTPAVAYLASTFRADAGVVISASHNPFYDNGIKFFSNSGTK 119

Query: 121 VSTDIEDRIETLLEDDLTSYLSC---YDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGL 177
           ++   E  IE LL+  L          + +G  +R+     RYIE  K    +D+TL GL
Sbjct: 120 LNDQQELEIEALLDQALNHNAMECVSSELLGKVRRITDAAGRYIEFCKGVFAKDLTLAGL 179

Query: 178 RIVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRAD 237
           +IVVD ANGA+Y +AP V+ ELGA+V+ I DKPNG NIN  CG+T++ SLQ  V    AD
Sbjct: 180 KIVVDSANGAAYHIAPNVYRELGAEVISINDKPNGTNINDHCGATHLDSLQTAVMVHEAD 239

Query: 238 IGIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFI 297
           +GIA+DGD DRV+ VD  G +V+GDQI+ ++A+           G+V T+MSN+GLE  +
Sbjct: 240 LGIAMDGDADRVMFVDHNGHVVDGDQILYILAKSA-KQQGTMTGGVVGTLMSNLGLEIAL 298

Query: 298 AGLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQ 357
             + +  KR +VGDRY++E +K  G+ +GGE SGHI+  D+ STGD +VA+L VL+ + Q
Sbjct: 299 KEMDIPFKRAKVGDRYVVEQLKQTGWRIGGEGSGHILHLDHASTGDAVVASLLVLQAVLQ 358

Query: 358 YDKPVSTICHCFEEYPQFLRSVSVKDTS---ILNSSSIVQAIADAESELRGIDRLIVRAS 414
             + ++ I  C ++ PQ L +V +   +   IL S+++ QA+ +AE+ L    R+++R S
Sbjct: 359 SGQSLAEIVSCMKKLPQVLLNVRLTANNADEILASAAVKQAVIEAEAVLAENGRVLLRKS 418

Query: 415 GTESLIRIMAEGDDLSRIKRIVDDLAKVI 443
           GTE LIR+M E  D    +   + +AKV+
Sbjct: 419 GTEPLIRVMVESTDPEMSQAQAEHIAKVV 447


>gi|238019972|ref|ZP_04600398.1| hypothetical protein VEIDISOL_01848 [Veillonella dispar ATCC 17748]
 gi|237863496|gb|EEP64786.1| hypothetical protein VEIDISOL_01848 [Veillonella dispar ATCC 17748]
          Length = 450

 Score =  267 bits (681), Expect = 3e-69,   Method: Composition-based stats.
 Identities = 188/444 (42%), Positives = 267/444 (60%), Gaps = 3/444 (0%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M R  FGTDG+RG  N F +TP     +G A    F  +K+H   +IG+DTR+SG MLE+
Sbjct: 1   MAR-LFGTDGVRGVVNEF-LTPELAYHLGRAAATHFGKEKEHPTFLIGRDTRISGSMLES 58

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +L AG  + G +  I G +P+PAVA L R    D G +ISASHNPY DNGIK F  +GYK
Sbjct: 59  ALAAGICSVGGNVVIAGVVPTPAVAYLVRQQGFDAGAVISASHNPYPDNGIKFFDGNGYK 118

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +  ++ED++E  +     + L      G        +  +          D +L+G+ IV
Sbjct: 119 LPDEVEDQLEAYVRQSAENELPRPTGDGIGTIEYNSNLAHFYAHFVRHTIDTSLEGMTIV 178

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
            D ANGA+  V PE+   LGA V+ I   P+G+NIN  CGST++  LQ  V +  AD+GI
Sbjct: 179 YDGANGAASSVGPEILAGLGAKVININVNPDGLNINHHCGSTHIEGLQVAVQQHHADLGI 238

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           A DGD DR ++VDEKG +++GDQIM L A +      L+ N +V TVMSNIG  +    L
Sbjct: 239 ANDGDADRCLLVDEKGQVLDGDQIMLLCALKLKEEGKLKDNTVVGTVMSNIGFHKAAKEL 298

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           G+    T VGDRY++EYM+ +  +VGGEQSGH+I  D+ +TGDG++ A+QV   +K+ ++
Sbjct: 299 GMKTFATAVGDRYVLEYMREHNLSVGGEQSGHVIFLDHNTTGDGMLTAVQVAALMKEKNQ 358

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTS-ILNSSSIVQAIADAESELRGIDRLIVRASGTESL 419
           P+S +     +YPQ L +V V   +   ++  I  AI  AE EL    R++VRASGTE L
Sbjct: 359 PLSELAGIMTKYPQVLINVRVATKTGWEDNDLIKAAIVTAEGELGVEGRVLVRASGTEPL 418

Query: 420 IRIMAEGDDLSRIKRIVDDLAKVI 443
           IR+MAEG +   ++ +  ++A +I
Sbjct: 419 IRVMAEGPNQEELQSLCQEIADII 442


>gi|85374876|ref|YP_458938.1| phosphoglucosamine mutase [Erythrobacter litoralis HTCC2594]
 gi|122543842|sp|Q2N850|GLMM_ERYLH RecName: Full=Phosphoglucosamine mutase
 gi|84787959|gb|ABC64141.1| phosphomannomutase [Erythrobacter litoralis HTCC2594]
          Length = 452

 Score =  267 bits (681), Expect = 3e-69,   Method: Composition-based stats.
 Identities = 235/443 (53%), Positives = 311/443 (70%), Gaps = 2/443 (0%)

Query: 3   RRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSL 62
           R+FFGTDGIRG++NT  +TP   MR+  A G  FR      RVVIGKDTRLSGYM+E +L
Sbjct: 10  RKFFGTDGIRGETNTGNMTPEIAMRVAQAAGEYFRRGDHRHRVVIGKDTRLSGYMMEAAL 69

Query: 63  VAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVS 122
           VAGFT+ GMD    GP+P+PAVA+LT+ +RAD+GVMISASHNPY+DNGIKLFGPDG+K+S
Sbjct: 70  VAGFTSVGMDVIQTGPLPTPAVALLTKEMRADLGVMISASHNPYRDNGIKLFGPDGFKLS 129

Query: 123 TDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVVD 182
            + E  IE  +  +    L     IG A+R++    RYI  +K+++  +     L++VVD
Sbjct: 130 DETELAIEQGIVSE--PALVPAAEIGRARRIEDSRGRYIHALKQSVSDETRFDSLKVVVD 187

Query: 183 CANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIAL 242
           CANGA+Y+VAP   WELGA+++ +G  PNG NIN   GST++ +++R V E  ADIGIAL
Sbjct: 188 CANGAAYQVAPSAIWELGAEIITLGVTPNGTNINDGVGSTSLDAIKRTVVEEGADIGIAL 247

Query: 243 DGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLGL 302
           DGD DR+I++DEKG  V+GDQIM LIA        LRG G+V TVMSN+GLER++    L
Sbjct: 248 DGDADRLIVIDEKGEAVDGDQIMGLIATRMAEKQALRGGGVVATVMSNLGLERYLDSKNL 307

Query: 303 SLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKPV 362
            L+RT+VGDRY++E MK  GFN+GGEQSGH+IL D+ +TGDG VAAL+VL  +    KP 
Sbjct: 308 RLERTQVGDRYVLERMKTGGFNIGGEQSGHMILLDHATTGDGTVAALRVLASLVNSGKPA 367

Query: 363 STICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLIRI 422
           S + H FE+ PQ L++V  +    L+  S+  AIADAE  L G  RL++R SGTE +IR+
Sbjct: 368 SEVLHVFEKVPQLLKNVRYEGGRPLDKDSVQTAIADAEKALDGKGRLVIRPSGTEPVIRV 427

Query: 423 MAEGDDLSRIKRIVDDLAKVIPM 445
           MAEGDD  +++ +VD +   +  
Sbjct: 428 MAEGDDADQVETVVDQICDAVKA 450


>gi|153209330|ref|ZP_01947349.1| phosphoglucosamine mutase [Coxiella burnetii 'MSU Goat Q177']
 gi|165924042|ref|ZP_02219874.1| phosphoglucosamine mutase [Coxiella burnetii RSA 334]
 gi|212212275|ref|YP_002303211.1| phosphoglucosamine mutase [Coxiella burnetii CbuG_Q212]
 gi|212218756|ref|YP_002305543.1| phosphoglucosamine mutase [Coxiella burnetii CbuK_Q154]
 gi|226722729|sp|B6J7Z9|GLMM_COXB1 RecName: Full=Phosphoglucosamine mutase
 gi|226722730|sp|B6IZD8|GLMM_COXB2 RecName: Full=Phosphoglucosamine mutase
 gi|120575401|gb|EAX32025.1| phosphoglucosamine mutase [Coxiella burnetii 'MSU Goat Q177']
 gi|165916501|gb|EDR35105.1| phosphoglucosamine mutase [Coxiella burnetii RSA 334]
 gi|212010685|gb|ACJ18066.1| phosphoglucosamine mutase [Coxiella burnetii CbuG_Q212]
 gi|212013018|gb|ACJ20398.1| phosphoglucosamine mutase [Coxiella burnetii CbuK_Q154]
          Length = 446

 Score =  267 bits (681), Expect = 3e-69,   Method: Composition-based stats.
 Identities = 198/446 (44%), Positives = 301/446 (67%), Gaps = 4/446 (0%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M++++FGTDGIRGK     I   FM+++G AVG +         V+IGKDTR+SGYM+E+
Sbjct: 1   MQKKYFGTDGIRGKVGNSLINAEFMLKLGWAVGRVLAN-SHSATVLIGKDTRISGYMIES 59

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +L AG +AAG++  + GP+P+PA+A LT S+RAD G++ISASHN Y DNG+K F  DG+K
Sbjct: 60  ALQAGLSAAGVNIKLTGPMPTPAIAYLTHSVRADAGIVISASHNHYPDNGVKFFNKDGFK 119

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +S ++E  IE  ++  + + +   D +G A R++  H RYIE  K T P ++TL+GL+IV
Sbjct: 120 LSDELELAIEKQIDKPMKTVV--ADRLGKAARMNEAHGRYIEFCKSTFPSNLTLKGLKIV 177

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           VDCANGA+Y VAP +F ELGA+VV I D P+G NIN  CG+T+   LQ  V +  AD+GI
Sbjct: 178 VDCANGAAYAVAPSIFHELGAEVVAIADDPDGFNINQTCGATDTAHLQEMVVKHNADVGI 237

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           A DGDGDR+I+VD  G  V+GD+++ ++A +          G+V T+MSN+GLE+ +   
Sbjct: 238 AFDGDGDRLIMVDHHGLRVDGDELLCIMAIDRFYLKENAPLGVVGTIMSNLGLEQTLKRH 297

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
            ++ +R+ VGDRY+++ M+  G+ +GGE SGHI+   + +TGDG++ ALQ+LR ++Q +K
Sbjct: 298 HIAFERSPVGDRYVLDLMQQKGWFLGGESSGHIVDLGFTTTGDGVITALQILRIMQQAEK 357

Query: 361 PVSTICHCFEEYPQFLRSVSVKD-TSILNSSSIVQAIADAESELRGIDRLIVRASGTESL 419
           P++ +     ++PQ L +V +K    I  + +I +AI +AE +L G  R+++R SGTE +
Sbjct: 358 PLADLKKVMVKHPQVLINVPIKGILDIAQNPNIKKAITEAEKQLNGAGRILLRPSGTEPV 417

Query: 420 IRIMAEGDDLSRIKRIVDDLAKVIPM 445
           IR+M EG D   +++  + LA  +  
Sbjct: 418 IRVMVEGSDEGIVRQTAEMLAAAVQQ 443


>gi|99082145|ref|YP_614299.1| phosphoglucosamine mutase [Ruegeria sp. TM1040]
 gi|123252193|sp|Q1GE79|GLMM_SILST RecName: Full=Phosphoglucosamine mutase
 gi|99038425|gb|ABF65037.1| phosphoglucosamine mutase [Ruegeria sp. TM1040]
          Length = 447

 Score =  267 bits (681), Expect = 3e-69,   Method: Composition-based stats.
 Identities = 229/445 (51%), Positives = 309/445 (69%), Gaps = 4/445 (0%)

Query: 3   RRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKH-RRVVIGKDTRLSGYMLENS 61
           R+ FGTDG+RGK+N  P+T    +RIG AVG  FR +     RVVIGKDTRLSGYM EN+
Sbjct: 2   RKLFGTDGVRGKANMHPMTAEMALRIGAAVGRYFRRENDTVHRVVIGKDTRLSGYMFENA 61

Query: 62  LVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKV 121
           L AG T+ GM+  +LGP+P+PAV ++TRS+RAD+GVMISASHNP +DNGIK FGPDGYK+
Sbjct: 62  LTAGLTSTGMNVLLLGPVPTPAVGLMTRSMRADLGVMISASHNPAEDNGIKFFGPDGYKL 121

Query: 122 STDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVV 181
           S ++E  +E L+E  +        +IG AKR+D    RY E VK +LPRD+ L GL++V+
Sbjct: 122 SDEVELELEALIEAGVEPA--QAQNIGRAKRIDDARFRYGERVKSSLPRDMRLDGLKVVI 179

Query: 182 DCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIA 241
           DCANGA+++ APE+ WELGADV+ +G  P+G+NIN  CGST   +    V    AD+GI 
Sbjct: 180 DCANGAAHRAAPEILWELGADVIPVGVSPDGLNINRGCGSTQPAAAAETVVAHGADVGIC 239

Query: 242 LDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLG 301
           LDGD DRV+++DE G + +GDQ+MAL+A  W +   L G  +V TVMSN+GLERF+   G
Sbjct: 240 LDGDADRVVVIDETGTVADGDQLMALLASAWSADGRLSGGALVATVMSNLGLERFLNERG 299

Query: 302 LSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKP 361
           + L+RT VGDRY++E M+  GFN+GGEQSGHI++SDY +TGDGL+A L  L  + +  + 
Sbjct: 300 IGLERTGVGDRYVVERMRQGGFNLGGEQSGHIVMSDYATTGDGLMAGLHFLAEMVRRGQK 359

Query: 362 VSTICHCFEEYPQFLRSVSVK-DTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
            S +   FE  PQ L++V  +   + L +  +  AIA+AE +L G  RL++R SGTE LI
Sbjct: 360 ASELARQFEPVPQLLKNVRFEAGQAPLEADQVQTAIAEAEKQLNGRGRLLIRKSGTEPLI 419

Query: 421 RIMAEGDDLSRIKRIVDDLAKVIPM 445
           R+MAE +D   + R VDD+   +  
Sbjct: 420 RVMAESEDPVLLNRAVDDVVAAVEA 444


>gi|134282785|ref|ZP_01769488.1| phosphoglucosamine mutase [Burkholderia pseudomallei 305]
 gi|167719067|ref|ZP_02402303.1| phosphoglucosamine mutase [Burkholderia pseudomallei DM98]
 gi|134245871|gb|EBA45962.1| phosphoglucosamine mutase [Burkholderia pseudomallei 305]
          Length = 452

 Score =  267 bits (681), Expect = 3e-69,   Method: Composition-based stats.
 Identities = 198/455 (43%), Positives = 281/455 (61%), Gaps = 10/455 (2%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFR------GKKKHRRVVIGKDTRLS 54
           M RR+FGTDGIRGK    PITP+F++R+G A G +               V+IGKDTR+S
Sbjct: 1   MGRRYFGTDGIRGKVGDAPITPDFVLRLGYAAGKVLASAPGRAASGARPTVLIGKDTRVS 60

Query: 55  GYMLENSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLF 114
           GYMLE +L AGF+AAG+D  + GP+P+P VA LTR+LR   GV+ISASHNPY DNGIK F
Sbjct: 61  GYMLEAALEAGFSAAGVDVMLAGPMPTPGVAYLTRALRLSAGVVISASHNPYHDNGIKFF 120

Query: 115 GPDGYKVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTL 174
             DG K+  +IE  IE  L+  L    +  D +G A+R+D    RYIE  K T P    L
Sbjct: 121 SADGNKLPDEIEAEIEAWLDKPLD--CAASDGLGKARRLDDAAGRYIEFCKSTFPAAFDL 178

Query: 175 QGLRIVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEV 234
           +G+++VVDCA+GA+Y+VAP VF ELGADV+ IG  PNG NIN   G+T   +L R V   
Sbjct: 179 RGMKLVVDCAHGAAYQVAPHVFHELGADVIPIGVAPNGFNINDGVGATAPDALMRAVRAN 238

Query: 235 RADIGIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLE 294
            AD+GIALDGD DR+++VD  G + NGD+++ ++ ++ ++ +      + T  M+N  +E
Sbjct: 239 HADLGIALDGDADRLLVVDHTGRLYNGDELLYVLVKDRIATNGQVEGAVGTL-MTNFAVE 297

Query: 295 RFIAGLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRY 354
             +   G+   R  VGDRY++E ++  G+ +G E SGHI+  D  STGDG+V+AL VL  
Sbjct: 298 VALKEAGVQFVRAAVGDRYVLEQLRERGWQLGAEGSGHILSLDRHSTGDGIVSALLVLAA 357

Query: 355 IKQYDKPVSTICHCFEEYPQFLRSVSVKDTSILNS-SSIVQAIADAESELRGIDRLIVRA 413
           +K+  K ++ +      +PQ L +V VK  +      +I +AI  AE  L G  R+++RA
Sbjct: 358 LKRSGKTLAQMLEGVTLFPQKLINVRVKPGADWKGSEAIRRAIDSAEQALSGSGRVLIRA 417

Query: 414 SGTESLIRIMAEGDDLSRIKRIVDDLAKVIPMIDS 448
           SGTE ++R+M E    +   R  + +A  +    +
Sbjct: 418 SGTEPVLRVMVEARQATDANRHAEAIADAVKQATA 452


>gi|326390411|ref|ZP_08211969.1| phosphoglucosamine mutase [Thermoanaerobacter ethanolicus JW 200]
 gi|325993529|gb|EGD51963.1| phosphoglucosamine mutase [Thermoanaerobacter ethanolicus JW 200]
          Length = 447

 Score =  267 bits (681), Expect = 4e-69,   Method: Composition-based stats.
 Identities = 199/447 (44%), Positives = 282/447 (63%), Gaps = 7/447 (1%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M R  FGTDG+RG +N + +TP     +G A  Y         ++V+GKD+R+S  MLE 
Sbjct: 1   MAR-LFGTDGVRGIAN-YDLTPQLAFELGRAGAYALTEGSHRPKIVVGKDSRISSDMLEC 58

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +L AG T+ G +   +G IP+PAVA LTR  +AD GVMISASHNP + NGIK F  +GYK
Sbjct: 59  ALAAGLTSVGAEVISVGIIPTPAVAYLTRLYQADAGVMISASHNPVEYNGIKFFDKNGYK 118

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +  ++EDRIE ++++ +         IG  K     H  YIE +K T+     L+G++IV
Sbjct: 119 LPDEVEDRIENIIKEKIELPSPIGTGIGTRKEYTNSHRDYIEFLKSTIDG--DLKGMKIV 176

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           +DCA GAS  VAP +F ELGA+V++ G +P G  IN++CGST+   LQ+ V E  ADIG+
Sbjct: 177 IDCAYGASSTVAPILFKELGAEVILHGAEPIGEKINVNCGSTHPEKLQQLVIENGADIGL 236

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           A DGD DR+I VDEKG +V+GD IMA+ A +      L+ N +V TVMSNIG E  +   
Sbjct: 237 AFDGDADRLIAVDEKGNVVDGDHIMAICAIDLKKKGRLKNNTVVATVMSNIGFEIALKEQ 296

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           G++L RT+VGDRY++E M   G+++GGEQSGHII  +  +TGDG + AL++   +K+  K
Sbjct: 297 GINLIRTKVGDRYVLEEMIKGGYSIGGEQSGHIIFLNDNTTGDGEITALKLCSILKESGK 356

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTSI---LNSSSIVQAIADAESELRGIDRLIVRASGTE 417
            +S +  C   YPQ L +  VK+      L    I + I + E E+RG  R+++R SGTE
Sbjct: 357 KLSELAACMVTYPQVLINAKVKNELKHAYLEDEEIKREIENLEREMRGEGRVLIRPSGTE 416

Query: 418 SLIRIMAEGDDLSRIKRIVDDLAKVIP 444
            L+R+M EG D  +I ++  +LA++I 
Sbjct: 417 PLVRVMVEGKDSDKISQMAKELAELIE 443


>gi|197119012|ref|YP_002139439.1| phosphoglucosamine mutase [Geobacter bemidjiensis Bem]
 gi|226722752|sp|B5EHA7|GLMM_GEOBB RecName: Full=Phosphoglucosamine mutase
 gi|197088372|gb|ACH39643.1| phosphoglucosamine mutase [Geobacter bemidjiensis Bem]
          Length = 454

 Score =  267 bits (681), Expect = 4e-69,   Method: Composition-based stats.
 Identities = 211/445 (47%), Positives = 304/445 (68%), Gaps = 2/445 (0%)

Query: 3   RRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSL 62
           ++ FGTDG+RG +N +P+T    M+IG A  Y+F+  KK  R+VIGKDTRLSGYMLE++L
Sbjct: 2   KKLFGTDGVRGVANVYPMTAEMAMQIGRAAAYIFKNGKKRHRIVIGKDTRLSGYMLESAL 61

Query: 63  VAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVS 122
           +AG  + G+D  ++GP+P+P +A +T S+RAD GV+ISASHNP++DNGIK F  DG+K+ 
Sbjct: 62  MAGICSMGVDVLLVGPLPTPGIANITSSMRADAGVVISASHNPFEDNGIKFFSRDGFKLP 121

Query: 123 TDIEDRIETLLEDD-LTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVV 181
            + E  +E L+    + S       +G A R+D    R++  +K T P+D+ L GL+IV+
Sbjct: 122 DETELMMEELIFSKRIDSLRPTAKEVGKAYRIDDAQGRFVVFLKSTFPKDLDLSGLKIVL 181

Query: 182 DCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIA 241
           DCANGA+YKVAP VF ELGA+V+ IG KPNG NIN DCGS +   + + V E  AD+G+A
Sbjct: 182 DCANGAAYKVAPAVFEELGAEVISIGVKPNGTNINADCGSLHPEVMSQAVKEHGADLGVA 241

Query: 242 LDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLG 301
           LDGD DRVI VDE G +V+GD+IMA+ A E +   +L+ N +V TVMSN+GL+  +   G
Sbjct: 242 LDGDADRVIFVDEYGNVVDGDRIMAICATEMIRQGILKQNTLVATVMSNMGLDIAMKRAG 301

Query: 302 LSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKP 361
             + +T VGDRY++E M   G+N+GGEQSGH+I  D+ +TGDG+++ALQVL  ++++ K 
Sbjct: 302 GQVIKTAVGDRYVVEEMLKGGYNLGGEQSGHMIFLDHNTTGDGVLSALQVLAIMQRHQKR 361

Query: 362 VSTICHCFEEYPQFLRSVSVKDTS-ILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
           +S +    E  PQ L +V + + S I+    I + I D E +L+G  R+++R SGTE L+
Sbjct: 362 LSELALVMEPLPQVLVNVRLAEKSDIMQVPEIAKLINDVEEKLKGEGRVLIRYSGTEPLL 421

Query: 421 RIMAEGDDLSRIKRIVDDLAKVIPM 445
           RIM EG D   I+   +D+A ++  
Sbjct: 422 RIMLEGSDEGDIRCWANDIASIVAQ 446


>gi|298369433|ref|ZP_06980751.1| phosphoglucosamine mutase [Neisseria sp. oral taxon 014 str. F0314]
 gi|298283436|gb|EFI24923.1| phosphoglucosamine mutase [Neisseria sp. oral taxon 014 str. F0314]
          Length = 446

 Score =  267 bits (681), Expect = 4e-69,   Method: Composition-based stats.
 Identities = 198/446 (44%), Positives = 293/446 (65%), Gaps = 6/446 (1%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKK--KHRRVVIGKDTRLSGYML 58
           M +++FGTDG+RG+   FPITP+F++++G A G +           V+IGKDTR+SGYML
Sbjct: 1   MAKKYFGTDGVRGEVGQFPITPDFVLKLGYAAGQVLVQHDSEHRPTVLIGKDTRISGYML 60

Query: 59  ENSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDG 118
           E +LVAGFT+AG++    GP+P+P VA LTR+LR   GVMISASHN Y DNGIK F   G
Sbjct: 61  EAALVAGFTSAGVNVIQTGPLPTPGVAYLTRALRLSAGVMISASHNVYSDNGIKFFAEGG 120

Query: 119 YKVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLR 178
            K+S +IE  IE  +++++ +     D +G A+R++G  DRYIE  K T P  + L+GL+
Sbjct: 121 VKLSDEIELEIEAKIDEEMKTQP--SDRLGRARRINGADDRYIEFCKSTFPNHLDLRGLK 178

Query: 179 IVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADI 238
           +VVD ANGA Y VAP+VF ELGA VV IGD+PNG NIN  CG+T+  +LQ  V +  AD 
Sbjct: 179 LVVDTANGAGYHVAPKVFHELGAQVVSIGDEPNGYNINEKCGATHPKTLQAAVLQNEADY 238

Query: 239 GIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIA 298
           G+ALDGDGDR+++VD  G + +GD ++ +IA+   +   +   G+V TVM+N+ +E  + 
Sbjct: 239 GLALDGDGDRLMMVDRNGKVYDGDSLIYVIAK-ARALEGIEIGGVVGTVMTNMAMEIALK 297

Query: 299 GLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQY 358
             G+   R +VGDRY++E +   G+ +GGE SGHI+  D  +TGDG+++ALQVL  ++  
Sbjct: 298 EQGVQFCRAKVGDRYVLEQLHQRGWLIGGEASGHILCMDKHNTGDGIISALQVLAALRIL 357

Query: 359 DKPVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTES 418
            + ++T+C  ++ YPQ + +V ++       +S    +A+ E EL G  R+++RASGTE 
Sbjct: 358 GQDLATVCADWQPYPQTMINVRIQKGQKWQEAS-AGVLAEVEKELEGRGRVVLRASGTEP 416

Query: 419 LIRIMAEGDDLSRIKRIVDDLAKVIP 444
           ++R+M E       K+  + +A  I 
Sbjct: 417 VVRVMVEAKQADWAKKGAERIAAAIQ 442


>gi|313893880|ref|ZP_07827446.1| phosphoglucosamine mutase [Veillonella sp. oral taxon 158 str.
           F0412]
 gi|313441444|gb|EFR59870.1| phosphoglucosamine mutase [Veillonella sp. oral taxon 158 str.
           F0412]
          Length = 450

 Score =  267 bits (681), Expect = 4e-69,   Method: Composition-based stats.
 Identities = 188/444 (42%), Positives = 268/444 (60%), Gaps = 3/444 (0%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M R  FGTDG+RG  N F +TP     +G A    F  +K+H   +IG+DTR+SG MLE+
Sbjct: 1   MAR-LFGTDGVRGVVNEF-LTPELAYHLGRAAATHFGKEKEHPTFLIGRDTRISGSMLES 58

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +L AG  + G +  I G +P+PAVA L R    D G +ISASHNPY DNGIK F  +GYK
Sbjct: 59  ALAAGICSVGGNVVIAGVVPTPAVAYLVRQQGFDAGAVISASHNPYPDNGIKFFDGNGYK 118

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +  ++ED++E  +     + L      G  K     +  +          D +L+G+ IV
Sbjct: 119 LPDEVEDQLEEYVRQSADNELPRPTGDGIGKIEHNSNLAHFYAHFVRHTIDTSLEGMTIV 178

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
            D ANGA+  V PE+   LGA V+ I   P+G+NIN  CGST++  LQ  V +  AD+GI
Sbjct: 179 YDGANGAASSVGPEILAGLGAKVININVNPDGLNINHHCGSTHIEGLQVAVQQHNADLGI 238

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           A DGD DR ++VDEKG +++GDQIM L A +      L+ + +V TVMSNIG  +    L
Sbjct: 239 ANDGDADRCLLVDEKGQVLDGDQIMLLCALKLKEEGKLKDDTVVGTVMSNIGFHKAAQEL 298

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           G+    T VGDRY++EYM+ +  +VGGEQSGH+I  D+ +TGDG++ A+QV   +K+ ++
Sbjct: 299 GMKTFATAVGDRYVLEYMREHNLSVGGEQSGHVIFLDHNTTGDGMLTAVQVAALMKEKNQ 358

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTS-ILNSSSIVQAIADAESELRGIDRLIVRASGTESL 419
           P+S +     +YPQ L +V V   +   ++  I  AI  AE EL    R++VRASGTE L
Sbjct: 359 PLSELAGIMTKYPQVLINVRVATKTGWEDNDIIKAAIVTAEGELGVEGRVLVRASGTEPL 418

Query: 420 IRIMAEGDDLSRIKRIVDDLAKVI 443
           IR+MAEG +   ++ +  ++A +I
Sbjct: 419 IRVMAEGPNQEELQALCQEIADII 442


>gi|113969676|ref|YP_733469.1| phosphoglucosamine mutase [Shewanella sp. MR-4]
 gi|123029816|sp|Q0HKK5|GLMM2_SHESM RecName: Full=Phosphoglucosamine mutase 2
 gi|113884360|gb|ABI38412.1| phosphoglucosamine mutase [Shewanella sp. MR-4]
          Length = 450

 Score =  266 bits (680), Expect = 4e-69,   Method: Composition-based stats.
 Identities = 205/450 (45%), Positives = 295/450 (65%), Gaps = 8/450 (1%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M R++FGTDG+RGK  TFPITP+F MR+G A G +       + V+IGKDTR+SGYMLE+
Sbjct: 1   MSRKYFGTDGVRGKVGTFPITPDFAMRLGWAAGTVLAS-TGTKEVLIGKDTRISGYMLES 59

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           ++ AGF+AAG++  ++GP+P+PAVA L  + RAD GV+ISASHNP+ DNGIK F   G K
Sbjct: 60  AMEAGFSAAGVNVALIGPMPTPAVAYLASTFRADAGVVISASHNPFYDNGIKFFSNTGTK 119

Query: 121 VSTDIEDRIETLLEDDLTSY---LSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGL 177
           ++   E  IE LLE  L          + +G  +R+D    RYIE  K T P  ++L GL
Sbjct: 120 LNDAQELEIEALLEQALEHNALQCVASEKLGKVRRIDDAAGRYIEFCKGTFPNHLSLAGL 179

Query: 178 RIVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRAD 237
           +IVVD A+GA+Y +AP V+ ELGA+V+ I DKPNG+NIN  CG+T++ SLQ  V    AD
Sbjct: 180 KIVVDSAHGAAYHIAPNVYRELGAEVISINDKPNGVNINDHCGATHLDSLQSAVMIHEAD 239

Query: 238 IGIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFI 297
           +GIALDGD DRV+ VD  G +V+GD+I+ ++A+       ++G  + T  MSN+GLE  +
Sbjct: 240 LGIALDGDADRVMFVDHNGHVVDGDEILFILAQAAYQKGEMQGGVVGTL-MSNLGLELAL 298

Query: 298 AGLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQ 357
            G+ +   R +VGDRY++E +K  G+ +GGE SGHI+   + STGDG+VA+LQVL+ + +
Sbjct: 299 KGMDIPFVRAKVGDRYVVEQLKETGWQLGGEGSGHILSLKHASTGDGIVASLQVLKAVLE 358

Query: 358 YDKPVSTICHCFEEYPQFLRSVSVKD---TSILNSSSIVQAIADAESELRGIDRLIVRAS 414
             K ++ +     + PQ L +V +      SIL+  S+ QA+  AE  L    R+++R S
Sbjct: 359 SGKRLAELKAEMTKLPQVLINVRLTSGCADSILSKDSVKQAVIAAEEVLGNQGRVLLRKS 418

Query: 415 GTESLIRIMAEGDDLSRIKRIVDDLAKVIP 444
           GTE LIR+M E  D+S  ++  + +A+ + 
Sbjct: 419 GTEPLIRVMVESTDISLTQQQAEYIAQAVK 448


>gi|315660311|ref|ZP_07913165.1| phosphoglucosamine mutase [Staphylococcus lugdunensis M23590]
 gi|315494648|gb|EFU82989.1| phosphoglucosamine mutase [Staphylococcus lugdunensis M23590]
          Length = 451

 Score =  266 bits (680), Expect = 4e-69,   Method: Composition-based stats.
 Identities = 186/446 (41%), Positives = 277/446 (62%), Gaps = 7/446 (1%)

Query: 4   RFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFR--GKKKHRRVVIGKDTRLSGYMLENS 61
           ++FGTDG+RG +N   +TP    ++G   GY+      + H +V++G+DTR+SG MLE +
Sbjct: 3   KYFGTDGVRGIANK-ELTPELAFKLGRYGGYVLAHNENEAHPKVLVGRDTRVSGEMLEAA 61

Query: 62  LVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKV 121
           L+AG  + G +   LG I +P VA LT+ + A++GVMISASHNP  DNGIK FG DG+K+
Sbjct: 62  LIAGLVSIGAEVMRLGVISTPGVAYLTKEMGAELGVMISASHNPVADNGIKFFGSDGFKL 121

Query: 122 STDIEDRIETLLEDDLTSYLSCYDS-IGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           S D E+ IE LLE             I H         +Y+  +K T+   V L+G++I 
Sbjct: 122 SDDQENEIEALLEQQNPELPRPVGQDIVHYSDYFEGAQKYLSFLKSTVD--VNLEGMKIA 179

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           +D ANG++  +AP +F +L AD   IG  P+G NIN +CGST+  +L + V E  +D G+
Sbjct: 180 LDGANGSTSSLAPFLFGDLEADTETIGCSPDGYNINENCGSTHPENLAKTVLETNSDFGL 239

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           A DGDGDR+I VDE G IV+GDQIM +I +    +  L+ + IV+TVMSN+G  + +   
Sbjct: 240 AFDGDGDRIIAVDENGQIVDGDQIMFIIGQAMHKNQELKKDMIVSTVMSNLGFYKALENE 299

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           G++  +T+VGDRY++E M+   +N+GGEQSGHI++ DY +TGDGL+  +Q+   IK   K
Sbjct: 300 GIASNKTKVGDRYVVEEMRKGDYNLGGEQSGHIVMMDYNTTGDGLLTGIQLASIIKMSGK 359

Query: 361 PVSTICHCFEEYPQFLRSVSVKDT-SILNSSSIVQAIADAESELRGIDRLIVRASGTESL 419
           P+S +    ++YPQ L +V V D  ++  +  +   IA  E+E+ G  R++VR SGTE L
Sbjct: 360 PLSELAAQMKKYPQSLINVRVTDKYNVEKNEDVKAEIAKVEAEMNGEGRILVRPSGTEPL 419

Query: 420 IRIMAEGDDLSRIKRIVDDLAKVIPM 445
           +R+M E        R  + +A+V+  
Sbjct: 420 VRVMVEASTDDNANRYAEQIAQVVEA 445


>gi|167902202|ref|ZP_02489407.1| phosphoglucosamine mutase [Burkholderia pseudomallei NCTC 13177]
          Length = 452

 Score =  266 bits (680), Expect = 4e-69,   Method: Composition-based stats.
 Identities = 198/455 (43%), Positives = 280/455 (61%), Gaps = 10/455 (2%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFR------GKKKHRRVVIGKDTRLS 54
           M RR+FGTDGIRGK    PITP+F++R+G A G +               V+IGKDTR+S
Sbjct: 1   MGRRYFGTDGIRGKVGDAPITPDFVLRLGYAAGKVLASAPGRAASGARPTVLIGKDTRVS 60

Query: 55  GYMLENSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLF 114
           GYMLE +L AGF+AAG+D  + GP+P+P VA LTR+LR   GV+ISASHNPY DNGIK F
Sbjct: 61  GYMLEAALEAGFSAAGVDVMLAGPMPTPGVAYLTRALRLSAGVVISASHNPYHDNGIKFF 120

Query: 115 GPDGYKVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTL 174
             DG K+  +IE  IE  L   L    +  D +G A+R+D    RYIE  K T P    L
Sbjct: 121 SADGNKLPDEIEAEIEAWLNKPLD--CAASDGLGKARRLDDAAGRYIEFCKSTFPAAFDL 178

Query: 175 QGLRIVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEV 234
           +G+++VVDCA+GA+Y+VAP VF ELGADV+ IG  PNG NIN   G+T   +L R V   
Sbjct: 179 RGMKLVVDCAHGAAYQVAPHVFHELGADVIPIGVAPNGFNINDGVGATAPDALMRAVRAN 238

Query: 235 RADIGIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLE 294
            AD+GIALDGD DR+++VD  G + NGD+++ ++ ++ ++ +      + T  M+N  +E
Sbjct: 239 HADLGIALDGDADRLLVVDHTGRLYNGDELLYVLVKDRIATNGQVEGAVGTL-MTNFAVE 297

Query: 295 RFIAGLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRY 354
             +   G+   R  VGDRY++E ++  G+ +G E SGHI+  D  STGDG+V+AL VL  
Sbjct: 298 VALKEAGVQFVRAAVGDRYVLEQLRERGWQLGAEGSGHILSLDRHSTGDGIVSALLVLAA 357

Query: 355 IKQYDKPVSTICHCFEEYPQFLRSVSVKDTSILNS-SSIVQAIADAESELRGIDRLIVRA 413
           +K+  K ++ +      +PQ L +V VK  +      +I +AI  AE  L G  R+++RA
Sbjct: 358 LKRSGKTLAQMLEGVTLFPQKLINVRVKPGADWKGSEAIRRAIDSAEQALSGSGRVLIRA 417

Query: 414 SGTESLIRIMAEGDDLSRIKRIVDDLAKVIPMIDS 448
           SGTE ++R+M E    +   R  + +A  +    +
Sbjct: 418 SGTEPVLRVMVEARQATDANRHAEAIADAVKQATA 452


>gi|254428994|ref|ZP_05042701.1| phosphoglucosamine mutase [Alcanivorax sp. DG881]
 gi|196195163|gb|EDX90122.1| phosphoglucosamine mutase [Alcanivorax sp. DG881]
          Length = 444

 Score =  266 bits (680), Expect = 5e-69,   Method: Composition-based stats.
 Identities = 199/446 (44%), Positives = 296/446 (66%), Gaps = 6/446 (1%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M R++FGTDG+RG    FPITP+F++++G A G +   +    +++IGKDTR+SGYM E+
Sbjct: 1   MTRKYFGTDGVRGTVGEFPITPDFVLKLGWAAGKVLAARGG-SKILIGKDTRISGYMFES 59

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +L AG +AAG+D  +LGP+P+P +A LTR+L A  G++ISASHNPY DNGIK FG DG K
Sbjct: 60  ALEAGISAAGVDVRLLGPLPTPGIAYLTRTLSAQAGIVISASHNPYTDNGIKFFGADGRK 119

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           ++ +IE  IE LL+++++   +  D IG  +R+D    RYIE  K T+P  + L G++IV
Sbjct: 120 LNDEIELEIERLLDEEISVVST--DQIGKVRRIDDARGRYIEFCKSTVPG-LDLSGMKIV 176

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           VD ANGA+Y +AP+VF ELGA VV + ++P+G NIN DCGST+  +LQR+V E +AD+G+
Sbjct: 177 VDTANGAAYHIAPDVFEELGATVVPLANQPDGFNINRDCGSTHPEALQRRVLEEKADLGV 236

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           ALDGD DR+++VD  G +V+GDQ++ ++AR+    +     G+V T+MSN GLE  +   
Sbjct: 237 ALDGDADRLLMVDHAGKLVDGDQLLFVVARDR-KDNGADMPGVVGTLMSNFGLELALEAE 295

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           G+   R +VGDRY+ME +   G+++GGE SGH++  D  STGDG V+ALQVL  + +  +
Sbjct: 296 GIEFVRAKVGDRYVMEQLDKRGWSIGGESSGHLVCLDCTSTGDGTVSALQVLAALSRRKQ 355

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTSIL-NSSSIVQAIADAESELRGIDRLIVRASGTESL 419
            ++         PQ + +V   +         +  A+A  E  L G  R+++R SGTE L
Sbjct: 356 GLAEAVADVAMLPQQMINVRGPNRDGFMQHPDVQAAMASVEERLAGNGRVLLRPSGTEPL 415

Query: 420 IRIMAEGDDLSRIKRIVDDLAKVIPM 445
           +R+M EG D  ++  +  +LA V+  
Sbjct: 416 VRVMIEGKDGDQVAALCRELADVVEK 441


>gi|47570174|ref|ZP_00240829.1| phosphoglucosamine mutase [Bacillus cereus G9241]
 gi|47553153|gb|EAL11549.1| phosphoglucosamine mutase [Bacillus cereus G9241]
          Length = 448

 Score =  266 bits (679), Expect = 5e-69,   Method: Composition-based stats.
 Identities = 193/444 (43%), Positives = 276/444 (62%), Gaps = 5/444 (1%)

Query: 4   RFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSLV 63
           ++FGTDG+RG +N   +TP    +IG   GY+        +V+IG+DTR+SG+MLE +LV
Sbjct: 3   KYFGTDGVRGVANQ-ELTPELAFKIGRFGGYVLTKDTDRPKVIIGRDTRISGHMLEGALV 61

Query: 64  AGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVST 123
           AG  + G +   LG I +P VA LT++L A  GVMISASHNP QDNGIK FG DG+K++ 
Sbjct: 62  AGLLSTGAEVMRLGVISTPGVAYLTKALDAQAGVMISASHNPVQDNGIKFFGSDGFKLTD 121

Query: 124 DIEDRIETLLEDDLTSYLSCYD-SIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVVD 182
           + E  IE LL+ ++         ++G          +Y++++K+T+  +    GL I +D
Sbjct: 122 EQEAEIEALLDKEVDELPRPTGTNLGQVSDYFEGGQKYLQYIKQTV--EEDFSGLHIALD 179

Query: 183 CANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIAL 242
           CA+GA+  +AP +F +L AD+  +G  PNG+NIN   GST+   L   V E  ADIG+A 
Sbjct: 180 CAHGATSSLAPYLFADLEADISTMGTSPNGMNINDGVGSTHPEVLAELVKEKGADIGLAF 239

Query: 243 DGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLGL 302
           DGDGDR+I VDEKG IV+GDQIM + A+       L+ N +V+TVMSN+G  + +    +
Sbjct: 240 DGDGDRLIAVDEKGNIVDGDQIMFICAKYMKETGQLKHNTVVSTVMSNLGFYKALEANNI 299

Query: 303 SLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKPV 362
           +  +T VGDRY+ME MK  G+N+GGEQSGHIIL DY +TGDG+++ALQ++  +K   KP+
Sbjct: 300 TSDKTAVGDRYVMEEMKRGGYNLGGEQSGHIILLDYITTGDGMLSALQLVNIMKMTKKPL 359

Query: 363 STICHCFEEYPQFLRSVSVKDTS-ILNSSSIVQAIADAESELRGIDRLIVRASGTESLIR 421
           S +     ++PQ L +V V D    L +  I + I   E E+ G  R++VR SGTE LIR
Sbjct: 360 SELAGEMTKFPQLLVNVRVTDKKLALENEKIKEIIRVVEEEMNGDGRILVRPSGTEPLIR 419

Query: 422 IMAEGDDLSRIKRIVDDLAKVIPM 445
           +MAE          V  + +V+  
Sbjct: 420 VMAEAPTQEVCDAYVHRIVEVVKA 443


>gi|126735424|ref|ZP_01751170.1| Phosphoglucomutase/phosphomannomutase [Roseobacter sp. CCS2]
 gi|126715979|gb|EBA12844.1| Phosphoglucomutase/phosphomannomutase [Roseobacter sp. CCS2]
          Length = 456

 Score =  266 bits (679), Expect = 5e-69,   Method: Composition-based stats.
 Identities = 229/447 (51%), Positives = 312/447 (69%), Gaps = 4/447 (0%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKK-KHRRVVIGKDTRLSGYMLE 59
           M R+FFGTDG+RGK+NT P+T +  ++IG A G  FR       RVVIGKDTRLSGYM E
Sbjct: 10  MTRKFFGTDGVRGKANTHPMTADMALKIGAAAGRYFRNDGSNGHRVVIGKDTRLSGYMFE 69

Query: 60  NSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGY 119
           N+L AG T+ GM+  +LGP+P+PAV +LT S+RADVG+MISASHNP+ DNGIK FGPDG+
Sbjct: 70  NALTAGLTSTGMNVLLLGPVPTPAVGLLTTSMRADVGIMISASHNPHHDNGIKFFGPDGF 129

Query: 120 KVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRI 179
           K+S + E  IETL+  ++    +   +IG AKR+D    RY E +K T P  + L GL++
Sbjct: 130 KLSDEAETEIETLIASEIEPAKAQ--NIGRAKRIDDGRFRYAERIKSTFPAGMRLDGLKV 187

Query: 180 VVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIG 239
           V+DCANGA+Y+VAPEV WELGA V+ +G  P+G NIN  CGST+  +  + + E  A +G
Sbjct: 188 VIDCANGAAYRVAPEVLWELGATVIPVGVSPDGFNINDGCGSTSTAAASKAILEEGAHVG 247

Query: 240 IALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAG 299
           I LDGD DRV+I+DEKG + +GDQ+MAL+A  W     L G  +V TVMSN+GLER++ G
Sbjct: 248 ICLDGDADRVMILDEKGQVADGDQLMALMAGRWADQDRLNGGTLVATVMSNLGLERYLDG 307

Query: 300 LGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYD 359
            GL L RT VGDRY++E M+ NG+N+GGEQSGHI+++D+ +TGDGL+A LQ L  + +  
Sbjct: 308 RGLHLTRTAVGDRYVVEAMRANGWNLGGEQSGHIVMTDFATTGDGLLAGLQFLAAMIETG 367

Query: 360 KPVSTICHCFEEYPQFLRSVSV-KDTSILNSSSIVQAIADAESELRGIDRLIVRASGTES 418
           +P S +   FE  PQ L++V        L +  + ++IAD ES+L G  RL++R SGTE 
Sbjct: 368 QPASALTKSFETVPQMLKNVRYAAGQDPLGAELVQKSIADGESKLVGKGRLLIRKSGTEP 427

Query: 419 LIRIMAEGDDLSRIKRIVDDLAKVIPM 445
           LIR+MAE +D + + ++VD +   +  
Sbjct: 428 LIRVMAECEDDALLAQVVDGIVAEVEA 454


>gi|15612830|ref|NP_241133.1| phosphoglucosamine mutase [Bacillus halodurans C-125]
 gi|81788154|sp|Q9KG46|GLMM_BACHD RecName: Full=Phosphoglucosamine mutase
 gi|10172879|dbj|BAB03986.1| phosphoglucosamine mutase [Bacillus halodurans C-125]
          Length = 447

 Score =  266 bits (679), Expect = 5e-69,   Method: Composition-based stats.
 Identities = 192/443 (43%), Positives = 282/443 (63%), Gaps = 4/443 (0%)

Query: 4   RFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSLV 63
           ++FGTDG+RG +NT  +TP    ++G   GY+    K++ +V+IG+DTR+SG MLE +LV
Sbjct: 3   KYFGTDGVRGVANT-ELTPELAFKLGRIGGYVLTKDKENPKVLIGRDTRISGEMLEGALV 61

Query: 64  AGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVST 123
           AG  + G++   LG I +P VA LT+++ A  GVMISASHNP  DNGIK FGPDG+K+  
Sbjct: 62  AGLLSIGVEVMRLGVISTPGVAFLTKAVSASAGVMISASHNPVADNGIKFFGPDGFKLLD 121

Query: 124 DIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVVDC 183
           + E  IETLL+ +          +G A        +Y++ +K+T+  D T  G+ I +DC
Sbjct: 122 EQEKEIETLLDQEDALPRPTGADLGQANDYFEGAQKYLQFLKQTVDEDFT--GIHIALDC 179

Query: 184 ANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIALD 243
           ANGA+  +AP +F +L AD+  +G  PNG NIN   GST+  +L   V+   ADIG+A D
Sbjct: 180 ANGAASSLAPHLFADLEADISTMGTSPNGKNINDGVGSTHPEALAAFVNAKNADIGLAFD 239

Query: 244 GDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLGLS 303
           GD DR+I VDEKG IV+GD+I+ + A+      LL+   +VTTVMSN+GL + +  L + 
Sbjct: 240 GDADRLIAVDEKGNIVDGDKILYICAKYMKEKGLLKQQTLVTTVMSNLGLYKALEALQID 299

Query: 304 LKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKPVS 363
            K+T VGDRY+ME M+  G+N+GGEQSGHII  D+ +TGDG+++ALQ++  +KQ  K +S
Sbjct: 300 TKQTAVGDRYVMEEMRKGGYNLGGEQSGHIIFLDHITTGDGMLSALQLVNIMKQTGKKLS 359

Query: 364 TICHCFEEYPQFLRSVSVKDT-SILNSSSIVQAIADAESELRGIDRLIVRASGTESLIRI 422
            +   +E +PQ L ++ V D  ++ ++  +   I + E E+ G  R++VR SGTE L+RI
Sbjct: 360 ELAEEWETFPQTLVNIRVTDKHAVTDNEKVPAVIKEVEQEMNGEGRVLVRPSGTEPLVRI 419

Query: 423 MAEGDDLSRIKRIVDDLAKVIPM 445
           M E          V+ +A V+  
Sbjct: 420 MVEAKTEELCDAFVNKIADVVKA 442


>gi|114046904|ref|YP_737454.1| phosphoglucosamine mutase [Shewanella sp. MR-7]
 gi|123326693|sp|Q0HWV8|GLMM2_SHESR RecName: Full=Phosphoglucosamine mutase 2
 gi|113888346|gb|ABI42397.1| phosphoglucosamine mutase [Shewanella sp. MR-7]
          Length = 450

 Score =  266 bits (679), Expect = 5e-69,   Method: Composition-based stats.
 Identities = 205/450 (45%), Positives = 295/450 (65%), Gaps = 8/450 (1%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M R++FGTDG+RGK  TFPITP+F M++G A G +       + V+IGKDTR+SGYMLE+
Sbjct: 1   MSRKYFGTDGVRGKVGTFPITPDFAMKLGWAAGTVLAS-TGTKEVLIGKDTRISGYMLES 59

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           ++ AGF+AAG++  ++GP+P+PAVA L  + RAD GV+ISASHNP+ DNGIK F   G K
Sbjct: 60  AMEAGFSAAGVNVALIGPMPTPAVAYLASTFRADAGVVISASHNPFYDNGIKFFSNTGTK 119

Query: 121 VSTDIEDRIETLLEDDLTSY---LSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGL 177
           ++   E  IE LLE  L          + +G  +R+D    RYIE  K T P  ++L GL
Sbjct: 120 LNDAQELEIEALLEQALEHNALQCVASEKLGKVRRIDDAAGRYIEFCKGTFPNHLSLAGL 179

Query: 178 RIVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRAD 237
           +IVVD A+GA+Y +AP V+ ELGA+V+ I DKPNG+NIN  CG+T++ SLQ  V    AD
Sbjct: 180 KIVVDSAHGAAYHIAPNVYRELGAEVISINDKPNGVNINDHCGATHLDSLQSAVMIHEAD 239

Query: 238 IGIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFI 297
           +GIALDGD DRV+ VD  G +V+GD+I+ ++A+       ++G  + T  MSN+GLE  +
Sbjct: 240 LGIALDGDADRVMFVDHNGHVVDGDEILFILAQAAYQKGEMQGGVVGTL-MSNLGLELAL 298

Query: 298 AGLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQ 357
             +G+   R +VGDRY++E +K  G+ +GGE SGHI+   + STGDG+VA+LQVL+ I +
Sbjct: 299 KQMGIPFLRAKVGDRYVVEQLKETGWQLGGEGSGHILSLQHASTGDGIVASLQVLKAILE 358

Query: 358 YDKPVSTICHCFEEYPQFLRSVSVKD---TSILNSSSIVQAIADAESELRGIDRLIVRAS 414
             K ++ +     + PQ L +V +      SIL+  S+ QA+  AE  L    R+++R S
Sbjct: 359 SGKRLAELKAGMTKLPQVLINVRLTSGSADSILSKDSVKQAVITAEEVLGNQGRVLLRKS 418

Query: 415 GTESLIRIMAEGDDLSRIKRIVDDLAKVIP 444
           GTE LIR+M E  D+S  ++  + +A+ + 
Sbjct: 419 GTEPLIRVMVESTDISLTQQQAEYIAQAVK 448


>gi|152979087|ref|YP_001344716.1| phosphoglucosamine mutase [Actinobacillus succinogenes 130Z]
 gi|171704300|sp|A6VP84|GLMM_ACTSZ RecName: Full=Phosphoglucosamine mutase
 gi|150840810|gb|ABR74781.1| phosphoglucosamine mutase [Actinobacillus succinogenes 130Z]
          Length = 444

 Score =  266 bits (679), Expect = 5e-69,   Method: Composition-based stats.
 Identities = 204/445 (45%), Positives = 298/445 (66%), Gaps = 5/445 (1%)

Query: 2   KRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENS 61
           +R++FGTDG+RGK  +FPITP+F +++G A G +       ++V+IGKDTR+SGYMLE++
Sbjct: 3   ERKYFGTDGVRGKVGSFPITPDFALKLGWAAGKVLATHG-SKKVLIGKDTRISGYMLESA 61

Query: 62  LVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKV 121
           L AG TAAG+ A  +GP+P+PAVA LTR+ RA+ GV+ISASHNPY DNGIK F  +G K+
Sbjct: 62  LEAGLTAAGLSAVFVGPMPTPAVAYLTRTFRAEAGVVISASHNPYDDNGIKFFSAEGTKL 121

Query: 122 STDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVV 181
             D+E+ IE LLE  +         +G A R++    RYIE  K T P  ++L+G +IVV
Sbjct: 122 PDDVEEAIEALLEQPMD--CVESAELGKASRINDAAGRYIEFCKSTFPTSLSLEGYKIVV 179

Query: 182 DCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIA 241
           DCA+GA+Y +AP V  ELGA+++ IG KPNG+NIN  CG+T++ +L+ KV E+ AD+G+A
Sbjct: 180 DCAHGATYHIAPSVLRELGAEIIEIGTKPNGLNINEKCGATDIEALRHKVLEIGADVGLA 239

Query: 242 LDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLG 301
            DGDGDR+++VD  G  V+GDQI+ +IARE +        G+V T+MSN+ LE  +  LG
Sbjct: 240 YDGDGDRIMMVDHLGNKVDGDQILYIIARETLRA-GHLKGGVVGTLMSNMSLEIALKQLG 298

Query: 302 LSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKP 361
           +   R  VGDRY++E M+ NG+ +GGE SGHII+ D  +TGDG++A+L VL  + Q+   
Sbjct: 299 IPFLRANVGDRYVLEKMQENGWKLGGENSGHIIILDKNTTGDGIIASLAVLTAMAQHKLS 358

Query: 362 VSTICHCFEEYPQFLRSVSVK-DTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
           +  +    + +PQ L +V      + LNS  +    A+ E  L G  R+++R SGTE LI
Sbjct: 359 LHELTGAVKLFPQVLINVRFAGGENPLNSEKVKAVAAEVEQRLAGKGRILLRKSGTEPLI 418

Query: 421 RIMAEGDDLSRIKRIVDDLAKVIPM 445
           R+M E +D    ++  +++A+ +  
Sbjct: 419 RVMVECEDAVLAQKSAEEIAEAVKN 443


>gi|118475923|ref|YP_893074.1| phosphoglucosamine mutase [Bacillus thuringiensis str. Al Hakam]
 gi|158512484|sp|A0R8M4|GLMM_BACAH RecName: Full=Phosphoglucosamine mutase
 gi|118415148|gb|ABK83567.1| phosphoglucosamine mutase [Bacillus thuringiensis str. Al Hakam]
          Length = 448

 Score =  266 bits (679), Expect = 5e-69,   Method: Composition-based stats.
 Identities = 193/444 (43%), Positives = 276/444 (62%), Gaps = 5/444 (1%)

Query: 4   RFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSLV 63
           ++FGTDG+RG +N   +TP    +IG   GY+        +V+IG+DTR+SG+MLE +LV
Sbjct: 3   KYFGTDGVRGVANQ-ELTPELAFKIGRFGGYVLTKDTDRPKVIIGRDTRISGHMLEGALV 61

Query: 64  AGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVST 123
           AG  + G +   LG I +P VA LT++L A  GVMISASHNP QDNGIK FG DG+K++ 
Sbjct: 62  AGLLSTGAEVMRLGVISTPGVAYLTKALDAQAGVMISASHNPVQDNGIKFFGSDGFKLTD 121

Query: 124 DIEDRIETLLEDDLTSYLSCYD-SIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVVD 182
           + E  IE LL+ ++         ++G          +Y++++K+T+  +    GL I +D
Sbjct: 122 EQEAEIEALLDKEVDELPRPTGTNLGQVSDYFEGGQKYLQYIKQTV--EEDFSGLHIALD 179

Query: 183 CANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIAL 242
           CA+GA+  +AP +F +L AD+  +G  PNG+NIN   GST+   L   V E  ADIG+A 
Sbjct: 180 CAHGATSSLAPYLFADLEADISTMGTSPNGMNINDGVGSTHPEVLAELVKEKGADIGLAF 239

Query: 243 DGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLGL 302
           DGDGDR+I VDEKG IV+GDQIM + A+       L+ N +V+TVMSN+G  + +    +
Sbjct: 240 DGDGDRLIAVDEKGNIVDGDQIMFICAKYMKETGQLKHNTVVSTVMSNLGFYKALEANDI 299

Query: 303 SLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKPV 362
           +  +T VGDRY+ME MK  G+N+GGEQSGHIIL DY +TGDG+++ALQ++  +K   KP+
Sbjct: 300 TSDKTAVGDRYVMEEMKRGGYNLGGEQSGHIILLDYITTGDGMLSALQLVNIMKMTKKPL 359

Query: 363 STICHCFEEYPQFLRSVSVKDTS-ILNSSSIVQAIADAESELRGIDRLIVRASGTESLIR 421
           S +     ++PQ L +V V D    L +  I + I   E E+ G  R++VR SGTE LIR
Sbjct: 360 SELAGEMTKFPQLLVNVRVTDKKLALENEKIKEIIRVVEEEMNGDGRILVRPSGTEPLIR 419

Query: 422 IMAEGDDLSRIKRIVDDLAKVIPM 445
           +MAE          V  + +V+  
Sbjct: 420 VMAEAPTQEVCDAYVHRIVEVVKA 443


>gi|134298172|ref|YP_001111668.1| phosphoglucosamine mutase [Desulfotomaculum reducens MI-1]
 gi|172044251|sp|A4J190|GLMM_DESRM RecName: Full=Phosphoglucosamine mutase
 gi|134050872|gb|ABO48843.1| phosphoglucosamine mutase [Desulfotomaculum reducens MI-1]
          Length = 444

 Score =  266 bits (679), Expect = 5e-69,   Method: Composition-based stats.
 Identities = 201/448 (44%), Positives = 290/448 (64%), Gaps = 6/448 (1%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M +  FGTDG+RG +NT  +T     R+G A  ++   +   ++++IG+DTR+SG MLE 
Sbjct: 1   MAK-LFGTDGVRGVANT-ELTAELAFRLGRAGAHVLTRQGHSKKIIIGRDTRISGDMLEA 58

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +LVAG  + G+D + +G +P+P +A LTR L A  GV+ISASHNP QDNGIK FGP GYK
Sbjct: 59  ALVAGICSVGVDVYKIGVLPTPGIAYLTRKLGAGAGVVISASHNPVQDNGIKFFGPSGYK 118

Query: 121 VSTDIEDRIETLLEDDLTS-YLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRI 179
           +  ++E +IE L  DD           +G    V+   D+Y++  K T+     L+GL+I
Sbjct: 119 LPDELESQIEKLALDDQAELPRPTGGELGRLYYVEDAVDQYVDFAKATI--STDLKGLKI 176

Query: 180 VVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIG 239
           VVDCANGA+Y VAP +  ELGA+V+ I  +P+G+NIN  CGST+  +L  +V +  AD+G
Sbjct: 177 VVDCANGAAYAVAPRILSELGAEVIPIFHRPDGVNINAHCGSTHPETLMEEVVKQGADLG 236

Query: 240 IALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAG 299
           +A DGD DRV+ VD  G +V+GDQIM L A+   S   LR N  V TVMSN+GL + +  
Sbjct: 237 LAHDGDADRVLAVDHLGNLVDGDQIMVLCAKHLKSKGKLRKNTTVVTVMSNLGLYKALER 296

Query: 300 LGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYD 359
            G+ +  T+VGDRY++E +   G   GGEQSGHII   + +TGDG++ ALQ+L  +K+  
Sbjct: 297 SGIEVVETKVGDRYVLEKLLETGARFGGEQSGHIIFLQHNTTGDGIITALQLLAVVKETG 356

Query: 360 KPVSTICHCFEEYPQFLRSVSVKDTS-ILNSSSIVQAIADAESELRGIDRLIVRASGTES 418
             ++ +    E YPQ L++V VKD + ++NS  I +AI   E +L G  R++VR SGTE 
Sbjct: 357 MSLAQLAGQMERYPQILKNVQVKDKNYVMNSPIISEAIRRFERDLAGQGRILVRPSGTEP 416

Query: 419 LIRIMAEGDDLSRIKRIVDDLAKVIPMI 446
           L+RIM EG D++ ++ IVD +A+++  I
Sbjct: 417 LVRIMVEGKDMAELQSIVDKMAEIVGNI 444


>gi|30260346|ref|NP_842723.1| phosphoglucosamine mutase [Bacillus anthracis str. Ames]
 gi|47525415|ref|YP_016764.1| phosphoglucosamine mutase [Bacillus anthracis str. 'Ames Ancestor']
 gi|49183191|ref|YP_026443.1| phosphoglucosamine mutase [Bacillus anthracis str. Sterne]
 gi|49476725|ref|YP_034507.1| phosphoglucosamine mutase [Bacillus thuringiensis serovar konkukian
           str. 97-27]
 gi|52145063|ref|YP_081766.1| phosphoglucosamine mutase [Bacillus cereus E33L]
 gi|65317600|ref|ZP_00390559.1| COG1109: Phosphomannomutase [Bacillus anthracis str. A2012]
 gi|165871605|ref|ZP_02216251.1| phosphoglucosamine mutase [Bacillus anthracis str. A0488]
 gi|167634178|ref|ZP_02392500.1| phosphoglucosamine mutase [Bacillus anthracis str. A0442]
 gi|167640305|ref|ZP_02398570.1| phosphoglucosamine mutase [Bacillus anthracis str. A0193]
 gi|170687782|ref|ZP_02878997.1| phosphoglucosamine mutase [Bacillus anthracis str. A0465]
 gi|170707907|ref|ZP_02898357.1| phosphoglucosamine mutase [Bacillus anthracis str. A0389]
 gi|177653399|ref|ZP_02935609.1| phosphoglucosamine mutase [Bacillus anthracis str. A0174]
 gi|190567394|ref|ZP_03020308.1| phosphoglucosamine mutase [Bacillus anthracis Tsiankovskii-I]
 gi|196036017|ref|ZP_03103418.1| phosphoglucosamine mutase [Bacillus cereus W]
 gi|196041158|ref|ZP_03108454.1| phosphoglucosamine mutase [Bacillus cereus NVH0597-99]
 gi|196046219|ref|ZP_03113446.1| phosphoglucosamine mutase [Bacillus cereus 03BB108]
 gi|206978027|ref|ZP_03238912.1| phosphoglucosamine mutase [Bacillus cereus H3081.97]
 gi|217957731|ref|YP_002336275.1| phosphoglucosamine mutase [Bacillus cereus AH187]
 gi|218901361|ref|YP_002449195.1| phosphoglucosamine mutase [Bacillus cereus AH820]
 gi|222093926|ref|YP_002527977.1| phosphoglucosamine mutase [Bacillus cereus Q1]
 gi|225862208|ref|YP_002747586.1| phosphoglucosamine mutase [Bacillus cereus 03BB102]
 gi|227812830|ref|YP_002812839.1| phosphoglucosamine mutase [Bacillus anthracis str. CDC 684]
 gi|229601789|ref|YP_002864806.1| phosphoglucosamine mutase [Bacillus anthracis str. A0248]
 gi|254686504|ref|ZP_05150363.1| phosphoglucosamine mutase [Bacillus anthracis str. CNEVA-9066]
 gi|254723655|ref|ZP_05185442.1| phosphoglucosamine mutase [Bacillus anthracis str. A1055]
 gi|254735023|ref|ZP_05192735.1| phosphoglucosamine mutase [Bacillus anthracis str. Western North
           America USA6153]
 gi|254739801|ref|ZP_05197494.1| phosphoglucosamine mutase [Bacillus anthracis str. Kruger B]
 gi|254754820|ref|ZP_05206855.1| phosphoglucosamine mutase [Bacillus anthracis str. Vollum]
 gi|254756869|ref|ZP_05208897.1| phosphoglucosamine mutase [Bacillus anthracis str. Australia 94]
 gi|301051893|ref|YP_003790104.1| phosphoglucosamine mutase [Bacillus anthracis CI]
 gi|81614029|sp|Q6HPL3|GLMM_BACHK RecName: Full=Phosphoglucosamine mutase
 gi|81689809|sp|Q63H45|GLMM_BACCZ RecName: Full=Phosphoglucosamine mutase
 gi|81715478|sp|Q81VN7|GLMM_BACAN RecName: Full=Phosphoglucosamine mutase
 gi|226722707|sp|B7JL64|GLMM_BACC0 RecName: Full=Phosphoglucosamine mutase
 gi|226722710|sp|B7HQZ0|GLMM_BACC7 RecName: Full=Phosphoglucosamine mutase
 gi|254798012|sp|C3PAL5|GLMM_BACAA RecName: Full=Phosphoglucosamine mutase
 gi|254798331|sp|C3LJZ1|GLMM_BACAC RecName: Full=Phosphoglucosamine mutase
 gi|254798561|sp|C1EU11|GLMM_BACC3 RecName: Full=Phosphoglucosamine mutase
 gi|254798562|sp|B9J0F1|GLMM_BACCQ RecName: Full=Phosphoglucosamine mutase
 gi|30253667|gb|AAP24209.1| phosphoglucosamine mutase [Bacillus anthracis str. Ames]
 gi|47500563|gb|AAT29239.1| phosphoglucosamine mutase [Bacillus anthracis str. 'Ames Ancestor']
 gi|49177118|gb|AAT52494.1| phosphoglucosamine mutase [Bacillus anthracis str. Sterne]
 gi|49328281|gb|AAT58927.1| phosphoglucosamine mutase [Bacillus thuringiensis serovar konkukian
           str. 97-27]
 gi|51978532|gb|AAU20082.1| phosphoglucosamine mutase [Bacillus cereus E33L]
 gi|164712709|gb|EDR18240.1| phosphoglucosamine mutase [Bacillus anthracis str. A0488]
 gi|167511707|gb|EDR87088.1| phosphoglucosamine mutase [Bacillus anthracis str. A0193]
 gi|167530492|gb|EDR93207.1| phosphoglucosamine mutase [Bacillus anthracis str. A0442]
 gi|170127265|gb|EDS96142.1| phosphoglucosamine mutase [Bacillus anthracis str. A0389]
 gi|170668309|gb|EDT19057.1| phosphoglucosamine mutase [Bacillus anthracis str. A0465]
 gi|172081439|gb|EDT66512.1| phosphoglucosamine mutase [Bacillus anthracis str. A0174]
 gi|190561521|gb|EDV15492.1| phosphoglucosamine mutase [Bacillus anthracis Tsiankovskii-I]
 gi|195991386|gb|EDX55353.1| phosphoglucosamine mutase [Bacillus cereus W]
 gi|196022964|gb|EDX61644.1| phosphoglucosamine mutase [Bacillus cereus 03BB108]
 gi|196028093|gb|EDX66704.1| phosphoglucosamine mutase [Bacillus cereus NVH0597-99]
 gi|206743740|gb|EDZ55162.1| phosphoglucosamine mutase [Bacillus cereus H3081.97]
 gi|217064322|gb|ACJ78572.1| phosphoglucosamine mutase [Bacillus cereus AH187]
 gi|218536521|gb|ACK88919.1| phosphoglucosamine mutase [Bacillus cereus AH820]
 gi|221237975|gb|ACM10685.1| phosphoglucosamine mutase [Bacillus cereus Q1]
 gi|225789891|gb|ACO30108.1| phosphoglucosamine mutase [Bacillus cereus 03BB102]
 gi|227005948|gb|ACP15691.1| phosphoglucosamine mutase [Bacillus anthracis str. CDC 684]
 gi|229266197|gb|ACQ47834.1| phosphoglucosamine mutase [Bacillus anthracis str. A0248]
 gi|300374062|gb|ADK02966.1| phosphoglucosamine mutase [Bacillus cereus biovar anthracis str.
           CI]
 gi|324324147|gb|ADY19407.1| phosphoglucosamine mutase [Bacillus thuringiensis serovar finitimus
           YBT-020]
          Length = 448

 Score =  266 bits (679), Expect = 5e-69,   Method: Composition-based stats.
 Identities = 194/444 (43%), Positives = 277/444 (62%), Gaps = 5/444 (1%)

Query: 4   RFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSLV 63
           ++FGTDG+RG +N   +TP    +IG   GY+        +V+IG+DTR+SG+MLE +LV
Sbjct: 3   KYFGTDGVRGVANK-ELTPELAFKIGRFGGYVLTKDTDRPKVIIGRDTRISGHMLEGALV 61

Query: 64  AGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVST 123
           AG  + G +   LG I +P VA LT++L A  GVMISASHNP QDNGIK FG DG+K++ 
Sbjct: 62  AGLLSTGAEVMRLGVISTPGVAYLTKALDAQAGVMISASHNPVQDNGIKFFGSDGFKLTD 121

Query: 124 DIEDRIETLLEDDLTSYLSCYD-SIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVVD 182
           + E  IE LL+ ++         ++G          +Y++++K+T+  +    GL I +D
Sbjct: 122 EQEAEIEALLDKEVDELPRPTGTNLGQVSDYFEGGQKYLQYIKQTV--EEDFSGLHIALD 179

Query: 183 CANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIAL 242
           CA+GA+  +AP +F +L AD+  +G  PNG+NIN   GST+   L   V E  ADIG+A 
Sbjct: 180 CAHGATSSLAPYLFADLEADISTMGTSPNGMNINDGVGSTHPEVLAELVKEKGADIGLAF 239

Query: 243 DGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLGL 302
           DGDGDR+I VDEKG IV+GDQIM + A+       L+ N +V+TVMSN+G  + +   G+
Sbjct: 240 DGDGDRLIAVDEKGNIVDGDQIMFICAKYMKETGQLKHNTVVSTVMSNLGFYKALEANGI 299

Query: 303 SLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKPV 362
           +  +T VGDRY+ME MK  G+N+GGEQSGHIIL DY +TGDG+++ALQ++  +K   KP+
Sbjct: 300 TSDKTAVGDRYVMEEMKRGGYNLGGEQSGHIILLDYITTGDGMLSALQLVNIMKMTKKPL 359

Query: 363 STICHCFEEYPQFLRSVSVKDTS-ILNSSSIVQAIADAESELRGIDRLIVRASGTESLIR 421
           S +     ++PQ L +V V D    L +  I + I   E E+ G  R++VR SGTE LIR
Sbjct: 360 SELAGEMTKFPQLLVNVRVTDKKLALENEKIKEIIRVVEEEMNGDGRILVRPSGTEPLIR 419

Query: 422 IMAEGDDLSRIKRIVDDLAKVIPM 445
           +MAE          V  + +V+  
Sbjct: 420 VMAEAPTQEVCDAYVHRIVEVVKA 443


>gi|319763180|ref|YP_004127117.1| phosphoglucosamine mutase [Alicycliphilus denitrificans BC]
 gi|330825243|ref|YP_004388546.1| phosphoglucosamine mutase [Alicycliphilus denitrificans K601]
 gi|317117741|gb|ADV00230.1| phosphoglucosamine mutase [Alicycliphilus denitrificans BC]
 gi|329310615|gb|AEB85030.1| phosphoglucosamine mutase [Alicycliphilus denitrificans K601]
          Length = 444

 Score =  266 bits (679), Expect = 6e-69,   Method: Composition-based stats.
 Identities = 189/443 (42%), Positives = 280/443 (63%), Gaps = 4/443 (0%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M R++FGTDGIRG     PITP+F++R+  AVG + R  +    V+IGKDTR+SGYMLE 
Sbjct: 1   MTRKYFGTDGIRGTVGQAPITPDFVLRLAHAVGRVLRRSEARPTVLIGKDTRISGYMLEA 60

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +L +GF +AG+D  +LGP+P+P VA LTR+ RA +GV+ISASHNPY DNGIK F   G K
Sbjct: 61  ALESGFNSAGVDVILLGPLPTPGVAYLTRAQRASLGVVISASHNPYPDNGIKFFSAQGTK 120

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +    E  +E  L++      +   ++G  +R+D    RYIE  K T   D+TL+GL+IV
Sbjct: 121 LPDAWEQEVEAALDE--PPMWADSATLGKTRRLDDAAGRYIEFCKSTFAHDLTLRGLKIV 178

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           VD A+GA+Y +AP+VF ELGADVV IG  P+G+NIN + G+T+  +L R V   RAD GI
Sbjct: 179 VDAAHGAAYHIAPKVFHELGADVVAIGCAPDGLNINHEVGATHPDALVRAVRANRADFGI 238

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
            LDGD DR+ +VD  G + NGD+++ L+A + ++        + T  M+N+ +E+ +   
Sbjct: 239 GLDGDADRLQMVDADGRLYNGDELLYLMAADRLARDEHVPGVVGTL-MTNMAVEQALVRR 297

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           G+   R +VGDRY++E ++   + +GGE SGH+++ D  +TGDGLV+ALQVL+   +  +
Sbjct: 298 GVKFVRAKVGDRYVLEELQRQHWLLGGEGSGHLLVLDRHTTGDGLVSALQVLQTCVRSQR 357

Query: 361 PVSTICHCFEEYPQFLRSVSVK-DTSILNSSSIVQAIADAESELRGIDRLIVRASGTESL 419
            ++ +      +PQ L +V +        + ++ +   + ++EL    RL+VRASGTE L
Sbjct: 358 TLAQLLADVPLFPQVLLNVRLNTGQDWTVNEALERTTREVQAELGDNGRLLVRASGTEPL 417

Query: 420 IRIMAEGDDLSRIKRIVDDLAKV 442
           +R+M E  D  +  R    LA  
Sbjct: 418 LRVMVEARDAEQASRCAQRLADA 440


>gi|226309856|ref|YP_002769750.1| phosphoglucosamine mutase [Brevibacillus brevis NBRC 100599]
 gi|254798565|sp|C0ZIM8|GLMM_BREBN RecName: Full=Phosphoglucosamine mutase
 gi|226092804|dbj|BAH41246.1| phosphoglucosamine mutase [Brevibacillus brevis NBRC 100599]
          Length = 448

 Score =  266 bits (679), Expect = 6e-69,   Method: Composition-based stats.
 Identities = 195/446 (43%), Positives = 285/446 (63%), Gaps = 7/446 (1%)

Query: 4   RFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLF--RGKKKHRRVVIGKDTRLSGYMLENS 61
           ++FGTDG+RG +NT  +TP    +IG   GY+     ++   +VVIG+DTR+SG MLEN+
Sbjct: 3   KYFGTDGVRGVANT-QLTPELAFKIGRVGGYVLTRHKQEGKPKVVIGRDTRISGQMLENA 61

Query: 62  LVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKV 121
           L+AG  + G +   LG I +  VA LTR+L AD GVMISASHNP+ DNGIK FG +G+K+
Sbjct: 62  LLAGLLSVGAEVVRLGVISTSGVAYLTRALGADAGVMISASHNPFPDNGIKFFGSNGFKL 121

Query: 122 STDIEDRIETLLE-DDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           S ++E  +E  L+  + T      + IG          +Y+ H+K T+       GL++V
Sbjct: 122 SDEVEAEVEQYLDAAEDTMPRPTGEQIGTVLEFLEGGQKYLSHLKSTVSE--RFDGLKVV 179

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           +DCANGA   +A  +F ++ A+V+ IG  PNGININ  CGST+   L  +V + +AD+G+
Sbjct: 180 LDCANGAVSSLAARLFADVDAEVITIGANPNGININDQCGSTHPERLVEEVLKHKADLGL 239

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           + DGD DR I VD  G I++GD IMA+ AR   +   L  N +VTTVM+N+G  + +   
Sbjct: 240 SFDGDADRCIAVDNNGEIIDGDYIMAICARALKAKGKLNNNTVVTTVMANMGFFKGMEEC 299

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
            ++  +T VGDRY++E M   G+N+GGEQSGHI+  DY +TGDGL+  LQ+L  IK+  K
Sbjct: 300 SINTTKTAVGDRYVVEEMLRGGYNLGGEQSGHIVFLDYNTTGDGLLTGLQLLNIIKESGK 359

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTSILNS-SSIVQAIADAESELRGIDRLIVRASGTESL 419
           P+S +     +YPQ L +V V+D S LN   +I QAI + E +L G  R++VR SGTE +
Sbjct: 360 PLSELKQVMVKYPQLLINVRVEDKSKLNGNEAIAQAIREVEEDLAGNGRVLVRPSGTEPI 419

Query: 420 IRIMAEGDDLSRIKRIVDDLAKVIPM 445
           +R+MAEG D ++++ +V+ +  V+  
Sbjct: 420 VRVMAEGPDAAQLEGLVNRIVDVVKQ 445


>gi|289550225|ref|YP_003471129.1| Phosphoglucosamine mutase/FemD, factor involved in methicillin
           resistance [Staphylococcus lugdunensis HKU09-01]
 gi|289179757|gb|ADC87002.1| Phosphoglucosamine mutase/FemD, factor involved in methicillin
           resistance [Staphylococcus lugdunensis HKU09-01]
          Length = 451

 Score =  266 bits (679), Expect = 6e-69,   Method: Composition-based stats.
 Identities = 186/446 (41%), Positives = 276/446 (61%), Gaps = 7/446 (1%)

Query: 4   RFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFR--GKKKHRRVVIGKDTRLSGYMLENS 61
           ++FGTDG+RG +N   +TP    ++G   GY+      + H +V++G+DTR+SG MLE +
Sbjct: 3   KYFGTDGVRGIANK-ELTPELAFKLGRYGGYVLAHNENEAHPKVLVGRDTRVSGEMLEAA 61

Query: 62  LVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKV 121
           L+AG  + G +   LG I +P VA LT+ + A++GVMISASHNP  DNGIK FG DG+K+
Sbjct: 62  LIAGLVSIGAEVMRLGVISTPGVAYLTKEMGAELGVMISASHNPVADNGIKFFGSDGFKL 121

Query: 122 STDIEDRIETLLEDDLTSYLSCYDS-IGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           S D E  IE LLE             I H         +Y+  +K T+   V L+G++I 
Sbjct: 122 SDDQESEIEALLEQQNPELPRPVGQDIVHYSDYFEGAQKYLSFLKSTVD--VNLEGMKIA 179

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           +D ANG++  +AP +F +L AD   IG  P+G NIN +CGST+  +L + V E  +D G+
Sbjct: 180 LDGANGSTSSLAPFLFGDLEADTETIGCSPDGYNINENCGSTHPENLAKTVLETNSDFGL 239

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           A DGDGDR+I VDE G IV+GDQIM +I +    +  L+ + IV+TVMSN+G  + +   
Sbjct: 240 AFDGDGDRIIAVDENGQIVDGDQIMFIIGQAMHKNQELKKDMIVSTVMSNLGFYKALENE 299

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           G++  +T+VGDRY++E M+   +N+GGEQSGHI++ DY +TGDGL+  +Q+   IK   K
Sbjct: 300 GIASNKTKVGDRYVVEEMRKGDYNLGGEQSGHIVMMDYNTTGDGLLTGIQLASIIKMSGK 359

Query: 361 PVSTICHCFEEYPQFLRSVSVKDT-SILNSSSIVQAIADAESELRGIDRLIVRASGTESL 419
           P+S +    ++YPQ L +V V D  ++  +  +   IA  E+E+ G  R++VR SGTE L
Sbjct: 360 PLSELAAQMKKYPQSLINVRVTDKYNVEKNEDVKAEIAKVEAEMNGEGRILVRPSGTEPL 419

Query: 420 IRIMAEGDDLSRIKRIVDDLAKVIPM 445
           +R+M E        R  + +A+V+  
Sbjct: 420 VRVMVEASTDDNANRYAEQIAQVVEA 445


>gi|212638000|ref|YP_002314520.1| phosphoglucosamine mutase [Anoxybacillus flavithermus WK1]
 gi|226722706|sp|B7GIY9|GLMM_ANOFW RecName: Full=Phosphoglucosamine mutase
 gi|212559480|gb|ACJ32535.1| Phosphomannomutase [Anoxybacillus flavithermus WK1]
          Length = 447

 Score =  266 bits (679), Expect = 6e-69,   Method: Composition-based stats.
 Identities = 192/444 (43%), Positives = 278/444 (62%), Gaps = 5/444 (1%)

Query: 4   RFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSLV 63
           ++FGTDG+RG +N   +TP    +IG   GY+    K+  +V+IG+DTR+SG+MLE +LV
Sbjct: 3   KYFGTDGVRGIAN-SELTPELAFKIGRFGGYVLTKDKERPKVLIGRDTRISGHMLEGALV 61

Query: 64  AGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVST 123
           AG  + G +   LG I +P VA LT++L A  GVMISASHNP QDNGIK FGPDG+K+S 
Sbjct: 62  AGLLSIGAEVMRLGVISTPGVAYLTKALGAQAGVMISASHNPVQDNGIKFFGPDGFKLSD 121

Query: 124 DIEDRIETLLEDDLTS-YLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVVD 182
           + E  IE LL+ +  +        +G          +Y++++K+T+       G+ + +D
Sbjct: 122 EQELEIEALLDSEQDTLPRPIGKDLGQVNDYFEGGQKYLQYLKQTVDE--DFSGIHVALD 179

Query: 183 CANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIAL 242
           CA+GA+  +A  +F +L ADV  +G  PNG+NIN   GST+  +L   V E  AD+G+A 
Sbjct: 180 CAHGATSALATHLFADLDADVSTMGASPNGLNINDGVGSTHPEALAAFVKEKGADVGLAF 239

Query: 243 DGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLGL 302
           DGDGDR+I VDE G IV+GDQIM + A+       L+   +V+TVMSN+G  + +   G+
Sbjct: 240 DGDGDRLIAVDENGQIVDGDQIMYICAKYLNEQGRLKHQTVVSTVMSNLGFYKALEAQGI 299

Query: 303 SLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKPV 362
              +T VGDRY++E MK NG+N+GGEQSGHII  DY +TGDGL+ ALQ++  +K   KP+
Sbjct: 300 KSVQTAVGDRYVVEEMKKNGYNLGGEQSGHIIFLDYNTTGDGLLTALQLVNIMKVTKKPL 359

Query: 363 STICHCFEEYPQFLRSVSVKDT-SILNSSSIVQAIADAESELRGIDRLIVRASGTESLIR 421
           S +    ++YPQ L +V V D    + +  + + I + E E+ G  R++VR SGTE L+R
Sbjct: 360 SELAGEMKKYPQKLVNVKVTDKQEAIANEEVQRVIREVEEEMAGNGRILVRPSGTEPLVR 419

Query: 422 IMAEGDDLSRIKRIVDDLAKVIPM 445
           +MAE        + V+ +A VI  
Sbjct: 420 VMAEAPTNELCDQYVERIAAVIRE 443


>gi|282849237|ref|ZP_06258622.1| phosphoglucosamine mutase [Veillonella parvula ATCC 17745]
 gi|282580941|gb|EFB86339.1| phosphoglucosamine mutase [Veillonella parvula ATCC 17745]
          Length = 450

 Score =  266 bits (679), Expect = 6e-69,   Method: Composition-based stats.
 Identities = 194/444 (43%), Positives = 269/444 (60%), Gaps = 3/444 (0%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M R  FGTDG+RG  N F +TP     +G A G  F  KK H   +IG+DTR+SG MLE+
Sbjct: 1   MAR-LFGTDGVRGVVNEF-LTPELAYHLGRATGTHFGKKKDHPTFLIGRDTRISGSMLES 58

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +L AG  + G +  I G IP+PAVA L R    D G +ISASHNPY DNGIK F  +GYK
Sbjct: 59  ALAAGICSVGGNVVIAGVIPTPAVAYLVRQQGFDAGAVISASHNPYPDNGIKFFDGNGYK 118

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +  ++ED +E  +     + L+     G  K     +  ++         D +L+GL IV
Sbjct: 119 LPDEVEDELEKYVRQSADNELARPTGDGIGKIEFNSNLAHLYAHFVRHTIDTSLEGLTIV 178

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
            D ANGA+  V PE+   LGA V+ I   P+G+NIN  CGST++  LQ  V +  AD+GI
Sbjct: 179 YDGANGAASSVGPEILSGLGAKVININVNPDGLNINHHCGSTHIEGLQVAVQQHNADLGI 238

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           A DGD DR ++VDEKG +++GDQIM L A +      L+G+ IV TVMSNIG  +    L
Sbjct: 239 ANDGDADRCLLVDEKGQVLDGDQIMLLCALKLKEEGKLKGDTIVGTVMSNIGFHKAAEEL 298

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           G+    T VGDRY++EYM+ +  +VGGEQSGH+I  D+ +TGDG++ A+QV   +K+  +
Sbjct: 299 GMKTVSTAVGDRYVLEYMREHNLSVGGEQSGHVIFLDHNTTGDGMLTAVQVAALMKEKKQ 358

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTS-ILNSSSIVQAIADAESELRGIDRLIVRASGTESL 419
           P+S +     +YPQ L +V V   +   ++  I  AI  AE EL    R++VRASGTE L
Sbjct: 359 PLSELAGIMTKYPQVLVNVRVATKTGWEDNDLIKAAIVTAEGELGDEGRVLVRASGTEPL 418

Query: 420 IRIMAEGDDLSRIKRIVDDLAKVI 443
           IR+MAEG +   ++ +  ++A +I
Sbjct: 419 IRVMAEGPNQEELQSLCQEIADII 442


>gi|42779238|ref|NP_976485.1| phosphoglucosamine mutase [Bacillus cereus ATCC 10987]
 gi|81570000|sp|Q73F50|GLMM_BACC1 RecName: Full=Phosphoglucosamine mutase
 gi|42735153|gb|AAS39093.1| phosphoglucosamine mutase [Bacillus cereus ATCC 10987]
          Length = 448

 Score =  266 bits (679), Expect = 6e-69,   Method: Composition-based stats.
 Identities = 194/444 (43%), Positives = 277/444 (62%), Gaps = 5/444 (1%)

Query: 4   RFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSLV 63
           ++FGTDG+RG +N   +TP    +IG   GY+        +V+IG+DTR+SG+MLE +LV
Sbjct: 3   KYFGTDGVRGVANQ-ELTPELAFKIGRFGGYVLTKDTDRPKVIIGRDTRISGHMLEGALV 61

Query: 64  AGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVST 123
           AG  + G +   LG I +P VA LT++L A  GVMISASHNP QDNGIK FG DG+K++ 
Sbjct: 62  AGLLSTGAEVMRLGVISTPGVAYLTKALDAQAGVMISASHNPVQDNGIKFFGSDGFKLTD 121

Query: 124 DIEDRIETLLEDDLTSYLSCYD-SIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVVD 182
           + E  IE LL+ ++         ++G          +Y++++K+T+  +    GL I +D
Sbjct: 122 EQEAEIEALLDKEVDELPRPTGTNLGQVSDYFEGGQKYLQYIKQTV--EEDFSGLHIALD 179

Query: 183 CANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIAL 242
           CA+GA+  +AP +F +L AD+  +G  PNG+NIN   GST+   L   V E  ADIG+A 
Sbjct: 180 CAHGATSSLAPYLFADLEADISTMGTSPNGMNINDGVGSTHPEVLAELVKEKGADIGLAF 239

Query: 243 DGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLGL 302
           DGDGDR+I VDEKG IV+GDQIM + A+       L+ N +V+TVMSN+G  + +   G+
Sbjct: 240 DGDGDRLIAVDEKGNIVDGDQIMFICAKYMKETGQLKHNTVVSTVMSNLGFYKALEANGI 299

Query: 303 SLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKPV 362
           +  +T VGDRY+ME MK  G+N+GGEQSGHIIL DY +TGDG+++ALQ++  +K   KP+
Sbjct: 300 TSDKTAVGDRYVMEEMKRGGYNLGGEQSGHIILLDYITTGDGMLSALQLVNIMKMTKKPL 359

Query: 363 STICHCFEEYPQFLRSVSVKDTS-ILNSSSIVQAIADAESELRGIDRLIVRASGTESLIR 421
           S +     ++PQ L +V V D    L +  I + I   E E+ G  R++VR SGTE LIR
Sbjct: 360 SELAGEMTKFPQLLVNVRVTDKKLALENEKIKEIIRVVEEEMNGDGRILVRPSGTEPLIR 419

Query: 422 IMAEGDDLSRIKRIVDDLAKVIPM 445
           +MAE          V  + +V+  
Sbjct: 420 VMAEAPTQEVCDAYVHRIVEVVKA 443


>gi|17546247|ref|NP_519649.1| phosphoglucosamine mutase (MRSA protein) [Ralstonia solanacearum
           GMI1000]
 gi|81505135|sp|Q8XZ76|GLMM_RALSO RecName: Full=Phosphoglucosamine mutase
 gi|17428544|emb|CAD15230.1| putative phosphoglucosamine mutase (mrsa protein) [Ralstonia
           solanacearum GMI1000]
          Length = 447

 Score =  266 bits (678), Expect = 6e-69,   Method: Composition-based stats.
 Identities = 188/450 (41%), Positives = 279/450 (62%), Gaps = 9/450 (2%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKK-----KHRRVVIGKDTRLSG 55
           M R++FGTDGIRG+    PITP+F++R+G A G +              V+IGKDTRLSG
Sbjct: 1   MSRKYFGTDGIRGRVGESPITPDFVLRLGYAAGRVLAHGSEAHGHGRPTVLIGKDTRLSG 60

Query: 56  YMLENSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFG 115
           YMLE +L AGFTAAG+D  + GP+P+P VA LTR+LR   GV+ISASHNPY DNGIK F 
Sbjct: 61  YMLEAALEAGFTAAGVDVLMSGPLPTPGVAYLTRALRLSAGVVISASHNPYYDNGIKFFS 120

Query: 116 PDGYKVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQ 175
             G K+  + E +IE  LE  +    +  D++G A+R+D    RYIE  K T P D+ L 
Sbjct: 121 ATGDKLPDETESQIEAELEKPM--VYAASDALGRARRIDDAAGRYIEFCKSTFPNDLNLF 178

Query: 176 GLRIVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVR 235
           G++IV+D A+GA+Y +AP VF ELGA+VV IG++PNG NIN   G+T    L     +  
Sbjct: 179 GMKIVLDSAHGAAYHIAPHVFHELGAEVVSIGNQPNGRNINDGYGATEPAKLIEATRQHG 238

Query: 236 ADIGIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLER 295
           AD+G+A DGD DR+ +VD  G + NGD+++ ++ +   +        + T  M+N+ +E 
Sbjct: 239 ADLGLAFDGDADRLQVVDRNGRLYNGDELLYVMVQARRAAGQAVPGAVGTL-MTNLAVEL 297

Query: 296 FIAGLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYI 355
            +   G+   R +VGDRY++E +K +G+ +GGE SGH++  D  STGDG+++ALQVL  +
Sbjct: 298 ALKAQGVEFVRAKVGDRYVLEELKKHGWLLGGEGSGHLLCLDKHSTGDGIISALQVLAAL 357

Query: 356 KQYDKPVSTICHCFEEYPQFLRSVSV-KDTSILNSSSIVQAIADAESELRGIDRLIVRAS 414
           ++  + +  +      +PQ L +V V K       +++  A+  +E+EL G  R+++R S
Sbjct: 358 RRSGQTLEQVLDGVHLFPQKLINVRVEKGFDWKAHAALQAALKVSEAELNGKGRVLIRPS 417

Query: 415 GTESLIRIMAEGDDLSRIKRIVDDLAKVIP 444
           GTE ++R+M E  D +   +  + LA  + 
Sbjct: 418 GTEPVVRVMVEAQDAALATKYAEQLAATLQ 447


>gi|302390491|ref|YP_003826312.1| phosphoglucosamine mutase [Thermosediminibacter oceani DSM 16646]
 gi|302201119|gb|ADL08689.1| phosphoglucosamine mutase [Thermosediminibacter oceani DSM 16646]
          Length = 446

 Score =  266 bits (678), Expect = 6e-69,   Method: Composition-based stats.
 Identities = 196/446 (43%), Positives = 278/446 (62%), Gaps = 4/446 (0%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M  R FGTDG+RG +N   +TP     +G A  Y+         VV+G+DTR+SG MLE+
Sbjct: 1   MTERLFGTDGVRGIANK-ELTPLLAYHLGRAGAYVLSETHDKPTVVVGRDTRISGDMLES 59

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +L+AG  + G +   +G +P+PAVA LTR   AD GV+ISASHNP + NGIK F  +G+K
Sbjct: 60  ALIAGICSVGANVLRVGVMPTPAVAFLTRHFGADAGVVISASHNPVEYNGIKFFNGEGFK 119

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +   +ED IE L++       S           +     Y + +K         +GL++ 
Sbjct: 120 LPDAMEDEIEALVKGPDGRIQSPTGPAVGRVVTEDGLHPYADFIKSAA--GTDFRGLKVA 177

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           +DCANGA+Y+VAP VF ELGA+V VI D+P+G NIN++CGST+   +   V EV AD+G+
Sbjct: 178 IDCANGAAYRVAPLVFRELGAEVFVINDRPDGCNINVNCGSTSPEVIAGFVREVGADVGL 237

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           + DGD DR+I VDEKG +V+GD IMA+ A       LL+   +V TVMSN+G E  +   
Sbjct: 238 SFDGDADRLIAVDEKGQVVDGDHIMAVCAEYMNRKGLLKNGTVVATVMSNMGFEVALKKA 297

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           G+   RT+VGDRY++E M   G+N+GGEQSGHII  D+ +TGDGL+ A+++L  + +  K
Sbjct: 298 GIKTVRTKVGDRYVLEEMLKGGYNLGGEQSGHIIFLDHNTTGDGLLTAVKLLSVMVEEAK 357

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTSI-LNSSSIVQAIADAESELRGIDRLIVRASGTESL 419
           P+S + +  + YPQ L +V VKD +    S+SI +A+ + E+ L    R++VR SGTE L
Sbjct: 358 PLSELRNIMKVYPQILVNVEVKDKAGYAKSTSIKEAVEETEALLGENGRIVVRPSGTEPL 417

Query: 420 IRIMAEGDDLSRIKRIVDDLAKVIPM 445
           IR+M EG+D   IK +   LA+VI  
Sbjct: 418 IRVMVEGEDEKVIKDLAHRLAEVIRK 443


>gi|329891054|ref|ZP_08269397.1| phosphoglucosamine mutase [Brevundimonas diminuta ATCC 11568]
 gi|328846355|gb|EGF95919.1| phosphoglucosamine mutase [Brevundimonas diminuta ATCC 11568]
          Length = 449

 Score =  266 bits (678), Expect = 7e-69,   Method: Composition-based stats.
 Identities = 243/445 (54%), Positives = 323/445 (72%), Gaps = 1/445 (0%)

Query: 2   KRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRR-VVIGKDTRLSGYMLEN 60
           +R++FGTDGIRG++NT P+T    +R+G+A G LFR     R  VVIGKDTRLSGYM+E 
Sbjct: 3   ERKYFGTDGIRGRANTHPMTAEVALRVGLAAGRLFRTDDDRRHLVVIGKDTRLSGYMIEP 62

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +LVAG  + GMD    GP+P+P VAM+TRS+RAD+G+MISASHN Y DNGIKLFGPDGYK
Sbjct: 63  ALVAGLASVGMDVRTFGPLPTPGVAMMTRSMRADLGIMISASHNDYADNGIKLFGPDGYK 122

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +S +IE +IE +++  L   L+  + +G  KR+D    RYIE  K+  P+ ++L+GLRI 
Sbjct: 123 LSDEIELKIEAMMDGALDEDLAPSNKLGRVKRIDDAPPRYIEIAKQAFPKRLSLKGLRIA 182

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           +DCANGA Y+VAP   +ELGA+V  +G +PNG+NIN +CGST+  ++   V   R DIGI
Sbjct: 183 IDCANGAGYRVAPTTLYELGAEVFPVGVEPNGLNINAECGSTHPEAVSEAVKRYRCDIGI 242

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           ALDGD DRVII DEKG +V+GDQIMALI  +W     L GNG+V TVMSN+GLER +   
Sbjct: 243 ALDGDADRVIICDEKGHVVDGDQIMALIGLDWAKRGRLNGNGVVATVMSNLGLERRLKAE 302

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           GL+L+RT+VGDRY+ME M+  GFN+GGEQSGHIIL D+ +TGDGL+AALQVL  + +   
Sbjct: 303 GLTLERTKVGDRYVMERMREGGFNIGGEQSGHIILKDHATTGDGLMAALQVLAVLVEAGV 362

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
           P+S +   FE  PQ L++V       L  + +  A+A+AE+ L G  RL+VR SGTE LI
Sbjct: 363 PMSELARQFEPVPQLLQNVRYTAGKPLEDAKVKAAMAEAEAALNGSGRLLVRPSGTEKLI 422

Query: 421 RIMAEGDDLSRIKRIVDDLAKVIPM 445
           R+MAEGDD + +KR+V+++A+ +  
Sbjct: 423 RVMAEGDDEALVKRVVNEVAEAVKA 447


>gi|259416951|ref|ZP_05740871.1| phosphoglucosamine mutase [Silicibacter sp. TrichCH4B]
 gi|259348390|gb|EEW60167.1| phosphoglucosamine mutase [Silicibacter sp. TrichCH4B]
          Length = 483

 Score =  266 bits (678), Expect = 7e-69,   Method: Composition-based stats.
 Identities = 229/448 (51%), Positives = 305/448 (68%), Gaps = 4/448 (0%)

Query: 3   RRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKH-RRVVIGKDTRLSGYMLENS 61
           R+ FGTDG+RGK+N  P+T    +RIG AVG  FR +     RVVIGKDTRLSGYM EN+
Sbjct: 38  RKLFGTDGVRGKANLHPMTAEMALRIGAAVGRYFRRETDTVHRVVIGKDTRLSGYMFENA 97

Query: 62  LVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKV 121
           L AG T+ GM+  +LGP+P+PAV ++TRS+RAD+GVMISASHNP +DNGIK FGPDGYK+
Sbjct: 98  LTAGLTSTGMNVLLLGPVPTPAVGLMTRSMRADLGVMISASHNPAEDNGIKFFGPDGYKL 157

Query: 122 STDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVV 181
           S ++E  +E L+E  +    S   +IG AKR+D    RY E VK +LPRD+ L GL++V+
Sbjct: 158 SDEVELELEALIEAGVEPAQSH--NIGRAKRIDDARFRYGERVKSSLPRDMRLDGLKVVI 215

Query: 182 DCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIA 241
           DCANGA+++ APE+ WELGADV+ +G  P+G NIN  CGST        V    A +GI 
Sbjct: 216 DCANGAAHRAAPEILWELGADVIPVGVSPDGKNINRGCGSTKPAVAAETVVAHGAHVGIC 275

Query: 242 LDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLG 301
           LDGD DRV+++DE G + +GDQ+MAL+A  W     L G  +V TVMSN+GLERF+   G
Sbjct: 276 LDGDADRVVMIDETGTVADGDQLMALLASAWAEDGRLSGGALVATVMSNLGLERFLNDRG 335

Query: 302 LSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKP 361
           + L+RT VGDRY++E M+  GFN+GGEQSGHI++SDY +TGDGL+A L  L  + + ++ 
Sbjct: 336 IGLERTGVGDRYVVERMRQGGFNLGGEQSGHIVMSDYATTGDGLMAGLHFLAEMVRREQK 395

Query: 362 VSTICHCFEEYPQFLRSVSVK-DTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
            S +   FE  PQ L++V  +     L   ++  AIA AE +L G  RL++R SGTE LI
Sbjct: 396 ASELAQQFEPVPQLLKNVRFEAGQVPLEVDAVQDAIAQAEGQLNGHGRLLIRKSGTEPLI 455

Query: 421 RIMAEGDDLSRIKRIVDDLAKVIPMIDS 448
           R+MAE +D   + R VD +   +    S
Sbjct: 456 RVMAESEDPDLLNRAVDGVVAAVEAATS 483


>gi|253682279|ref|ZP_04863076.1| phosphoglucosamine mutase [Clostridium botulinum D str. 1873]
 gi|253561991|gb|EES91443.1| phosphoglucosamine mutase [Clostridium botulinum D str. 1873]
          Length = 449

 Score =  266 bits (678), Expect = 7e-69,   Method: Composition-based stats.
 Identities = 186/449 (41%), Positives = 274/449 (61%), Gaps = 8/449 (1%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M R  FGTDG+RG +NT  +T +   ++G A  ++        ++++G DTR+SG MLE 
Sbjct: 1   MSR-LFGTDGVRGIANT-ELTADLAFKLGRAGAFVLTEGTHKPKILVGMDTRISGDMLEA 58

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +LV+G  + G +A  +G +P+PA+A LTR  +AD GV+ISASHNP + NGIK F  +GYK
Sbjct: 59  ALVSGILSVGAEAICVGIVPTPAIAYLTRKYKADAGVVISASHNPVEYNGIKFFNKNGYK 118

Query: 121 VSTDIEDRIETLLEDDLTSYL-SCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRI 179
           +  ++EDRI++++E+D         + +G     +   + YIE  K T+   + L+GL+I
Sbjct: 119 LKDELEDRIQSIIENDFEGVPSPTGEHLGKKVVCESAVEDYIEFAKSTID--IDLKGLKI 176

Query: 180 VVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIG 239
            +DCANGASYK + E F ELGA+VVVI + P+G+NIN +CGST+   L   V +   D+G
Sbjct: 177 ALDCANGASYKTSVETFRELGAEVVVINNDPDGVNINKNCGSTHPEELMDYVVKQGCDLG 236

Query: 240 IALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAG 299
           +A DGD DR + VDEKG +++GD IM +  +       L+ N +V TVMSN+GL      
Sbjct: 237 LAFDGDADRCLAVDEKGNLIDGDFIMTICGKHLKEKGKLKDNMVVVTVMSNLGLSIAFDK 296

Query: 300 LGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYD 359
             +S  +T+VGDRY++E M   G+ +GGEQSGHII  D+ +TGDGLV  LQV   +K+  
Sbjct: 297 ENISTIKTKVGDRYVLEEMVKEGYKLGGEQSGHIIFLDFNTTGDGLVTGLQVAAIVKETG 356

Query: 360 KPVSTICHCFEEYPQFLRSVSVKDTSI---LNSSSIVQAIADAESELRGIDRLIVRASGT 416
           K +S +     + PQ L +  V +           I + I   E +L G  R+++R SGT
Sbjct: 357 KKLSELASIMTKLPQVLVNAKVPNNMKDIHEKDEKIAEEIKKIEEKLNGSGRVLIRPSGT 416

Query: 417 ESLIRIMAEGDDLSRIKRIVDDLAKVIPM 445
           E L+R+M EG D + + +I   LAK+I  
Sbjct: 417 EPLVRVMLEGKDQAELDKIAHALAKMIEE 445


>gi|119471553|ref|ZP_01613967.1| phosphoglucosamine mutase [Alteromonadales bacterium TW-7]
 gi|119445496|gb|EAW26782.1| phosphoglucosamine mutase [Alteromonadales bacterium TW-7]
          Length = 449

 Score =  266 bits (678), Expect = 8e-69,   Method: Composition-based stats.
 Identities = 191/444 (43%), Positives = 290/444 (65%), Gaps = 5/444 (1%)

Query: 2   KRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENS 61
           +R++FGTDG+RG   T PI P F M++G A G +   K   ++V+IGKDTR+SGYMLE +
Sbjct: 3   QRKYFGTDGVRGLVGTAPINPEFAMKLGWAAGRVL-SKGGTKKVIIGKDTRISGYMLETA 61

Query: 62  LVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKV 121
           L AG  AAG+D  +LGP+P+PAVA L ++ RA+ G++ISASHNPY DNGIK F   G K+
Sbjct: 62  LEAGLIAAGIDVVLLGPMPTPAVAYLAQTFRAEAGIVISASHNPYYDNGIKFFNGQGLKL 121

Query: 122 STDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVV 181
              +E  IE +L++ +T      D +G A R+     RYIE  K   P+ ++L+GL++VV
Sbjct: 122 DDAVELEIEAMLDEQMTCVA--SDKLGKATRLASADGRYIEFCKSQFPQGLSLEGLKVVV 179

Query: 182 DCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIA 241
           DCANGA+Y +AP V  ELGADV+    +PNG+NIN +CG+T+V +L+RKV E +AD+GIA
Sbjct: 180 DCANGATYHIAPSVMRELGADVITHACEPNGVNINHECGATHVDTLKRKVLEHKADVGIA 239

Query: 242 LDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLG 301
            DGDGDRV++VD  G + +GD ++ +IA    ++  + G G+V TVMSN+GLE  +   G
Sbjct: 240 YDGDGDRVMMVDHNGRVFDGDDLVYIIA-CQAANDHILGGGVVGTVMSNMGLENALKAKG 298

Query: 302 LSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKP 361
           +   R++VGDRY+ME ++  G+ +GGE SGH++  D  STGDG++++LQVL  +   ++ 
Sbjct: 299 IEFARSKVGDRYVMELLQQKGWKIGGESSGHVLNLDLISTGDGIISSLQVLAAMVAQNRT 358

Query: 362 VSTICHCFEEYPQFLRSVS-VKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
           +  +   F +YP  + +V     T    +  ++ A+ + E  L    R+++R SGTE ++
Sbjct: 359 LQDLGAGFTKYPMKMINVRYTPGTDPTTAPKVLAAVEEVEQNLGNKGRVLLRKSGTEPVV 418

Query: 421 RIMAEGDDLSRIKRIVDDLAKVIP 444
           R+M E +    +      +A+++ 
Sbjct: 419 RVMVEAEQEKIVLDSARKIAEIVE 442


>gi|53718997|ref|YP_107983.1| phosphoglucosamine mutase [Burkholderia pseudomallei K96243]
 gi|167815249|ref|ZP_02446929.1| putative phosphoglucomutase [Burkholderia pseudomallei 91]
 gi|167910444|ref|ZP_02497535.1| putative phosphoglucomutase [Burkholderia pseudomallei 112]
 gi|81379951|sp|Q63V83|GLMM_BURPS RecName: Full=Phosphoglucosamine mutase
 gi|52209411|emb|CAH35356.1| putative phosphoglucomutase [Burkholderia pseudomallei K96243]
          Length = 452

 Score =  266 bits (678), Expect = 8e-69,   Method: Composition-based stats.
 Identities = 197/455 (43%), Positives = 282/455 (61%), Gaps = 10/455 (2%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFR------GKKKHRRVVIGKDTRLS 54
           M RR+FGTDGIRGK    PITP+F++R+G A G +               V+IGKDTR+S
Sbjct: 1   MGRRYFGTDGIRGKVGDAPITPDFVLRLGYAAGKVLASAPGRAASGARPTVLIGKDTRVS 60

Query: 55  GYMLENSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLF 114
           GYMLE +L AGF+AAG+D  + GP+P+P VA LTR+LR   GV+ISASHNPY DNGIK F
Sbjct: 61  GYMLEAALEAGFSAAGVDVMLAGPMPTPGVAYLTRALRLSAGVVISASHNPYHDNGIKFF 120

Query: 115 GPDGYKVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTL 174
             DG K+  +IE  IE  L+  L    +  D +G A+R+D    RYIE  K T P    L
Sbjct: 121 SADGNKLPDEIEAEIEAWLDKPLD--CAASDGLGKARRLDDAAGRYIEFCKSTFPAAFDL 178

Query: 175 QGLRIVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEV 234
           +G+++VVDCA+GA+Y+VAP VF ELGADV+ IG  PNG NIN   G+T   +L R V   
Sbjct: 179 RGMKLVVDCAHGAAYQVAPHVFHELGADVIPIGVAPNGFNINDGVGATAPDALMRAVRAN 238

Query: 235 RADIGIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLE 294
            AD+GIALDGD DR+++VD  G + NGD+++ ++ ++ ++ +      + T  M+N  +E
Sbjct: 239 HADLGIALDGDADRLLVVDHTGRLYNGDELLYVLVKDRIATNGQVEGAVGTL-MTNFAVE 297

Query: 295 RFIAGLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRY 354
             +   G+   R  VGDRY++E ++ +G+ +G E SGHI+  D  STGDG+V+AL VL  
Sbjct: 298 VALKEAGVQFVRAAVGDRYVLEQLREHGWQLGAEGSGHILSLDRHSTGDGIVSALLVLAA 357

Query: 355 IKQYDKPVSTICHCFEEYPQFLRSVSVKDTSILNS-SSIVQAIADAESELRGIDRLIVRA 413
           +K+  K ++ +      +PQ L +V +K  +      +I +AI  AE  L G  R+++RA
Sbjct: 358 LKRSGKTLAQMLEGVTLFPQKLINVRMKPGADWKGSDAIRRAIDSAEQALSGSGRVLIRA 417

Query: 414 SGTESLIRIMAEGDDLSRIKRIVDDLAKVIPMIDS 448
           SGTE ++R+M E    +   R  + +A  +    +
Sbjct: 418 SGTEPVLRVMVEARQATDANRHAEAIADAVKQATA 452


>gi|114327776|ref|YP_744933.1| phosphoglucosamine mutase [Granulibacter bethesdensis CGDNIH1]
 gi|122327258|sp|Q0BT42|GLMM_GRABC RecName: Full=Phosphoglucosamine mutase
 gi|114315950|gb|ABI62010.1| phosphoglucosamine mutase [Granulibacter bethesdensis CGDNIH1]
          Length = 457

 Score =  266 bits (678), Expect = 8e-69,   Method: Composition-based stats.
 Identities = 247/443 (55%), Positives = 315/443 (71%)

Query: 2   KRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENS 61
           ++R FGTDGIRG +NT P+T    +R+G A G LF       RV+IGKDTRLSGYM+E +
Sbjct: 3   QKRLFGTDGIRGTANTAPMTAEIALRVGQAAGLLFTRGDHRHRVIIGKDTRLSGYMIEPA 62

Query: 62  LVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKV 121
           L AGF  AGMD  ++GP+P+PA+AMLTRSLRAD+GVMISASHNPY+DNGIKLFGPDG K+
Sbjct: 63  LTAGFIGAGMDVTLVGPLPTPAIAMLTRSLRADLGVMISASHNPYEDNGIKLFGPDGEKL 122

Query: 122 STDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVV 181
           S   E  IE LL  DL+  L+   ++G A R++    RYIE  K T P+   L GL+IV+
Sbjct: 123 SDATEMEIERLLHADLSGQLAAPAALGRAARLEDAAGRYIESAKSTFPKSQRLDGLKIVL 182

Query: 182 DCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIA 241
           DCANGA+Y+VAP V WELGA V+ +G  P+G NIN  CGST    L  +V +  AD+GIA
Sbjct: 183 DCANGAAYRVAPTVLWELGATVIPLGVSPDGFNINSGCGSTAPDYLCAQVVKHGADLGIA 242

Query: 242 LDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLG 301
           LDGD DR+++ DE+G +V+GDQI+ALIAR W +   LRG+G+V TVMSN+GLERF+   G
Sbjct: 243 LDGDADRLLVSDERGHLVDGDQIIALIARSWSASGRLRGDGVVATVMSNLGLERFLKANG 302

Query: 302 LSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKP 361
           L L RT VGDRY+ E M+  G N+GGEQSGH+ILSDY +TGDGL+AALQ+L  + +  +P
Sbjct: 303 LILDRTRVGDRYVAEQMRATGRNIGGEQSGHVILSDYATTGDGLIAALQILSVLVEEGRP 362

Query: 362 VSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLIR 421
            S  C  F   PQ L++V     + L    + QAIADAES L G  RL++R SGTE LIR
Sbjct: 363 ASETCRVFAPLPQKLKNVRYHRDNPLLHPRVKQAIADAESGLNGHGRLLIRRSGTEPLIR 422

Query: 422 IMAEGDDLSRIKRIVDDLAKVIP 444
           +MAE +D + + RIVD+L  +I 
Sbjct: 423 VMAEAEDETTVIRIVDELCDIIA 445


>gi|170750726|ref|YP_001756986.1| phosphoglucosamine mutase [Methylobacterium radiotolerans JCM 2831]
 gi|226723898|sp|B1M3G3|GLMM_METRJ RecName: Full=Phosphoglucosamine mutase
 gi|170657248|gb|ACB26303.1| phosphoglucosamine mutase [Methylobacterium radiotolerans JCM 2831]
          Length = 447

 Score =  265 bits (677), Expect = 9e-69,   Method: Composition-based stats.
 Identities = 257/433 (59%), Positives = 330/433 (76%), Gaps = 1/433 (0%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M R++FGTDGIRG++N   ITP   +++G A G +F+      RVVIGKDTRLSGYM+E 
Sbjct: 1   MVRKYFGTDGIRGRAN-GVITPELALKVGQAAGLVFQRGDHRHRVVIGKDTRLSGYMIET 59

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +LVAGFT+ GMD  +LGP+P+PAVAMLTRS+RAD+GVMISASHNP++DNGIKLFGPDG+K
Sbjct: 60  ALVAGFTSVGMDVLLLGPVPTPAVAMLTRSMRADLGVMISASHNPFEDNGIKLFGPDGFK 119

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           ++  IE  IE L++ D+   LS  + +G AKR++ VH RYIE  KRTLPR VTL GLR+V
Sbjct: 120 LNDAIEHEIEGLIDADMHKRLSGSNDLGRAKRIESVHARYIEFAKRTLPRQVTLDGLRVV 179

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           VDCANGA+Y+VAPE  WELGA+V+ IG +P+G NIN D GST   +L   V E RADIGI
Sbjct: 180 VDCANGAAYRVAPETLWELGAEVIAIGTEPDGFNINRDVGSTAPAALIDMVRERRADIGI 239

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           ALDGD DRV+IVDEKG +V+GDQ+MA++AR W     L   G+V T+MSN+GLERF+ GL
Sbjct: 240 ALDGDADRVLIVDEKGQVVDGDQLMAVVARSWKEDERLTQPGVVATIMSNLGLERFLGGL 299

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           GLSL RT VGDRY++E+M+ +G+N+GGEQSGHII+SDY +TGDGLVAALQ+L  +++ ++
Sbjct: 300 GLSLARTAVGDRYVLEHMRAHGYNLGGEQSGHIIMSDYTTTGDGLVAALQLLSVVQRQNR 359

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
           PVS +CHCF+  PQ L++V  +    L   S+V AI  A   L    RL++R SGTE +I
Sbjct: 360 PVSEVCHCFDPLPQILKNVRYRSGEPLREDSVVSAIEHARERLGNAGRLVIRPSGTEPVI 419

Query: 421 RIMAEGDDLSRIK 433
           R+MAEGDD   + 
Sbjct: 420 RVMAEGDDRGLVN 432


>gi|291533355|emb|CBL06468.1| phosphoglucosamine mutase [Megamonas hypermegale ART12/1]
          Length = 449

 Score =  265 bits (677), Expect = 9e-69,   Method: Composition-based stats.
 Identities = 204/449 (45%), Positives = 278/449 (61%), Gaps = 9/449 (2%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHR-RVVIGKDTRLSGYMLE 59
           M R  FGTDG+RGK+N   +TP     +G A    F  K      + IG+DTRLSG M E
Sbjct: 1   MAR-MFGTDGVRGKANV-ELTPELAYNLGRAAAIYFTKKDGEACTIYIGRDTRLSGPMYE 58

Query: 60  NSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGY 119
            +L AG  +AG +  + G +P+PAVA L R  +AD G++ISASHNP+ DNGIK FG DGY
Sbjct: 59  AALSAGICSAGGNVVLTGVMPTPAVAYLARKHKADAGIVISASHNPFHDNGIKFFGGDGY 118

Query: 120 KVSTDIEDRIETL---LEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQG 176
           K+   +ED IE L   +E++   Y    D IG+      + D Y+  V +T    + L+G
Sbjct: 119 KLPDAVEDEIEALVHEIENNDNLYRPTDDKIGNVVYRHDLLDEYVSFVTKTTD--IELEG 176

Query: 177 LRIVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRA 236
           ++IV+DCANGA+Y+  P++   LGADV+VI DKPNGININ +CGST++ SL   V E +A
Sbjct: 177 MKIVLDCANGAAYEAMPKILRRLGADVIVIHDKPNGININDNCGSTHLESLMEAVKEHKA 236

Query: 237 DIGIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERF 296
           DIGIA DGD DR + +DE G  ++GD ++A  A   M    L+ N +VTTVM+NIG  + 
Sbjct: 237 DIGIAHDGDADRCLCIDENGEFIDGDHMIAACAIYMMGKGKLKDNTVVTTVMANIGFHKA 296

Query: 297 IAGLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIK 356
           I   G   + T VGDRY++E M  NG+N+GGEQSGHII +D+ +TGDG V ALQVL Y+K
Sbjct: 297 IKENGGRTEITAVGDRYVLENMLANGYNLGGEQSGHIIFTDFSTTGDGPVTALQVLSYLK 356

Query: 357 QYDKPVSTICHCFEEYPQFLRSVSVKDTS-ILNSSSIVQAIADAESELRGIDRLIVRASG 415
           +     S I      YPQ L +V V       ++ +I  +I + + +L    R++VR SG
Sbjct: 357 RTRHKASAITKIMTSYPQLLVNVKVATKDGWEDNEAIKASIEEGKQQLGENGRILVRPSG 416

Query: 416 TESLIRIMAEGDDLSRIKRIVDDLAKVIP 444
           TE LIR+MAEG D   ++ I   +A V+ 
Sbjct: 417 TEPLIRVMAEGPDQKELEEICYKIADVVK 445


>gi|326794265|ref|YP_004312085.1| phosphoglucosamine mutase [Marinomonas mediterranea MMB-1]
 gi|326545029|gb|ADZ90249.1| phosphoglucosamine mutase [Marinomonas mediterranea MMB-1]
          Length = 443

 Score =  265 bits (677), Expect = 1e-68,   Method: Composition-based stats.
 Identities = 203/445 (45%), Positives = 297/445 (66%), Gaps = 5/445 (1%)

Query: 3   RRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSL 62
           R++FGTDGIRG+     ITP FM+++G A G +F G+ K++ ++IGKDTR+SGYM E++L
Sbjct: 2   RKYFGTDGIRGQVGKGVITPEFMLKLGWAAGKVFNGQSKNK-ILIGKDTRISGYMFESAL 60

Query: 63  VAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVS 122
            AG  AAG D  ++GP+P+PA+A LTR+ RA  G++ISASHNPY DNGIK F  +G K+S
Sbjct: 61  EAGIVAAGADVRLVGPMPTPAIAYLTRTFRACAGIVISASHNPYTDNGIKFFSSEGGKIS 120

Query: 123 TDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVVD 182
            ++E+ IE  L+  +   +   D IG AKR+D    RYIE+ K T P  + + GL++V+D
Sbjct: 121 DELEEEIEYWLDQPME--VVESDKIGKAKRIDDAAGRYIEYCKGTFPIGLRITGLKMVLD 178

Query: 183 CANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIAL 242
           CA+GA+Y VAP VF ELGADV+VIG  P+G+NIN   G+T    LQ+ V    ADIGIAL
Sbjct: 179 CADGATYHVAPRVFSELGADVIVIGASPDGLNINEVSGATKPELLQKNVVAHGADIGIAL 238

Query: 243 DGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLGL 302
           DGDGDR+I+VD+ G + +GD ++ +IA    S       G+V T+M+N GLE  ++  G+
Sbjct: 239 DGDGDRLILVDKFGKVCDGDDVLYIIANHL-SSKGQFSGGVVGTLMTNFGLELALSERGV 297

Query: 303 SLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKPV 362
              R  VGDRY+ E +  +G+++GGE SGHI+     +TGDG++AALQ+L+ + +  KP+
Sbjct: 298 GFSRANVGDRYVNEKLTQHGWSLGGEPSGHIVCKSITTTGDGIIAALQILQAMLEEGKPL 357

Query: 363 STICHCFEEYPQFLRSVSVKDTSI-LNSSSIVQAIADAESELRGIDRLIVRASGTESLIR 421
             +     ++PQ L+++ VK+  I     ++ +AIA A   L G  R+++RASGTE LIR
Sbjct: 358 HELLEGLVKFPQKLKNIRVKERFIPSEVPALQKAIAHANERLNGSGRVLLRASGTEPLIR 417

Query: 422 IMAEGDDLSRIKRIVDDLAKVIPMI 446
           +M EG D   +  ++D L+  +  +
Sbjct: 418 VMVEGRDDELVSDLIDYLSAEVQKV 442


>gi|30018425|ref|NP_830056.1| phosphoglucosamine mutase [Bacillus cereus ATCC 14579]
 gi|206972281|ref|ZP_03233228.1| phosphoglucosamine mutase [Bacillus cereus AH1134]
 gi|218233725|ref|YP_002365005.1| phosphoglucosamine mutase [Bacillus cereus B4264]
 gi|296500989|ref|YP_003662689.1| phosphoglucosamine mutase [Bacillus thuringiensis BMB171]
 gi|81580835|sp|Q81J03|GLMM_BACCR RecName: Full=Phosphoglucosamine mutase
 gi|226722709|sp|B7HJK3|GLMM_BACC4 RecName: Full=Phosphoglucosamine mutase
 gi|29893965|gb|AAP07257.1| Phosphoglucosamine mutase [Bacillus cereus ATCC 14579]
 gi|206732855|gb|EDZ50030.1| phosphoglucosamine mutase [Bacillus cereus AH1134]
 gi|218161682|gb|ACK61674.1| phosphoglucosamine mutase [Bacillus cereus B4264]
 gi|296322041|gb|ADH04969.1| phosphoglucosamine mutase [Bacillus thuringiensis BMB171]
 gi|326937952|gb|AEA13848.1| phosphoglucosamine mutase [Bacillus thuringiensis serovar chinensis
           CT-43]
          Length = 448

 Score =  265 bits (677), Expect = 1e-68,   Method: Composition-based stats.
 Identities = 193/444 (43%), Positives = 276/444 (62%), Gaps = 5/444 (1%)

Query: 4   RFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSLV 63
           ++FGTDG+RG +N   +TP    +IG   GY+        +V+IG+DTR+SG+MLE +LV
Sbjct: 3   KYFGTDGVRGVANK-ELTPELAFKIGRFGGYVLTKDTDRPKVIIGRDTRVSGHMLEGALV 61

Query: 64  AGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVST 123
           AG  + G +   LG I +P VA LT++L A  GVMISASHNP QDNGIK FG DG+K++ 
Sbjct: 62  AGLLSTGAEVMRLGVISTPGVAYLTKALDAQAGVMISASHNPVQDNGIKFFGSDGFKLTD 121

Query: 124 DIEDRIETLLEDDLTSYLSCYD-SIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVVD 182
           + E  IE LL+ ++         ++G          +Y++++K+T+  +    GL I +D
Sbjct: 122 EQEAEIEALLDKEVDELPRPTGTNLGQVSDYFEGGQKYLQYIKQTV--EEDFSGLHIALD 179

Query: 183 CANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIAL 242
           CA+GA+  +AP +F +L AD+  +G  PNG+NIN   GST+   L   V E  ADIG+A 
Sbjct: 180 CAHGATSSLAPYLFADLEADISTMGTSPNGMNINEGVGSTHPEGLAELVKEKGADIGLAF 239

Query: 243 DGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLGL 302
           DGDGDR+I VDEKG IV+GDQIM + A+       L+ N +V+TVMSN+G  + +    +
Sbjct: 240 DGDGDRLIAVDEKGNIVDGDQIMFICAKYMKETGQLKHNTVVSTVMSNLGFYKALEANNI 299

Query: 303 SLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKPV 362
           +  +T VGDRY+ME MK  G+N+GGEQSGHIIL DY +TGDG+++ALQ++  +K   KP+
Sbjct: 300 TSDKTAVGDRYVMEEMKRGGYNLGGEQSGHIILLDYITTGDGMLSALQLVNIMKMTKKPL 359

Query: 363 STICHCFEEYPQFLRSVSVKDTS-ILNSSSIVQAIADAESELRGIDRLIVRASGTESLIR 421
           S +     ++PQ L +V V D    L +  I + I   E E+ G  R++VR SGTE LIR
Sbjct: 360 SELAGEMTKFPQLLVNVRVTDKKLALENEKIKEIIRVVEEEMNGDGRILVRPSGTEPLIR 419

Query: 422 IMAEGDDLSRIKRIVDDLAKVIPM 445
           +MAE          V  + +V+  
Sbjct: 420 VMAEAPTQEVCDAYVHRIVEVVKA 443


>gi|209520870|ref|ZP_03269611.1| phosphoglucosamine mutase [Burkholderia sp. H160]
 gi|209498677|gb|EDZ98791.1| phosphoglucosamine mutase [Burkholderia sp. H160]
          Length = 452

 Score =  265 bits (677), Expect = 1e-68,   Method: Composition-based stats.
 Identities = 196/452 (43%), Positives = 284/452 (62%), Gaps = 10/452 (2%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRG------KKKHRRVVIGKDTRLS 54
           M RR+FGTDGIRGK    PITP F++R+G A G +  G            V+IGKDTR+S
Sbjct: 1   MARRYFGTDGIRGKVGEGPITPEFVLRLGYAAGKVLAGADRWAKTGTRPTVLIGKDTRVS 60

Query: 55  GYMLENSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLF 114
           GYMLE +L +GF+AAG+D  + GP+P+P +A LTR+LR   GV+ISASHNPY DNGIK F
Sbjct: 61  GYMLEAALESGFSAAGVDVMLAGPMPTPGIAYLTRALRLAAGVVISASHNPYYDNGIKFF 120

Query: 115 GPDGYKVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTL 174
             DG K+  D+E  IE  LE  L    +  + +G A+R+D    RYIE  K T P    L
Sbjct: 121 SADGNKLPDDVEALIEEQLE--LPLACAASEQLGKARRLDDAAGRYIEFCKSTFPAAYDL 178

Query: 175 QGLRIVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEV 234
           +G+++VVDCA+GA+Y VAP VF ELGA+V+ IG  PNG NIN   G+T   +L R V   
Sbjct: 179 RGMKLVVDCAHGAAYDVAPHVFHELGAEVIPIGVAPNGFNINDGVGATAPDALVRAVRAN 238

Query: 235 RADIGIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLE 294
            AD+GIALDGD DR+ IVD  G + NGD+++ ++ ++ ++ S      + T  M+N+ +E
Sbjct: 239 HADLGIALDGDADRLQIVDGSGRLFNGDELLYVLVKDRIATSGHVEGAVGTL-MTNMAVE 297

Query: 295 RFIAGLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRY 354
             +   G+   R  VGDRY++E ++ +G+ +G E SGHI+  D  STGDG+V+AL VL  
Sbjct: 298 VALQRAGVKFVRAAVGDRYVLEQLREHGWQLGAEGSGHILSLDRHSTGDGIVSALLVLAA 357

Query: 355 IKQYDKPVSTICHCFEEYPQFLRSVSVKDTSILNSSS-IVQAIADAESELRGIDRLIVRA 413
           +++  K ++ +    + +PQ L +V +K  +    S  I +AI +AE  L G  R+++RA
Sbjct: 358 MQRSGKSLADLLDGVKLFPQKLINVRMKPGADWKGSEPIRRAIKEAEGALDGRGRVLIRA 417

Query: 414 SGTESLIRIMAEGDDLSRIKRIVDDLAKVIPM 445
           SGTE ++R+M E  +++   +  + +A  +  
Sbjct: 418 SGTEPVLRVMVEAQNVADAVQHSEAIADAVRE 449


>gi|303327627|ref|ZP_07358068.1| phosphoglucosamine mutase [Desulfovibrio sp. 3_1_syn3]
 gi|302862567|gb|EFL85500.1| phosphoglucosamine mutase [Desulfovibrio sp. 3_1_syn3]
          Length = 450

 Score =  265 bits (677), Expect = 1e-68,   Method: Composition-based stats.
 Identities = 219/446 (49%), Positives = 295/446 (66%), Gaps = 2/446 (0%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M  R FGTDG+RG  N  P+T +  +R+G+A G  FR      +VVIGKDTRLSGYM E+
Sbjct: 1   MAERLFGTDGLRGTVNNAPMTVDVALRLGLAAGVRFRRGPHQHKVVIGKDTRLSGYMFES 60

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +L AG  AAGM   + GP+P+PA++ LTRS+RAD+GV+ISASHNP+ DNGIK F  DGYK
Sbjct: 61  ALTAGLCAAGMHVIMTGPLPTPAISFLTRSMRADLGVVISASHNPFSDNGIKFFDADGYK 120

Query: 121 VSTDIEDRI-ETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRI 179
           +    E+ I E +L  D+         +G A +++    RYI + K   P  +TL GLRI
Sbjct: 121 LPDQTENEIAEMVLNPDMAWPYPDPRQVGRATKIEDAGGRYIVYTKSCFPTQLTLSGLRI 180

Query: 180 VVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIG 239
           VVDCANGASYKVAP    ELGA+V  +   P+G NIN  CGS     +  KV EVRAD+G
Sbjct: 181 VVDCANGASYKVAPLALEELGAEVFRLSTAPDGTNINDHCGSLYPEVVAAKVREVRADVG 240

Query: 240 IALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAG 299
           +ALDGD DR+I+VDE G +++GDQ+MAL A+  M+   L GN +V TVMSN+ LE F+  
Sbjct: 241 LALDGDADRLIVVDEHGNVLDGDQLMALCAQSMMARGELPGNMLVATVMSNLALEIFMRE 300

Query: 300 LGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYD 359
            G +L RT+VGDRY++E M+  G  +GGEQSGH+I   Y +TGDGL+AALQ+LR +++ +
Sbjct: 301 HGGTLLRTKVGDRYVVEAMRREGAMLGGEQSGHLIFRGYSTTGDGLLAALQILRIMREKE 360

Query: 360 KPVSTICHCFEEYPQFLRSVSVKDT-SILNSSSIVQAIADAESELRGIDRLIVRASGTES 418
           KP+S +      +PQ L +V V+         +I +A+A  E EL G  R+++R SGTE+
Sbjct: 361 KPLSELAGLLTPFPQRLVNVRVEKRLPFEERPAIGEAVAKVEKELAGRGRVLLRYSGTEA 420

Query: 419 LIRIMAEGDDLSRIKRIVDDLAKVIP 444
           L RIM EG+D  +++    DLA V+ 
Sbjct: 421 LCRIMVEGEDEDKVRAFAADLADVVA 446


>gi|300691221|ref|YP_003752216.1| phosphoglucosamine mutase [Ralstonia solanacearum PSI07]
 gi|299078281|emb|CBJ50929.1| phosphoglucosamine mutase [Ralstonia solanacearum PSI07]
          Length = 447

 Score =  265 bits (677), Expect = 1e-68,   Method: Composition-based stats.
 Identities = 188/450 (41%), Positives = 279/450 (62%), Gaps = 9/450 (2%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKK-----KHRRVVIGKDTRLSG 55
           M R++FGTDGIRG+    PITP+F++R+G A G +              V+IGKDTRLSG
Sbjct: 1   MSRKYFGTDGIRGRVGESPITPDFVLRLGYAAGRVLAHGSEAHGHGRPTVLIGKDTRLSG 60

Query: 56  YMLENSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFG 115
           YMLE +L AGFTAAG+D  + GP+P+P VA LTR+LR   GV+ISASHNPY DNGIK F 
Sbjct: 61  YMLEAALEAGFTAAGVDVLMSGPLPTPGVAYLTRALRLSAGVVISASHNPYYDNGIKFFS 120

Query: 116 PDGYKVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQ 175
             G K+  + E +IE  LE  +    +  D++G A+R+D    RYIE  K T P D+ L 
Sbjct: 121 ATGDKLPDETESQIEAELEKPME--YAASDALGRARRIDDAAGRYIEFCKSTFPNDLNLF 178

Query: 176 GLRIVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVR 235
           G++IV+D A+GA+Y +AP VF ELGADV+ IG++PNG NIN   G+T    L     +  
Sbjct: 179 GMKIVLDSAHGAAYHIAPHVFHELGADVISIGNQPNGRNINDGYGATAPAKLIEATRQHG 238

Query: 236 ADIGIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLER 295
           AD+G+A DGD DR+ +VD+ G + NGD+++ ++ +   +        + T  M+N+ +E 
Sbjct: 239 ADLGLAFDGDADRLQVVDKNGRLYNGDELLYVMVQARRAAGQAVPGAVGTL-MTNLAVEL 297

Query: 296 FIAGLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYI 355
            +   G+   R +VGDRY++E +K  G+ +GGE SGH++  D  STGDG+++ALQVL  +
Sbjct: 298 ALKAQGVDFVRAKVGDRYVLEELKKRGWLLGGEGSGHLLCLDKHSTGDGIISALQVLAAL 357

Query: 356 KQYDKPVSTICHCFEEYPQFLRSVSVK-DTSILNSSSIVQAIADAESELRGIDRLIVRAS 414
           ++  + +  +      +PQ L +V V+        +++  A+  +E+EL G  R+++R S
Sbjct: 358 RRSGQTLEQVLDGVHLFPQKLINVRVERGFDWKAHAALQAALKVSEAELNGKGRVLIRPS 417

Query: 415 GTESLIRIMAEGDDLSRIKRIVDDLAKVIP 444
           GTE ++R+M E  D +   +  + LA  I 
Sbjct: 418 GTEPVVRVMVEAQDAALATKHAEQLAATIR 447


>gi|56418689|ref|YP_146007.1| phosphoglucosamine mutase [Geobacillus kaustophilus HTA426]
 gi|261417654|ref|YP_003251336.1| phosphoglucosamine mutase [Geobacillus sp. Y412MC61]
 gi|297528528|ref|YP_003669803.1| phosphoglucosamine mutase [Geobacillus sp. C56-T3]
 gi|319765311|ref|YP_004130812.1| phosphoglucosamine mutase [Geobacillus sp. Y412MC52]
 gi|81348347|sp|Q5L3P1|GLMM_GEOKA RecName: Full=Phosphoglucosamine mutase
 gi|56378531|dbj|BAD74439.1| phosphoglucomutase (glycolysis) [Geobacillus kaustophilus HTA426]
 gi|261374111|gb|ACX76854.1| phosphoglucosamine mutase [Geobacillus sp. Y412MC61]
 gi|297251780|gb|ADI25226.1| phosphoglucosamine mutase [Geobacillus sp. C56-T3]
 gi|317110177|gb|ADU92669.1| phosphoglucosamine mutase [Geobacillus sp. Y412MC52]
          Length = 449

 Score =  265 bits (676), Expect = 1e-68,   Method: Composition-based stats.
 Identities = 186/442 (42%), Positives = 271/442 (61%), Gaps = 2/442 (0%)

Query: 4   RFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSLV 63
           ++FGTDG+RG +N   +TP    +IG   GY+     +  +V+IG+DTR+SG+MLE +LV
Sbjct: 3   KYFGTDGVRGVANR-ELTPELAFQIGRCGGYVLTKSAERPKVLIGRDTRISGHMLEGALV 61

Query: 64  AGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVST 123
           AG  + G +   LG I +P VA LT++L A  G+MISASHNP QDNGIK FGPDG+K+S 
Sbjct: 62  AGLLSIGAEVMRLGVISTPGVAYLTKALGAQAGIMISASHNPVQDNGIKFFGPDGFKLSD 121

Query: 124 DIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVVDC 183
           + E  IE L++           +            +      +    +    G++I +DC
Sbjct: 122 EQEAEIEALIDSAEDMLPRPIGAGLGQVNDYFEGGQKYLQYLKQTIDEEDFSGMKIALDC 181

Query: 184 ANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIALD 243
           A+GA+  +A  +F +L ADVV +G  PNG+NIN   GST+  +L   V E  AD+G+A D
Sbjct: 182 AHGATSSLATYLFADLDADVVTMGASPNGLNINEGVGSTHPEALAAFVKEKGADVGLAFD 241

Query: 244 GDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLGLS 303
           GDGDR+I VDE+G IV+GDQIM + A+       L+   +V+TVMSN+G  + +   G+ 
Sbjct: 242 GDGDRLIAVDERGNIVDGDQIMYICAKYLKETGRLKQQTVVSTVMSNLGFYKALEAQGIK 301

Query: 304 LKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKPVS 363
             +T VGDRY++E MK NG+N+GGEQSGHII  DY +TGDG++ ALQ++  +K   KP+S
Sbjct: 302 SVQTAVGDRYVVEEMKKNGYNLGGEQSGHIIFLDYNTTGDGMLTALQLVNIMKIKGKPLS 361

Query: 364 TICHCFEEYPQFLRSVSVKDTSI-LNSSSIVQAIADAESELRGIDRLIVRASGTESLIRI 422
            +    ++YPQ L +V V D    + +  + + I + E+E+ G  R++VR SGTE L+RI
Sbjct: 362 ELAGEMKKYPQLLVNVRVADKEKAMENEQVKKVIQEVEAEMNGNGRVLVRPSGTEPLVRI 421

Query: 423 MAEGDDLSRIKRIVDDLAKVIP 444
           MAE       +  V+ +A V+ 
Sbjct: 422 MAEAQTEEACRAYVERIADVVR 443


>gi|315127238|ref|YP_004069241.1| phosphoglucosamine mutase [Pseudoalteromonas sp. SM9913]
 gi|315015752|gb|ADT69090.1| phosphoglucosamine mutase [Pseudoalteromonas sp. SM9913]
          Length = 449

 Score =  265 bits (676), Expect = 1e-68,   Method: Composition-based stats.
 Identities = 190/446 (42%), Positives = 289/446 (64%), Gaps = 6/446 (1%)

Query: 1   MK-RRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLE 59
           MK R++FGTDG+RG     PI P F M++G A G +       ++V+IGKDTR+SGYMLE
Sbjct: 1   MKERKYFGTDGVRGLVGQGPINPEFAMKLGWAAGRVL-SLHGTKKVIIGKDTRISGYMLE 59

Query: 60  NSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGY 119
            +L AG  AAG+D  +LGP+P+PAVA L ++ RA+ G++ISASHNPY DNGIK F   G 
Sbjct: 60  TALEAGLIAAGIDVILLGPMPTPAVAYLAQTFRAEAGIVISASHNPYYDNGIKFFNGQGL 119

Query: 120 KVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRI 179
           K+  ++E +IE +L++ +T      D +G A R+     RYIE  K   P+ ++L+G++I
Sbjct: 120 KLDDEVELQIEAMLDEPMTCVA--SDKLGKATRLSSADGRYIEFCKSQFPQGLSLEGIKI 177

Query: 180 VVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIG 239
           V+DCANGA+Y +AP V  ELGA+V+    +PNG+NIN +CG+T+V +L+RKV E +AD+G
Sbjct: 178 VLDCANGATYHIAPSVMRELGAEVITHACEPNGVNINHECGATHVDTLKRKVLEHKADVG 237

Query: 240 IALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAG 299
           IA DGDGDRV++VD  G + +GD ++ +IA    +     G G+V TVMSN+GLE  +  
Sbjct: 238 IAYDGDGDRVMMVDHNGRVFDGDDLVYIIA-CQAAQDDNLGGGVVGTVMSNMGLENALKA 296

Query: 300 LGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYD 359
             ++  R++VGDRY+ME ++  G+ +GGE SGH++  D  STGDG++++LQVL  +   +
Sbjct: 297 KNIAFARSKVGDRYVMELLQQKGWKIGGESSGHVLNLDLISTGDGIISSLQVLAAMVAQN 356

Query: 360 KPVSTICHCFEEYPQFLRSVSVK-DTSILNSSSIVQAIADAESELRGIDRLIVRASGTES 418
           + +  +   F +YP  + +V     T    +  ++ A+A+ E  L    R+++R SGTE 
Sbjct: 357 RTLQDLGAGFTKYPMKMINVRYTAGTDPTQAPEVLAAVAEVEQSLADKGRVLLRKSGTEP 416

Query: 419 LIRIMAEGDDLSRIKRIVDDLAKVIP 444
           ++R+M E +    +      +A V+ 
Sbjct: 417 VVRVMVEAEQEKIVIDSAQKIAAVVE 442


>gi|126448255|ref|YP_001080142.1| phosphoglucosamine mutase [Burkholderia mallei NCTC 10247]
 gi|238563622|ref|ZP_04610642.1| phosphoglucosamine mutase [Burkholderia mallei GB8 horse 4]
 gi|251767841|ref|ZP_02268577.2| phosphoglucosamine mutase [Burkholderia mallei PRL-20]
 gi|254177692|ref|ZP_04884347.1| phosphoglucosamine mutase [Burkholderia mallei ATCC 10399]
 gi|254180200|ref|ZP_04886799.1| phosphoglucosamine mutase [Burkholderia pseudomallei 1655]
 gi|254199453|ref|ZP_04905819.1| phosphoglucosamine mutase [Burkholderia mallei FMH]
 gi|254205766|ref|ZP_04912118.1| phosphoglucosamine mutase [Burkholderia mallei JHU]
 gi|254259683|ref|ZP_04950737.1| phosphoglucosamine mutase [Burkholderia pseudomallei 1710a]
 gi|126241125|gb|ABO04218.1| phosphoglucosamine mutase [Burkholderia mallei NCTC 10247]
 gi|147749049|gb|EDK56123.1| phosphoglucosamine mutase [Burkholderia mallei FMH]
 gi|147753209|gb|EDK60274.1| phosphoglucosamine mutase [Burkholderia mallei JHU]
 gi|160698731|gb|EDP88701.1| phosphoglucosamine mutase [Burkholderia mallei ATCC 10399]
 gi|184210740|gb|EDU07783.1| phosphoglucosamine mutase [Burkholderia pseudomallei 1655]
 gi|238520338|gb|EEP83799.1| phosphoglucosamine mutase [Burkholderia mallei GB8 horse 4]
 gi|243061548|gb|EES43734.1| phosphoglucosamine mutase [Burkholderia mallei PRL-20]
 gi|254218372|gb|EET07756.1| phosphoglucosamine mutase [Burkholderia pseudomallei 1710a]
          Length = 467

 Score =  265 bits (676), Expect = 1e-68,   Method: Composition-based stats.
 Identities = 197/455 (43%), Positives = 281/455 (61%), Gaps = 10/455 (2%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFR------GKKKHRRVVIGKDTRLS 54
           M RR+FGTDGIRGK    PITP+F++R+G A G +               V+IGKDTR+S
Sbjct: 16  MGRRYFGTDGIRGKVGDAPITPDFVLRLGYAAGKVLASAPGRAASGARPTVLIGKDTRVS 75

Query: 55  GYMLENSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLF 114
           GYMLE +L AGF+AAG+D  + GP+P+P VA LTR+LR   GV+ISASHNPY DNGIK F
Sbjct: 76  GYMLEAALEAGFSAAGVDVMLAGPMPTPGVAYLTRALRLSAGVVISASHNPYHDNGIKFF 135

Query: 115 GPDGYKVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTL 174
             DG K+  +IE  IE  L+  L    +  D +G A+R+D    RYIE  K T P    L
Sbjct: 136 SADGNKLPDEIEAEIEAWLDKPLD--CAASDGLGKARRLDDAAGRYIEFCKSTFPAAFDL 193

Query: 175 QGLRIVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEV 234
           +G+++VVDCA+GA+Y+VAP VF ELGADV+ IG  PNG NIN   G+T   +L R V   
Sbjct: 194 RGMKLVVDCAHGAAYQVAPHVFHELGADVIPIGVAPNGFNINDGVGATAPDALMRAVRAN 253

Query: 235 RADIGIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLE 294
            AD+GIALDGD DR+++VD  G + NGD+++ ++ ++ ++ +      + T  M+N  +E
Sbjct: 254 HADLGIALDGDADRLLVVDHTGRLYNGDELLYVLVKDRIATNGQVEGAVGTL-MTNFAVE 312

Query: 295 RFIAGLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRY 354
             +   G+   R  VGDRY++E ++  G+ +G E SGHI+  D  STGDG+V+AL VL  
Sbjct: 313 VALKEAGVQFVRAAVGDRYVLEQLRERGWQLGAEGSGHILSLDRHSTGDGIVSALLVLAA 372

Query: 355 IKQYDKPVSTICHCFEEYPQFLRSVSVKDTSILNS-SSIVQAIADAESELRGIDRLIVRA 413
           +K+  K ++ +      +PQ L +V +K  +      +I +AI  AE  L G  R+++RA
Sbjct: 373 LKRSGKTLAQMLEGVTLFPQKLINVRMKPGADWKGSEAIRRAIDSAEQALSGSGRVLIRA 432

Query: 414 SGTESLIRIMAEGDDLSRIKRIVDDLAKVIPMIDS 448
           SGTE ++R+M E    +   R  + +A  +    +
Sbjct: 433 SGTEPVLRVMVEARQATDANRHAEAIADAVKQATA 467


>gi|53725543|ref|YP_102542.1| phosphoglucosamine mutase [Burkholderia mallei ATCC 23344]
 gi|76808929|ref|YP_333021.1| phosphoglucosamine mutase [Burkholderia pseudomallei 1710b]
 gi|121601119|ref|YP_992625.1| phosphoglucosamine mutase [Burkholderia mallei SAVP1]
 gi|124384735|ref|YP_001026573.1| phosphoglucosamine mutase [Burkholderia mallei NCTC 10229]
 gi|126454506|ref|YP_001065787.1| phosphoglucosamine mutase [Burkholderia pseudomallei 1106a]
 gi|167738065|ref|ZP_02410839.1| phosphoglucosamine mutase [Burkholderia pseudomallei 14]
 gi|167823658|ref|ZP_02455129.1| phosphoglucosamine mutase [Burkholderia pseudomallei 9]
 gi|167845202|ref|ZP_02470710.1| phosphoglucosamine mutase [Burkholderia pseudomallei B7210]
 gi|167893754|ref|ZP_02481156.1| phosphoglucosamine mutase [Burkholderia pseudomallei 7894]
 gi|167918470|ref|ZP_02505561.1| phosphoglucosamine mutase [Burkholderia pseudomallei BCC215]
 gi|217423381|ref|ZP_03454882.1| phosphoglucosamine mutase [Burkholderia pseudomallei 576]
 gi|226196132|ref|ZP_03791717.1| phosphoglucosamine mutase [Burkholderia pseudomallei Pakistan 9]
 gi|237811781|ref|YP_002896232.1| phosphoglucosamine mutase [Burkholderia pseudomallei MSHR346]
 gi|242317812|ref|ZP_04816828.1| phosphoglucosamine mutase [Burkholderia pseudomallei 1106b]
 gi|254198070|ref|ZP_04904492.1| phosphoglucosamine mutase [Burkholderia pseudomallei S13]
 gi|254358833|ref|ZP_04975106.1| phosphoglucosamine mutase [Burkholderia mallei 2002721280]
 gi|81605292|sp|Q62L77|GLMM_BURMA RecName: Full=Phosphoglucosamine mutase
 gi|123599578|sp|Q3JTT2|GLMM_BURP1 RecName: Full=Phosphoglucosamine mutase
 gi|158513525|sp|A3NTW6|GLMM_BURP0 RecName: Full=Phosphoglucosamine mutase
 gi|166990400|sp|A2S3Q4|GLMM_BURM9 RecName: Full=Phosphoglucosamine mutase
 gi|166990401|sp|A1V322|GLMM_BURMS RecName: Full=Phosphoglucosamine mutase
 gi|172044082|sp|A3MIQ6|GLMM_BURM7 RecName: Full=Phosphoglucosamine mutase
 gi|52428966|gb|AAU49559.1| phosphoglucosamine mutase [Burkholderia mallei ATCC 23344]
 gi|76578382|gb|ABA47857.1| phosphoglucosamine mutase [Burkholderia pseudomallei 1710b]
 gi|121229929|gb|ABM52447.1| phosphoglucosamine mutase [Burkholderia mallei SAVP1]
 gi|124292755|gb|ABN02024.1| phosphoglucosamine mutase [Burkholderia mallei NCTC 10229]
 gi|126228148|gb|ABN91688.1| phosphoglucosamine mutase [Burkholderia pseudomallei 1106a]
 gi|148027960|gb|EDK85981.1| phosphoglucosamine mutase [Burkholderia mallei 2002721280]
 gi|169654811|gb|EDS87504.1| phosphoglucosamine mutase [Burkholderia pseudomallei S13]
 gi|217393239|gb|EEC33260.1| phosphoglucosamine mutase [Burkholderia pseudomallei 576]
 gi|225931718|gb|EEH27720.1| phosphoglucosamine mutase [Burkholderia pseudomallei Pakistan 9]
 gi|237506394|gb|ACQ98712.1| phosphoglucosamine mutase [Burkholderia pseudomallei MSHR346]
 gi|242141051|gb|EES27453.1| phosphoglucosamine mutase [Burkholderia pseudomallei 1106b]
          Length = 452

 Score =  265 bits (676), Expect = 1e-68,   Method: Composition-based stats.
 Identities = 197/455 (43%), Positives = 281/455 (61%), Gaps = 10/455 (2%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFR------GKKKHRRVVIGKDTRLS 54
           M RR+FGTDGIRGK    PITP+F++R+G A G +               V+IGKDTR+S
Sbjct: 1   MGRRYFGTDGIRGKVGDAPITPDFVLRLGYAAGKVLASAPGRAASGARPTVLIGKDTRVS 60

Query: 55  GYMLENSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLF 114
           GYMLE +L AGF+AAG+D  + GP+P+P VA LTR+LR   GV+ISASHNPY DNGIK F
Sbjct: 61  GYMLEAALEAGFSAAGVDVMLAGPMPTPGVAYLTRALRLSAGVVISASHNPYHDNGIKFF 120

Query: 115 GPDGYKVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTL 174
             DG K+  +IE  IE  L+  L    +  D +G A+R+D    RYIE  K T P    L
Sbjct: 121 SADGNKLPDEIEAEIEAWLDKPLD--CAASDGLGKARRLDDAAGRYIEFCKSTFPAAFDL 178

Query: 175 QGLRIVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEV 234
           +G+++VVDCA+GA+Y+VAP VF ELGADV+ IG  PNG NIN   G+T   +L R V   
Sbjct: 179 RGMKLVVDCAHGAAYQVAPHVFHELGADVIPIGVAPNGFNINDGVGATAPDALMRAVRAN 238

Query: 235 RADIGIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLE 294
            AD+GIALDGD DR+++VD  G + NGD+++ ++ ++ ++ +      + T  M+N  +E
Sbjct: 239 HADLGIALDGDADRLLVVDHTGRLYNGDELLYVLVKDRIATNGQVEGAVGTL-MTNFAVE 297

Query: 295 RFIAGLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRY 354
             +   G+   R  VGDRY++E ++  G+ +G E SGHI+  D  STGDG+V+AL VL  
Sbjct: 298 VALKEAGVQFVRAAVGDRYVLEQLRERGWQLGAEGSGHILSLDRHSTGDGIVSALLVLAA 357

Query: 355 IKQYDKPVSTICHCFEEYPQFLRSVSVKDTSILNS-SSIVQAIADAESELRGIDRLIVRA 413
           +K+  K ++ +      +PQ L +V +K  +      +I +AI  AE  L G  R+++RA
Sbjct: 358 LKRSGKTLAQMLEGVTLFPQKLINVRMKPGADWKGSEAIRRAIDSAEQALSGSGRVLIRA 417

Query: 414 SGTESLIRIMAEGDDLSRIKRIVDDLAKVIPMIDS 448
           SGTE ++R+M E    +   R  + +A  +    +
Sbjct: 418 SGTEPVLRVMVEARQATDANRHAEAIADAVKQATA 452


>gi|126728907|ref|ZP_01744722.1| phosphoglucosamine mutase [Sagittula stellata E-37]
 gi|126710837|gb|EBA09888.1| phosphoglucosamine mutase [Sagittula stellata E-37]
          Length = 451

 Score =  265 bits (676), Expect = 1e-68,   Method: Composition-based stats.
 Identities = 231/448 (51%), Positives = 310/448 (69%), Gaps = 4/448 (0%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKH-RRVVIGKDTRLSGYMLE 59
           M R+ FGTDG+RGK+NT+P+T    + +G AVG  FR +     RVVIGKDTRLSGYM E
Sbjct: 1   MSRKLFGTDGVRGKANTYPMTVELAVALGAAVGRHFRNEHGGVHRVVIGKDTRLSGYMFE 60

Query: 60  NSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGY 119
           N+L AG T+ GM+  +LGP+P+PAV +LT S+RAD+G+MISASHNP  DNGIK FGPDG+
Sbjct: 61  NALTAGLTSTGMNVLLLGPVPTPAVGLLTTSMRADLGIMISASHNPADDNGIKFFGPDGF 120

Query: 120 KVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRI 179
           K+S  +E  IE L+E  +  + +   +IG AKR+D    RY E +K TLP  + L G+++
Sbjct: 121 KLSDAVEAEIEGLVEGGV--HAAQPQNIGRAKRIDDGRFRYQERIKGTLPSGLRLDGIKV 178

Query: 180 VVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIG 239
           VVDCANGA+YK APEV WELGADVV +G  PNG+NIN  CGST+  +    V    AD+G
Sbjct: 179 VVDCANGAAYKTAPEVLWELGADVVPLGTNPNGLNINDKCGSTHPQAAAEAVVAHGADVG 238

Query: 240 IALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAG 299
           + LDGD DR+I++DE G +V+GDQIMAL+A  W     L+G  +V TVMSN+GLERF+ G
Sbjct: 239 LCLDGDADRIILIDETGTVVDGDQIMALLADRWAEEDRLKGGALVATVMSNLGLERFLDG 298

Query: 300 LGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYD 359
            GL L+RT VGDRY++E M+  GFN+GGEQSGHI+++DY +TGDGL+A LQ L  + +  
Sbjct: 299 RGLRLERTAVGDRYVVERMRAGGFNLGGEQSGHIVMTDYATTGDGLMAGLQFLAEMVRTG 358

Query: 360 KPVSTICHCFEEYPQFLRSVSV-KDTSILNSSSIVQAIADAESELRGIDRLIVRASGTES 418
           +  S +   F   PQ L++V      + L+S  +   I DAE+ L G  RL++R SGTE 
Sbjct: 359 RRASELTRSFAPVPQLLKNVRFGPGVAPLDSEQVKAVIRDAEARLAGKGRLLIRKSGTEP 418

Query: 419 LIRIMAEGDDLSRIKRIVDDLAKVIPMI 446
           LIR+MAE +D + +  +VD +   +  +
Sbjct: 419 LIRVMAECEDDALLLSVVDGIVAEVEAV 446


>gi|307302379|ref|ZP_07582137.1| phosphoglucosamine mutase [Shewanella baltica BA175]
 gi|306914417|gb|EFN44838.1| phosphoglucosamine mutase [Shewanella baltica BA175]
          Length = 450

 Score =  265 bits (676), Expect = 1e-68,   Method: Composition-based stats.
 Identities = 205/452 (45%), Positives = 288/452 (63%), Gaps = 12/452 (2%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M R++FGTDG+RGK   FPITP+F M++G A G +       + V+IGKDTR SGYMLE+
Sbjct: 1   MSRKYFGTDGVRGKVGEFPITPDFAMKLGWAAGTVLAS-SGTKEVLIGKDTRSSGYMLES 59

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           ++ AGF+AAG++  ++GP+P+PAVA L  + RAD GV+ISASHNP+ DNGIK F   G K
Sbjct: 60  AMEAGFSAAGVNVALIGPMPTPAVAYLASTFRADAGVVISASHNPFYDNGIKFFSNSGTK 119

Query: 121 VSTDIEDRIETLLEDDLTSYLSC---YDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGL 177
           ++   E  IE LLE  L          + +G  +R+D    RYIE  K T P  ++L G 
Sbjct: 120 LNDAQELEIEALLEKALNQNAMQCVASEKLGKVRRIDDAAGRYIEFCKGTFPNHLSLTGF 179

Query: 178 RIVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRAD 237
           +IVVD A+GA+Y +AP V+ ELGA+V+ I DKPNG+NIN  CG+T++ SLQ  V    AD
Sbjct: 180 KIVVDSAHGAAYHIAPNVYRELGAEVISINDKPNGVNINDHCGATHLDSLQTAVMVHEAD 239

Query: 238 IGIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFI 297
           +GIALDGD DRV+ VD  G +V+GD+I+ ++A+   S   + G  + T  MSN+GLE  +
Sbjct: 240 LGIALDGDADRVMFVDHNGHVVDGDEILFILAQAAHSKGEMTGGVVGTL-MSNLGLELAL 298

Query: 298 AGLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQ 357
             + +   R +VGDRY++E +K  G+ +GGE SGHI+   + STGDG+VA+LQVL+ + +
Sbjct: 299 KQMDIPFVRAKVGDRYVVEQLKATGWQLGGEGSGHILSLQHASTGDGIVASLQVLKAVLE 358

Query: 358 YDKPVSTICHCFEEYPQFLRSVSV---KDTSILNSSSIVQAIADAESELRGIDRLIVRAS 414
             K +S I     + PQ L +V +      SIL  SS+ QA+  AE  L    R+++R S
Sbjct: 359 SQKSLSEIKAGMTKLPQVLINVRLATADADSILAKSSVQQAVIKAEGILGDQGRVLLRKS 418

Query: 415 GTESLIRIMAEGDD----LSRIKRIVDDLAKV 442
           GTE LIR+M E  D     ++ + I D +   
Sbjct: 419 GTEPLIRVMVESTDNVMTQTQAEYIADAVRAA 450


>gi|28212123|ref|NP_783067.1| phosphoglucosamine mutase [Clostridium tetani E88]
 gi|75541630|sp|Q890U1|GLMM_CLOTE RecName: Full=Phosphoglucosamine mutase
 gi|28204566|gb|AAO37004.1| phosphoglucosamine mutase [Clostridium tetani E88]
          Length = 448

 Score =  265 bits (676), Expect = 1e-68,   Method: Composition-based stats.
 Identities = 201/449 (44%), Positives = 277/449 (61%), Gaps = 8/449 (1%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M R  FGTDG+RG +N   +T      +G A  Y+        ++V+G DTR+SG+MLE+
Sbjct: 1   MSR-MFGTDGVRGIANE-ELTAEVAYNLGKAGAYVLTEGTHKPKIVVGMDTRISGHMLES 58

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +LVAG  + G +A  LG +P+PAVA LTR   AD GV+ISASHNP + NGIK F   GYK
Sbjct: 59  ALVAGILSMGGEAICLGIVPTPAVAHLTRKYGADAGVVISASHNPVEYNGIKFFDKGGYK 118

Query: 121 VSTDIEDRIETLLEDDLTSYLSC-YDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRI 179
           +  ++EDRI++++E++         + IG    +D     YIE  K T+     L+GLR+
Sbjct: 119 LPDELEDRIQSVIENNFEGVPCPTGEDIGEKTIIDDAIKDYIEFAKGTIKG--DLKGLRV 176

Query: 180 VVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIG 239
            +DCANGASYK + E F +LGA+V VI ++PNG NIN DCGST++ SL++ V E   D G
Sbjct: 177 ALDCANGASYKASVETFKDLGAEVYVINNEPNGKNINKDCGSTHMESLRKYVVEKGCDFG 236

Query: 240 IALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAG 299
           +A DGD DR + VDEKG IVNGD +MA+ A+    H  L  N +V TVMSNIGL   +  
Sbjct: 237 LAFDGDADRCLAVDEKGNIVNGDFMMAICAKYMKDHKKLDKNTMVVTVMSNIGLFIAMER 296

Query: 300 LGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYD 359
             + L +T+VGDRY++E M   G+ +GGEQSGHII  DY +TGDGLV ALQ+   IK  +
Sbjct: 297 EKIDLIKTKVGDRYVLEEMLKEGYKIGGEQSGHIIFLDYNTTGDGLVTALQLSSIIKDSN 356

Query: 360 KPVSTICHCFEEYPQFLRSVSVKDTSI---LNSSSIVQAIADAESELRGIDRLIVRASGT 416
           K +S +    +E PQ L +  V +      +    I   I   E ++ G  R+++R SGT
Sbjct: 357 KKLSELASIMKELPQVLLNAKVTNNMKNIYIEDEEIAGEIKKIEEQMEGKGRVLIRPSGT 416

Query: 417 ESLIRIMAEGDDLSRIKRIVDDLAKVIPM 445
           E L+R+M EG++   I +I  DL K+I  
Sbjct: 417 EPLVRVMLEGENQEEIDKIAHDLVKLIEK 445


>gi|239825739|ref|YP_002948363.1| phosphoglucosamine mutase [Geobacillus sp. WCH70]
 gi|239806032|gb|ACS23097.1| phosphoglucosamine mutase [Geobacillus sp. WCH70]
          Length = 448

 Score =  265 bits (676), Expect = 1e-68,   Method: Composition-based stats.
 Identities = 188/444 (42%), Positives = 281/444 (63%), Gaps = 5/444 (1%)

Query: 4   RFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSLV 63
           ++FGTDG+RG +N   +TP    +IG   GY+    ++  +V+IG+DTR+SG+MLE +LV
Sbjct: 3   KYFGTDGVRGVANR-ELTPELAFKIGRCGGYVLTKSEERPKVLIGRDTRISGHMLEGALV 61

Query: 64  AGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVST 123
           AG  + G +   LG I +P VA LT++L A  G+MISASHNP QDNGIK FGPDG+K+S 
Sbjct: 62  AGLLSIGAEVMRLGVISTPGVAYLTKALGAQAGIMISASHNPVQDNGIKFFGPDGFKLSD 121

Query: 124 DIEDRIETLLEDDLTS-YLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVVD 182
           + E  IE L++            ++G          +Y++++K+T+       GL+I +D
Sbjct: 122 EQEQEIEALIDSPEDMLPRPIGKALGQVNDYFEGGQKYLQYLKQTIDE--DFSGLKIALD 179

Query: 183 CANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIAL 242
           CA+GA+  +A  +F +L ADVV +G  PNG+NIN   GST+  +L   V E  AD+G+A 
Sbjct: 180 CAHGATSSLATHLFADLEADVVTMGASPNGLNINEGVGSTHPEALAAFVKEKGADVGLAF 239

Query: 243 DGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLGL 302
           DGDGDR+I VDE G IV+GDQIM + A+       L+   +V+TVMSN+G  + +   G+
Sbjct: 240 DGDGDRLIAVDEYGNIVDGDQIMYICAKYLKETGRLKHQTVVSTVMSNLGFYKALEAQGI 299

Query: 303 SLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKPV 362
              +T VGDRY++E M+ NG+N+GGEQSGHII  DY +TGDGL+ ALQ++  +K  +KP+
Sbjct: 300 QSVQTAVGDRYVVEEMRKNGYNLGGEQSGHIIFLDYNTTGDGLLTALQLVNIMKVKEKPL 359

Query: 363 STICHCFEEYPQFLRSVSVKDT-SILNSSSIVQAIADAESELRGIDRLIVRASGTESLIR 421
           S +    ++YPQ L ++ V D   ++ +  +   I + E+E+ G  R++VR SGTE ++R
Sbjct: 360 SELASEMKKYPQQLVNIKVADKHKVMENEKVKAVIQEVEAEMNGNGRVLVRPSGTEPVVR 419

Query: 422 IMAEGDDLSRIKRIVDDLAKVIPM 445
           +MAE       +  V+ +A V+  
Sbjct: 420 VMAEAPTEEACRNYVERIASVVRE 443


>gi|262274887|ref|ZP_06052698.1| phosphoglucosamine mutase [Grimontia hollisae CIP 101886]
 gi|262221450|gb|EEY72764.1| phosphoglucosamine mutase [Grimontia hollisae CIP 101886]
          Length = 445

 Score =  265 bits (676), Expect = 1e-68,   Method: Composition-based stats.
 Identities = 206/445 (46%), Positives = 298/445 (66%), Gaps = 5/445 (1%)

Query: 2   KRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENS 61
           KR++FGTDG+RGK   FPITP+FM+++G A G +   +   ++V+IGKDTR+SGYMLE++
Sbjct: 3   KRKYFGTDGVRGKVGQFPITPDFMLKLGWAAGRVLSQQG-TKKVLIGKDTRISGYMLESA 61

Query: 62  LVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKV 121
           L AG +AAG+ A   GP+P+PA+A LT++ RA+ G++ISASHNPY DNGIK F  +G K+
Sbjct: 62  LEAGLSAAGLQAAFTGPMPTPAIAYLTQTFRAEAGIVISASHNPYYDNGIKFFSSEGTKL 121

Query: 122 STDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVV 181
             +IE  IE  LE  LT        +G AKR+     RYIE  K T P  ++L+GL+IV+
Sbjct: 122 PDEIELAIEAELEKPLT--CVESSQLGKAKRIVDAAGRYIEFCKGTFPSSMSLKGLKIVL 179

Query: 182 DCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIA 241
           DCA+GA+Y +AP VF ELGADV+ +G +PNG NIN   G+T+V +LQ++V E +A +GIA
Sbjct: 180 DCAHGATYHIAPSVFQELGADVIAMGVEPNGTNINDQVGATDVRALQKRVVEEQAMLGIA 239

Query: 242 LDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLG 301
            DGDGDRVI+VD +G  V+GDQI  +IARE +    L+G  + T  M+N+G+E  +  LG
Sbjct: 240 FDGDGDRVIMVDHEGNKVDGDQIAYIIARESLRRGELKGGVVGTL-MTNMGMEVALKNLG 298

Query: 302 LSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKP 361
           +   R +VGDRY+ME +  NG+ +G E SGH+IL D  +TGD +VAALQVL  +      
Sbjct: 299 IPFTRAKVGDRYVMEKLLENGWTIGAENSGHVILLDKVTTGDAIVAALQVLASVVGTGMS 358

Query: 362 VSTICHCFEEYPQFLRSVSVK-DTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
           +  +C     +PQ L +V    ++  L S +++ A A  E++L    R+++R SGTE LI
Sbjct: 359 LKELCDGMSMFPQVLENVRFSGESDPLQSDAVLSAKAAVEAKLGDKGRVLLRKSGTEPLI 418

Query: 421 RIMAEGDDLSRIKRIVDDLAKVIPM 445
           R+M EG++   ++    ++A+ +  
Sbjct: 419 RVMVEGENAEEVQAYALEIAEAVKA 443


>gi|269468929|gb|EEZ80513.1| phosphomannomutase [uncultured SUP05 cluster bacterium]
          Length = 442

 Score =  265 bits (676), Expect = 1e-68,   Method: Composition-based stats.
 Identities = 201/441 (45%), Positives = 294/441 (66%), Gaps = 4/441 (0%)

Query: 5   FFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSLVA 64
           FFGTDGIRG+    PIT +F +++G AVG +   K     V+IGKDTR+SGY+ E++L A
Sbjct: 4   FFGTDGIRGRVGEEPITADFFLKLGWAVGSVL-AKDGSASVIIGKDTRVSGYLFESALEA 62

Query: 65  GFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVSTD 124
           GF +AG+D  +LGP+P+PAVA LT++  A  GV+ISASHN +QDNG+K F   G+K+S +
Sbjct: 63  GFLSAGVDVGLLGPMPTPAVAYLTQAYGATAGVVISASHNHFQDNGVKFFSSQGFKLSDE 122

Query: 125 IEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVVDCA 184
            +  IE  L + + S     D+IG A R +    RYIE  K T  R V L GL IV+DCA
Sbjct: 123 NQKEIEAKLSESMISV--DSDNIGKAHRHEQPLGRYIEFCKSTFDRSVDLSGLNIVIDCA 180

Query: 185 NGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIALDG 244
           NGA+Y +A  VF ELGA++ +I ++P+G NINL+CG+T+   LQR V E + D+GIA DG
Sbjct: 181 NGATYHIAENVFSELGANITIINNQPDGFNINLNCGATDTKQLQRVVVEQKFDLGIAFDG 240

Query: 245 DGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLGLSL 304
           DGDR+++VD  G +V+GD+++ +IA+ W   S L  N +V T M+N+G+   +  LG++ 
Sbjct: 241 DGDRLMMVDTDGKLVDGDELVFIIAKAWKDQSRLVNNAVVGTKMTNLGMRHALKDLGINF 300

Query: 305 KRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKPVST 364
             T+VGDR++ME M+++G  +GGE SGHII  D  ++GDG+V+ALQVL  + +  K +  
Sbjct: 301 IETDVGDRFVMEQMQSSGSILGGEGSGHIICLDKTTSGDGIVSALQVLEVLAKSHKSLGE 360

Query: 365 ICHCFEEYPQFLRSVSVKDTSILNSSS-IVQAIADAESELRGIDRLIVRASGTESLIRIM 423
           +    E+YPQ L +V  K    L++ + + QA  + E  L    R+++RASGTE LIR+M
Sbjct: 361 LKKEMEKYPQVLINVKTKSKVDLDNHADLKQAQLEVEESLGDEGRVLIRASGTEPLIRVM 420

Query: 424 AEGDDLSRIKRIVDDLAKVIP 444
            EG +L+ +++  D L K++ 
Sbjct: 421 VEGKNLTLVQQSADKLVKILS 441


>gi|83720419|ref|YP_443286.1| phosphoglucosamine mutase [Burkholderia thailandensis E264]
 gi|257139522|ref|ZP_05587784.1| phosphoglucosamine mutase [Burkholderia thailandensis E264]
 gi|123536419|sp|Q2SUW3|GLMM_BURTA RecName: Full=Phosphoglucosamine mutase
 gi|83654244|gb|ABC38307.1| phosphoglucosamine mutase [Burkholderia thailandensis E264]
          Length = 452

 Score =  265 bits (676), Expect = 1e-68,   Method: Composition-based stats.
 Identities = 195/455 (42%), Positives = 279/455 (61%), Gaps = 10/455 (2%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFR------GKKKHRRVVIGKDTRLS 54
           M RR+FGTDGIRGK    PITP+F++R+G A G +               V+IGKDTR+S
Sbjct: 1   MGRRYFGTDGIRGKVGDAPITPDFVLRLGYAAGKVLASAPGRAASGARPTVLIGKDTRVS 60

Query: 55  GYMLENSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLF 114
           GYMLE +L AGF+AAG+D  + GP+P+P VA LTR+LR   GV+ISASHNPY DNGIK F
Sbjct: 61  GYMLEAALEAGFSAAGVDVMLAGPMPTPGVAYLTRALRLSAGVVISASHNPYHDNGIKFF 120

Query: 115 GPDGYKVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTL 174
             DG K+  + E  IE  L+  L       D +G A+R+D    RYIE  K T P    L
Sbjct: 121 SADGNKLPDETEAEIEAWLDKSLDCAP--SDGLGKARRLDDAAGRYIEFCKSTFPAAFDL 178

Query: 175 QGLRIVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEV 234
           +G+++VVDCA+GA+Y+VAP VF ELGADV+ IG  PNG NIN   G+T   +L R V   
Sbjct: 179 RGMKLVVDCAHGAAYQVAPHVFHELGADVIPIGVAPNGFNINDGVGATAPDALMRAVRAN 238

Query: 235 RADIGIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLE 294
            AD+GIALDGD DR+++VD  G + NGD+++ ++ ++ ++ +      + T  M+N+ +E
Sbjct: 239 HADLGIALDGDADRLLVVDHTGRLYNGDELLYVLVKDRIATNGQVEGAVGTL-MTNLAVE 297

Query: 295 RFIAGLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRY 354
             +   G+   R  VGDRY++E ++  G+ +G E SGHI+  D  STGDG+V+AL VL  
Sbjct: 298 VALKDAGVQFVRAAVGDRYVLEQLRERGWQLGAEGSGHILSLDRHSTGDGIVSALLVLAA 357

Query: 355 IKQYDKPVSTICHCFEEYPQFLRSVSVKDTSILNS-SSIVQAIADAESELRGIDRLIVRA 413
           +K+  K ++ +      +PQ L +V +K  +      +I +AI  AE  L G  R+++RA
Sbjct: 358 LKRSGKTLAQMLEGVTLFPQKLINVRMKPGADWKGSDAIRRAIGSAEQALAGSGRVLIRA 417

Query: 414 SGTESLIRIMAEGDDLSRIKRIVDDLAKVIPMIDS 448
           SGTE ++R+M E    +      + +A  +    +
Sbjct: 418 SGTEPVLRVMVEARHAADANHHAEAIADAVKQATA 452


>gi|167582302|ref|ZP_02375176.1| phosphoglucosamine mutase [Burkholderia thailandensis TXDOH]
          Length = 452

 Score =  265 bits (676), Expect = 1e-68,   Method: Composition-based stats.
 Identities = 196/455 (43%), Positives = 280/455 (61%), Gaps = 10/455 (2%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFR------GKKKHRRVVIGKDTRLS 54
           M RR+FGTDGIRGK    PITP+F++R+G A G +               V+IGKDTR+S
Sbjct: 1   MGRRYFGTDGIRGKVGDAPITPDFVLRLGYAAGKVLASAPGRAASGARPTVLIGKDTRVS 60

Query: 55  GYMLENSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLF 114
           GYMLE +L AGF+AAG+D  + GP+P+P VA LTR+LR   GV+ISASHNPY DNGIK F
Sbjct: 61  GYMLEAALEAGFSAAGVDVMLAGPMPTPGVAYLTRALRLSAGVVISASHNPYHDNGIKFF 120

Query: 115 GPDGYKVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTL 174
             DG K+  + E  IE  L+  L       D +G A+R+D    RYIE  K T P    L
Sbjct: 121 SADGNKLPDETEAEIEAWLDKSLDCAP--SDGLGKARRLDDAAGRYIEFCKSTFPAAFDL 178

Query: 175 QGLRIVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEV 234
           +G+++VVDCA+GA+Y+VAP VF ELGADV+ IG  PNG NIN   G+T   +L R V   
Sbjct: 179 RGMKLVVDCAHGAAYQVAPHVFHELGADVIPIGVAPNGFNINDGVGATAPDALMRAVRAN 238

Query: 235 RADIGIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLE 294
            AD+GIALDGD DR+++VD  G + NGD+++ ++ ++ ++ +      + T  M+N+ +E
Sbjct: 239 HADLGIALDGDADRLLVVDHTGRLYNGDELLYVLVKDRIATNGQVEGAVGTL-MTNLAVE 297

Query: 295 RFIAGLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRY 354
             +   G+   R  VGDRY++E ++  G+ +G E SGHI+  D  STGDG+V+AL VL  
Sbjct: 298 VALKDAGVQFVRAAVGDRYVLEQLRERGWQLGAEGSGHILSLDRHSTGDGIVSALLVLAA 357

Query: 355 IKQYDKPVSTICHCFEEYPQFLRSVSVKDTSILN-SSSIVQAIADAESELRGIDRLIVRA 413
           +K+  K ++ +      +PQ L +V +K  +    S +I +AI  AE  L G  R+++RA
Sbjct: 358 LKRSGKTLAQMLEGVTLFPQKLINVRMKPGADWKRSDAIRRAIGSAEQALAGSGRVLIRA 417

Query: 414 SGTESLIRIMAEGDDLSRIKRIVDDLAKVIPMIDS 448
           SGTE ++R+M E    +      + +A  +    +
Sbjct: 418 SGTEPVLRVMVEARHAADANHHAEAIADAVKQATA 452


>gi|167562365|ref|ZP_02355281.1| phosphoglucosamine mutase [Burkholderia oklahomensis EO147]
 gi|167574338|ref|ZP_02367212.1| phosphoglucosamine mutase [Burkholderia oklahomensis C6786]
          Length = 452

 Score =  264 bits (675), Expect = 1e-68,   Method: Composition-based stats.
 Identities = 196/455 (43%), Positives = 281/455 (61%), Gaps = 10/455 (2%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFR------GKKKHRRVVIGKDTRLS 54
           M RR+FGTDGIRGK    PITP+F++R+G A G +               V+IGKDTR+S
Sbjct: 1   MGRRYFGTDGIRGKVGEAPITPDFVLRLGYAAGKVLASAPRRAASGARPTVLIGKDTRVS 60

Query: 55  GYMLENSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLF 114
           GYMLE +L AGF+AAG+D  + GP+P+P VA LTR+LR   GV+ISASHNPY DNGIK F
Sbjct: 61  GYMLEAALEAGFSAAGVDVMLAGPMPTPGVAYLTRALRLSAGVVISASHNPYHDNGIKFF 120

Query: 115 GPDGYKVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTL 174
             DG K+  +IE  IE  L+  L       D +G A+R+D    RYIE  K T P    L
Sbjct: 121 SADGNKLPDEIEAEIEARLDKPLDCAP--SDGLGKARRLDDAAGRYIEFCKSTFPAAFDL 178

Query: 175 QGLRIVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEV 234
           +G+++VVDCA+GA+Y+VAP VF ELGADV+ IG  PNG NIN   G+T   +L R V   
Sbjct: 179 RGMKLVVDCAHGAAYQVAPHVFHELGADVIPIGVSPNGFNINDGVGATAPDALMRAVRAN 238

Query: 235 RADIGIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLE 294
            AD+GIALDGD DR+++VD  G + NGD+++ ++ ++ ++        + T  M+N+ +E
Sbjct: 239 HADLGIALDGDADRLLVVDHTGRLYNGDELLYVLVKDRVATDGRVEGAVGTL-MTNLAVE 297

Query: 295 RFIAGLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRY 354
             +  +G+   R  VGDRY++E ++  G+ +G E SGHI+  D  STGDG+V+AL VL  
Sbjct: 298 VALKDMGVQFVRAAVGDRYVLEQLRERGWQLGAEGSGHILSLDRHSTGDGIVSALLVLAA 357

Query: 355 IKQYDKPVSTICHCFEEYPQFLRSVSVKDTSILNS-SSIVQAIADAESELRGIDRLIVRA 413
           +K+  + ++ +      +PQ L +V +K  +      +I +AI  AE  L G  R+++RA
Sbjct: 358 LKRSGRTLAQMLEGVTLFPQKLINVRMKPGADWKGSDAIRRAIDSAEQALAGSGRVLIRA 417

Query: 414 SGTESLIRIMAEGDDLSRIKRIVDDLAKVIPMIDS 448
           SGTE ++R+M E    +   R  + +A  +    +
Sbjct: 418 SGTEPVLRVMVEARLAADANRHAEAIADAVKQATA 452


>gi|56962025|ref|YP_173747.1| phosphoglucomutase [Bacillus clausii KSM-K16]
 gi|81367409|sp|Q5WLG9|GLMM_BACSK RecName: Full=Phosphoglucosamine mutase
 gi|56908259|dbj|BAD62786.1| phosphoglucomutase [Bacillus clausii KSM-K16]
          Length = 446

 Score =  264 bits (675), Expect = 1e-68,   Method: Composition-based stats.
 Identities = 185/443 (41%), Positives = 269/443 (60%), Gaps = 4/443 (0%)

Query: 4   RFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSLV 63
           ++FGTDG+RG +N   +TP    ++G A GY+   +    +V+IG+DTR+SG MLE SLV
Sbjct: 3   KYFGTDGVRGVAN-SELTPELAFKLGRAGGYVLTKEAAQPKVLIGRDTRISGEMLEASLV 61

Query: 64  AGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVST 123
           AG  + G +   LG I +P VA LT+ L A  G+MISASHNP +DNGIK FG DG+K+  
Sbjct: 62  AGLLSIGAEVMRLGVISTPGVAFLTKQLSATAGIMISASHNPVEDNGIKFFGSDGFKLLD 121

Query: 124 DIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVVDC 183
             E+ IE L++ + T        +G          +Y++ +K+T+      +G+ + +DC
Sbjct: 122 SQEEEIEALIDGEDTMPRPIGGDVGQLNDYFEGSQKYMQFLKQTVEG--GFEGIHVAIDC 179

Query: 184 ANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIALD 243
           ANGA+  +A  V  +L AD+  +G  PNG NIN  CGST+   L + V E +AD+G+A D
Sbjct: 180 ANGAASSLATHVLADLDADISSMGSSPNGTNINACCGSTHPEELAKLVVEKQADVGLAFD 239

Query: 244 GDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLGLS 303
           GD DR+I VDEKG IV+GD+IM +IA        L  N IVTTVMSN+G  + +    + 
Sbjct: 240 GDADRLIAVDEKGEIVDGDKIMYIIASYLKEQGRLNNNTIVTTVMSNLGFYKALEEKQIE 299

Query: 304 LKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKPVS 363
            K+T VGDRY+ME M+   +N+GGEQSGHII  DY +TGDGL+  +Q+L  +KQ  KP+S
Sbjct: 300 TKQTAVGDRYVMEEMRKGNYNLGGEQSGHIIFLDYNTTGDGLLTGVQLLNIMKQTGKPLS 359

Query: 364 TICHCFEEYPQFLRSVSVKDTSILNSSS-IVQAIADAESELRGIDRLIVRASGTESLIRI 422
            +    + +PQ L +V V D   + +++ + Q I   E  + G  R++VR SGTE L+R+
Sbjct: 360 ELAAGMKTFPQCLINVRVTDKDAVKNNALVQQEIKRVEEAMAGEGRILVRPSGTEPLVRV 419

Query: 423 MAEGDDLSRIKRIVDDLAKVIPM 445
           M E       ++  + +  V+  
Sbjct: 420 MVEAKTDELCQQYANQIVDVVKE 442


>gi|253700223|ref|YP_003021412.1| phosphoglucosamine mutase [Geobacter sp. M21]
 gi|259647722|sp|C6E5P5|GLMM_GEOSM RecName: Full=Phosphoglucosamine mutase
 gi|251775073|gb|ACT17654.1| phosphoglucosamine mutase [Geobacter sp. M21]
          Length = 454

 Score =  264 bits (675), Expect = 1e-68,   Method: Composition-based stats.
 Identities = 212/445 (47%), Positives = 302/445 (67%), Gaps = 2/445 (0%)

Query: 3   RRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSL 62
           ++ FGTDG+RG +N +P+T    M+IG A  Y+F+  KK  R+VIGKDTRLSGYMLE++L
Sbjct: 2   KKLFGTDGVRGVANVYPMTAEMAMQIGRAAAYIFKNGKKRHRIVIGKDTRLSGYMLESAL 61

Query: 63  VAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVS 122
           +AG  + G+D  ++GP+P+P +A +T S+RAD GV+ISASHNP++DNGIK F  DG+K+ 
Sbjct: 62  MAGICSMGVDVLLVGPLPTPGIANITSSMRADAGVVISASHNPFEDNGIKFFSRDGFKLP 121

Query: 123 TDIEDRIETLLEDD-LTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVV 181
            + E  +E L+    + S       +G A R+D    R++  +K T P+D+ L GL+IV+
Sbjct: 122 DETELLMEELIFSKRIDSLRPTAKEVGKAYRIDDAQGRFVVFLKSTFPKDLDLSGLKIVL 181

Query: 182 DCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIA 241
           DCANGA+YKVAP VF ELGA+V+ IG KPNG NIN DCGS +   + R V E  AD+GIA
Sbjct: 182 DCANGAAYKVAPAVFEELGAEVISIGVKPNGTNINADCGSLHPEVMSRAVKENGADLGIA 241

Query: 242 LDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLG 301
           LDGD DRVI VDE G +V+GD+IMA+ A E +    L+ N +V TVMSN+GL+  +   G
Sbjct: 242 LDGDADRVIFVDEYGNVVDGDRIMAICATEMLRQGTLKQNTLVATVMSNMGLDIAMKRAG 301

Query: 302 LSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKP 361
             + +T VGDRY++E M   G+N+GGEQSGH+I  D+ +TGDG+++ALQVL  ++++ K 
Sbjct: 302 GQVVKTAVGDRYVVEEMLKGGYNLGGEQSGHMIFLDHNTTGDGVLSALQVLAIMQRHQKR 361

Query: 362 VSTICHCFEEYPQFLRSVSVKDTS-ILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
           +S +    +  PQ L +V + + S I+    I + I D E  L+G  R+++R SGTE L+
Sbjct: 362 LSELALVMDPLPQVLVNVRLAEKSDIMQVPEIAKMINDVEERLKGEGRVLIRYSGTEPLL 421

Query: 421 RIMAEGDDLSRIKRIVDDLAKVIPM 445
           RIM EG D   I+   +D+A ++  
Sbjct: 422 RIMLEGSDEGDIRCWANDIASIVEQ 446


>gi|160876127|ref|YP_001555443.1| phosphoglucosamine mutase [Shewanella baltica OS195]
 gi|205830871|sp|A9KVT4|GLMM2_SHEB9 RecName: Full=Phosphoglucosamine mutase 2
 gi|160861649|gb|ABX50183.1| phosphoglucosamine mutase [Shewanella baltica OS195]
 gi|315268324|gb|ADT95177.1| phosphoglucosamine mutase [Shewanella baltica OS678]
          Length = 450

 Score =  264 bits (675), Expect = 1e-68,   Method: Composition-based stats.
 Identities = 205/452 (45%), Positives = 292/452 (64%), Gaps = 12/452 (2%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M R++FGTDG+RGK   FPITP+F M++G A G +       + V+IGKDTR+SGYMLE+
Sbjct: 1   MSRKYFGTDGVRGKVGDFPITPDFAMKLGWAAGTVLAS-TGTKEVLIGKDTRISGYMLES 59

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           ++ AGF+AAG++  ++GP+P+PAVA L  + RAD GV+ISASHNP+ DNGIK F   G K
Sbjct: 60  AMEAGFSAAGVNVALIGPMPTPAVAYLASTFRADAGVVISASHNPFYDNGIKFFSNSGTK 119

Query: 121 VSTDIEDRIETLLEDDLTSYLSC---YDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGL 177
           ++   E  IE LLE  L          + +G  +R+D    RYIE  K T P  ++L GL
Sbjct: 120 LNDAQELEIEALLEKALNQNAMQCVASEKLGKVRRIDDAAGRYIEFCKGTFPNHLSLAGL 179

Query: 178 RIVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRAD 237
           +IVVD A+GA+Y +AP V+ ELGA+V+ I DKPNG+NIN  CG+T++ SLQ  V    AD
Sbjct: 180 KIVVDSAHGAAYHIAPNVYRELGAEVISINDKPNGVNINDHCGATHLDSLQTAVMVHEAD 239

Query: 238 IGIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFI 297
           +GIALDGD DRV+ VD  G +V+GD+I+ ++A+   S   + G  + T  MSN+GLE  +
Sbjct: 240 LGIALDGDADRVMFVDHNGHVVDGDEILFILAQAAHSKGEMTGGVVGTL-MSNLGLELAL 298

Query: 298 AGLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQ 357
             + +   R +VGDRY++E +K+ G+ +GGE SGHI+   + STGDG+VA+LQVL+ + +
Sbjct: 299 KQMDIPFVRAKVGDRYVVEQLKHTGWQLGGEGSGHILSLQHASTGDGIVASLQVLKAVLE 358

Query: 358 YDKPVSTICHCFEEYPQFLRSVSV---KDTSILNSSSIVQAIADAESELRGIDRLIVRAS 414
             K +S I     + PQ L +V +      SIL ++S+ QA+  AE  L    R+++R S
Sbjct: 359 SQKSLSEIKAGMTKLPQVLINVRLATADADSILATTSVQQAVIKAEEFLGDQGRVLLRKS 418

Query: 415 GTESLIRIMAEGDD----LSRIKRIVDDLAKV 442
           GTE LIR+M E  D     ++ + I D +   
Sbjct: 419 GTEPLIRVMVESTDNVMTQTQAEYIADAVRAA 450


>gi|297620656|ref|YP_003708793.1| putative phosphoglucosamine mutase [Waddlia chondrophila WSU
           86-1044]
 gi|297375957|gb|ADI37787.1| putative phosphoglucosamine mutase [Waddlia chondrophila WSU
           86-1044]
          Length = 454

 Score =  264 bits (675), Expect = 2e-68,   Method: Composition-based stats.
 Identities = 198/446 (44%), Positives = 293/446 (65%), Gaps = 2/446 (0%)

Query: 2   KRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENS 61
           +++ FGTDG+RGK+N  P+T    + +G A G  FR      RVVIGKDTRLS YM EN+
Sbjct: 6   EKKIFGTDGVRGKANFSPMTVETALALGRAAGKFFRRHNGKHRVVIGKDTRLSCYMFENA 65

Query: 62  LVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKV 121
           L+AG  + G+D  ++GP+P+P VA +TR+ RAD G++ISASHN Y+DNGIK F  DG K+
Sbjct: 66  LIAGLCSMGVDTLMVGPLPTPGVAFITRAYRADAGIVISASHNSYEDNGIKFFSSDGIKL 125

Query: 122 STDIEDRIETLLEDDLTSYLSCYDS-IGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           S + E  IE L+E++  +        IG  K++D    RYIE VK T  + ++L G++I 
Sbjct: 126 SDEWEREIEKLIEENDFNDSLPASHLIGRNKKIDDAAGRYIEFVKATFGKKLSLNGMKIA 185

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           +DCANGA+Y+VAP VF EL   V   G  PNG+NIN  CGS +   +Q+ V E  AD+GI
Sbjct: 186 LDCANGAAYRVAPHVFNELDGQVFAYGINPNGLNINDMCGSLHPEVVQKAVIEHHADVGI 245

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           ALDGDGDRVI++DE   IV+GDQ++A+ A+  +    L+   +V T+M+N+G+   +   
Sbjct: 246 ALDGDGDRVILIDEHAQIVDGDQMLAICAKHMLGEGTLKNARVVATIMTNMGIVNAMEQS 305

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           G+ + R+ VGDRY+++ M +NG  +GGEQSGH+I  ++ +TGDGLV+ALQVLR ++    
Sbjct: 306 GIEVIRSAVGDRYVVKEMIDNGAELGGEQSGHVIFLEHNTTGDGLVSALQVLRIMQTTGL 365

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTSIL-NSSSIVQAIADAESELRGIDRLIVRASGTESL 419
            +S +   FE++PQ   +V+VK    L   S + + + D E +L+G  R++VR SGTE++
Sbjct: 366 RLSELAKPFEKFPQVTVNVAVKSKPPLEEISELRKVVQDVEKKLQGKGRVLVRYSGTENM 425

Query: 420 IRIMAEGDDLSRIKRIVDDLAKVIPM 445
            R+M EG++L ++      +A+ +  
Sbjct: 426 CRVMVEGENLHQVSVFAGQIAESVEQ 451


>gi|167621272|ref|ZP_02389903.1| phosphoglucosamine mutase [Burkholderia thailandensis Bt4]
          Length = 452

 Score =  264 bits (675), Expect = 2e-68,   Method: Composition-based stats.
 Identities = 195/455 (42%), Positives = 279/455 (61%), Gaps = 10/455 (2%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFR------GKKKHRRVVIGKDTRLS 54
           M RR+FGTDGIRGK    PITP+F++R+G A G +               V+IGKDTR+S
Sbjct: 1   MGRRYFGTDGIRGKVGDAPITPDFVLRLGYAAGKVLASAPGRAASGARPTVLIGKDTRVS 60

Query: 55  GYMLENSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLF 114
           GYMLE +L AGF+AAG+D  + GP+P+P VA LTR+LR   GV+ISASHNPY DNGIK F
Sbjct: 61  GYMLEAALEAGFSAAGVDVMLAGPMPTPGVAYLTRALRLSAGVVISASHNPYHDNGIKFF 120

Query: 115 GPDGYKVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTL 174
             DG K+  + E  IE  L+  L       D +G A+R+D    RYIE  K T P    L
Sbjct: 121 SADGNKLPDETEAEIEAWLDKSLDCAP--SDGLGKARRLDDAAGRYIEFCKSTFPAAFDL 178

Query: 175 QGLRIVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEV 234
           +G+++VVDCA+GA+Y+VAP VF ELGADV+ IG  PNG NIN   G+T   +L R V   
Sbjct: 179 RGMKLVVDCAHGAAYQVAPHVFHELGADVIPIGVAPNGFNINDGVGATAPDALMRAVRAN 238

Query: 235 RADIGIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLE 294
            AD+GIALDGD DR+++VD  G + NGD+++ ++ ++ ++ +      + T  M+N+ +E
Sbjct: 239 HADLGIALDGDADRLLVVDHTGRLYNGDELLYVLVKDRIATNGRVEGAVGTL-MTNLAVE 297

Query: 295 RFIAGLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRY 354
             +   G+   R  VGDRY++E ++  G+ +G E SGHI+  D  STGDG+V+AL VL  
Sbjct: 298 VALKDAGVQFVRAAVGDRYVLEQLRERGWQLGAEGSGHILSLDRHSTGDGIVSALLVLAA 357

Query: 355 IKQYDKPVSTICHCFEEYPQFLRSVSVKDTSILNS-SSIVQAIADAESELRGIDRLIVRA 413
           +K+  K ++ +      +PQ L +V +K  +      +I +AI  AE  L G  R+++RA
Sbjct: 358 LKRSGKTLAQMLEGVTLFPQKLINVRMKPGADWKGSDAIRRAIGSAEQALAGSGRVLIRA 417

Query: 414 SGTESLIRIMAEGDDLSRIKRIVDDLAKVIPMIDS 448
           SGTE ++R+M E    +      + +A  +    +
Sbjct: 418 SGTEPVLRVMVEARHAADANHHAEAIADAVKQATA 452


>gi|307266838|ref|ZP_07548360.1| phosphoglucosamine mutase [Thermoanaerobacter wiegelii Rt8.B1]
 gi|306918126|gb|EFN48378.1| phosphoglucosamine mutase [Thermoanaerobacter wiegelii Rt8.B1]
          Length = 447

 Score =  264 bits (675), Expect = 2e-68,   Method: Composition-based stats.
 Identities = 199/447 (44%), Positives = 282/447 (63%), Gaps = 7/447 (1%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M R  FGTDG+RG +N + +TP     +G A  Y         ++V+GKD+R+S  MLE 
Sbjct: 1   MAR-LFGTDGVRGIAN-YDLTPQLAFELGRAGAYALTEGSHRPKIVVGKDSRISSDMLEC 58

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +L AG T+ G +   +G IP+PAVA LTR  +AD GVMISASHNP + NGIK F  +GYK
Sbjct: 59  ALAAGLTSVGTEVISVGIIPTPAVAYLTRLYQADAGVMISASHNPVEYNGIKFFDKNGYK 118

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +  ++EDRIE ++++ +         IG  K     H  YIE +K T+     L+G++IV
Sbjct: 119 LPDEVEDRIENIIKEKIELPSPIGTGIGTRKEYTNSHRDYIEFLKSTIDG--DLKGMKIV 176

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           +DCA GAS  VAP +F ELGA+V++ G +P G  IN++CGST+   LQ+ V E  ADIG+
Sbjct: 177 IDCAYGASSTVAPILFKELGAEVILHGAEPIGEKINVNCGSTHPEKLQQLVIENGADIGL 236

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           A DGD DR+I VDEKG +V+GD IMA+ A +      L+ N +V TVMSNIG E  +   
Sbjct: 237 AFDGDADRLIAVDEKGNVVDGDHIMAICAIDLKKKGRLKNNTVVATVMSNIGFEIALKEQ 296

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           G++L RT+VGDRY++E M   G+++GGEQSGHII  +  +TGDG + AL++   +K+  K
Sbjct: 297 GINLIRTKVGDRYVLEEMIKGGYSIGGEQSGHIIFLNDNTTGDGEITALKLCSILKESGK 356

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTSI---LNSSSIVQAIADAESELRGIDRLIVRASGTE 417
            +S +  C   YPQ L +  VK+      L    I + I + E E+RG  R+++R SGTE
Sbjct: 357 KLSELAACMVTYPQVLINAKVKNELKHAYLEDEEIKREIENLEREMRGEGRVLIRPSGTE 416

Query: 418 SLIRIMAEGDDLSRIKRIVDDLAKVIP 444
            L+R+M EG D  +I ++  +LA++I 
Sbjct: 417 PLVRVMVEGKDYDKISQMAKELAELIE 443


>gi|78223093|ref|YP_384840.1| phosphoglucosamine mutase [Geobacter metallireducens GS-15]
 gi|123571772|sp|Q39UF9|GLMM_GEOMG RecName: Full=Phosphoglucosamine mutase
 gi|78194348|gb|ABB32115.1| phosphoglucosamine mutase [Geobacter metallireducens GS-15]
          Length = 451

 Score =  264 bits (675), Expect = 2e-68,   Method: Composition-based stats.
 Identities = 206/445 (46%), Positives = 291/445 (65%), Gaps = 2/445 (0%)

Query: 3   RRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSL 62
           ++ FGTDG+RG +N +P+T    M+IG A  YLF+   +  R+VIGKDTRLSGYMLEN+L
Sbjct: 2   KKLFGTDGVRGVANVYPMTTEMAMQIGRAAAYLFKNGNRRHRIVIGKDTRLSGYMLENAL 61

Query: 63  VAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVS 122
           VAG  + G+D  ++GP+P+P +A +T S+RAD GV+ISASHN +QDNGIK F  DG+K+ 
Sbjct: 62  VAGICSMGVDVLVVGPLPTPGIANITSSMRADAGVVISASHNAFQDNGIKFFSRDGFKLP 121

Query: 123 TDIEDRIETLL-EDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVV 181
            ++E +IE L+    + S       +G A R+D    RY+  +K T P+++ L G++IV+
Sbjct: 122 DEMELKIEELIFSKKIDSLRPIATEVGKAYRIDDAVGRYVVFLKNTFPKELDLTGMKIVL 181

Query: 182 DCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIA 241
           DCANGA+YKVAP V  ELGA+V+  G KPNG NIN   GS +   +   V E RAD+GIA
Sbjct: 182 DCANGAAYKVAPAVLEELGAEVIPYGIKPNGTNINAGFGSLHPEVISEAVKEHRADLGIA 241

Query: 242 LDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLG 301
           LDGD DRVI VDE G  V+GD IMA+ A + + H  LR N +V TVMSN+GL+  +   G
Sbjct: 242 LDGDADRVIFVDEFGNEVDGDHIMAICATDMLKHKKLRKNTLVATVMSNMGLDIAVKKAG 301

Query: 302 LSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKP 361
             + +T VGDRY++E M   G+N+GGEQSGH+I  D+ +TGDG+++ALQVL  +++  K 
Sbjct: 302 GKVIKTAVGDRYVVEEMLKGGYNLGGEQSGHMIFLDHNTTGDGMLSALQVLAIMRRSGKT 361

Query: 362 VSTICHCFEEYPQFLRSVSVKDTS-ILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
           +S +       PQ L +V V +   I+    +   I   E +L+   R+++R SGTE L+
Sbjct: 362 LSELAEVMIPLPQVLVNVRVTEKKDIMTIPEVAALIRGVEDKLKDEGRILIRYSGTEPLL 421

Query: 421 RIMAEGDDLSRIKRIVDDLAKVIPM 445
           RIM EG D  +I     ++A ++  
Sbjct: 422 RIMLEGQDKYQITGWAKEIADLVEK 446


>gi|78043024|ref|YP_360831.1| phosphoglucosamine mutase [Carboxydothermus hydrogenoformans
           Z-2901]
 gi|123575746|sp|Q3AAK3|GLMM_CARHZ RecName: Full=Phosphoglucosamine mutase
 gi|77995139|gb|ABB14038.1| phosphoglucosamine mutase [Carboxydothermus hydrogenoformans
           Z-2901]
          Length = 443

 Score =  264 bits (675), Expect = 2e-68,   Method: Composition-based stats.
 Identities = 194/445 (43%), Positives = 284/445 (63%), Gaps = 6/445 (1%)

Query: 4   RFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSLV 63
           + FGTDG+RG +N   +TP    ++G A  Y+ + K   + +V+GKDTR+SG MLE +L 
Sbjct: 3   KLFGTDGVRGVANR-DLTPELAYKLGRAAAYVLKKKYNGQGIVVGKDTRISGDMLETALA 61

Query: 64  AGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVST 123
           AG  + G++   +G +P+PA+A LTR L+A  G +ISASHNP +DNGIK F   G+K+  
Sbjct: 62  AGILSVGLNVLRVGVMPTPAIAYLTRELKATAGAVISASHNPMEDNGIKFFSGSGFKLPD 121

Query: 124 DIEDRIETLLEDDLTSYLSCYD-SIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVVD 182
           ++E+ IE  +  +    +      IG  + +      Y    K T+  ++   GLR+VVD
Sbjct: 122 EVEEEIEKYVLGEKEIPIRPIGAEIGRVREISDAVLLYKSFAKNTV--ELPFSGLRVVVD 179

Query: 183 CANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIAL 242
           CANGA+  VAP+++ ELGA+V+ I + P+G NIN +CGST+  +L R V E  A +G+A 
Sbjct: 180 CANGAASYVAPKIYEELGAEVIPIFNTPDGTNINANCGSTHPEALMRAVVEEGAHLGLAH 239

Query: 243 DGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLGL 302
           DGD DRV+ VDEKG +V+GDQIM +I +      LL+ N IV TVMSN+GL++  A  G+
Sbjct: 240 DGDADRVLAVDEKGNLVDGDQIMVIIGKYLKKKGLLKNNRIVVTVMSNLGLKKAFAREGI 299

Query: 303 SLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKPV 362
            +  T+VGDRY++E M  NG  +GGEQSGHIIL D+ +TGDG++ ALQ+++ I    K +
Sbjct: 300 EVLETKVGDRYVLEEMLKNGAIIGGEQSGHIILLDHNTTGDGIITALQLMQVIVAEGKKL 359

Query: 363 STICHCFEEYPQFLRSVSVKDTSIL-NSSSIVQAIADAESELRGIDRLIVRASGTESLIR 421
           S +     ++PQ L++V V D   +  S  + +AIA  E +L G  R++VR SGTE LIR
Sbjct: 360 SELAQEMPKFPQVLKNVRVLDKEKIMASEELAKAIARGEKKL-GEGRILVRPSGTEPLIR 418

Query: 422 IMAEGDDLSRIKRIVDDLAKVIPMI 446
           +MAEG D    + +VD++  VI  +
Sbjct: 419 VMAEGADAKLTEEVVDEIIAVIEKL 443


>gi|71281940|ref|YP_270123.1| phosphoglucosamine mutase [Colwellia psychrerythraea 34H]
 gi|84029239|sp|Q47YJ7|GLMM_COLP3 RecName: Full=Phosphoglucosamine mutase
 gi|71147680|gb|AAZ28153.1| phosphoglucosamine mutase [Colwellia psychrerythraea 34H]
          Length = 445

 Score =  264 bits (675), Expect = 2e-68,   Method: Composition-based stats.
 Identities = 188/448 (41%), Positives = 284/448 (63%), Gaps = 6/448 (1%)

Query: 1   MK-RRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLE 59
           M  R++FGTDGIRG    +PITP F+M++G A G +  G+   ++V+IGKDTR+SGYMLE
Sbjct: 1   MSDRKYFGTDGIRGLVGQYPITPEFVMKLGYAAGKVLAGQG-TKKVLIGKDTRISGYMLE 59

Query: 60  NSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGY 119
           ++L AGF+AAG+D  +LGP+P+P +A LT++ RA+ G++ISASHNP+ DNGIK F   G 
Sbjct: 60  SALEAGFSAAGIDVGLLGPMPTPGIAYLTKTFRAEAGIVISASHNPFYDNGIKFFSNTGE 119

Query: 120 KVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRI 179
           K+   +E  IE  L++ +         +G A RV+    RYIE  K   P  ++L+ L I
Sbjct: 120 KLPDAVELAIEAELDNPM--GCVESAKLGKASRVNDAAGRYIEFCKSNFPSKISLKDLTI 177

Query: 180 VVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIG 239
           VVDCA+GA+Y +AP VF ELGA V+ IG  PNG NIN  CG+T++ ++ + V E +AD+G
Sbjct: 178 VVDCAHGATYHIAPNVFRELGATVIEIGTAPNGTNINQGCGATSMAAISKAVVEHKADLG 237

Query: 240 IALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAG 299
           IALDGDGDR+++VD     V     +  I       +  +  G+V T+MSN+GLE  +  
Sbjct: 238 IALDGDGDRIMMVDHT-GYVIDGDEIIYIIACNDLKTGRKEGGVVGTLMSNMGLELALKE 296

Query: 300 LGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYD 359
           L +   R+ VGDR++ME ++  G+ +G E SGH+I  ++ STGDG++AAL VL  + + +
Sbjct: 297 LDIEFARSNVGDRHVMELLREKGWQLGAENSGHVINLNHTSTGDGIIAALNVLTAVTKQE 356

Query: 360 KPVSTICHCFEEYPQFLRSVSVK-DTSILNSSSIVQAIADAESELRGIDRLIVRASGTES 418
           K +  +       PQ L +V      + LN + ++ A+ +    L G  R+++R SGTE 
Sbjct: 357 KSLFELRQGLTMLPQLLVNVRFSGQNNPLNDADVLAAVDEVNETLTGRGRVLLRKSGTEP 416

Query: 419 LIRIMAEGDDLSRIKRIVDDLAKVIPMI 446
           LIR+M EG D+  +  + + +A ++ ++
Sbjct: 417 LIRVMVEGPDMDEVTLLANKIADLVKLV 444


>gi|126441617|ref|YP_001058527.1| phosphoglucosamine mutase [Burkholderia pseudomallei 668]
 gi|166990402|sp|A3N856|GLMM_BURP6 RecName: Full=Phosphoglucosamine mutase
 gi|126221110|gb|ABN84616.1| phosphoglucosamine mutase [Burkholderia pseudomallei 668]
          Length = 452

 Score =  264 bits (675), Expect = 2e-68,   Method: Composition-based stats.
 Identities = 197/455 (43%), Positives = 282/455 (61%), Gaps = 10/455 (2%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFR------GKKKHRRVVIGKDTRLS 54
           M RR+FGTDGIRGK    PITP+F++R+G A G +               V+IGKDTR+S
Sbjct: 1   MGRRYFGTDGIRGKVGDAPITPDFVLRLGYAAGKVLASAPGRAASGARPTVLIGKDTRVS 60

Query: 55  GYMLENSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLF 114
           GYMLE +L AGF+AAG+D  + GP+P+P VA LTR+LR   GV+ISASHNPY DNGIK F
Sbjct: 61  GYMLEAALEAGFSAAGVDVMLAGPMPTPGVAYLTRALRLSAGVVISASHNPYHDNGIKFF 120

Query: 115 GPDGYKVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTL 174
             DG K+  +IE +IE  L+  L    +  D +G A+R+D    RYIE  K T P    L
Sbjct: 121 SADGNKLPDEIEAKIEAWLDKPLD--CAASDGLGKARRLDDAAGRYIEFCKSTFPAAFDL 178

Query: 175 QGLRIVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEV 234
           +G+++VVDCA+GA+Y+VAP VF ELGADV+ IG  PNG NIN   G+T   +L R V   
Sbjct: 179 RGMKLVVDCAHGAAYQVAPHVFHELGADVIPIGVAPNGFNINDGVGATAPDALMRAVRAN 238

Query: 235 RADIGIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLE 294
            AD+GIALDGD DR+++VD  G + NGD+++ ++ ++ ++ +      + T  M+N  +E
Sbjct: 239 HADLGIALDGDADRLLVVDHTGRLYNGDELLYVLVKDRIATNGQVEGAVGTL-MTNFAVE 297

Query: 295 RFIAGLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRY 354
             +   G+   R  VGDRY++E ++  G+ +G E SGHI+  D  STGDG+V+AL VL  
Sbjct: 298 VALKEAGVQFVRAAVGDRYVLEQLRERGWQLGAEGSGHILSLDRHSTGDGIVSALLVLAA 357

Query: 355 IKQYDKPVSTICHCFEEYPQFLRSVSVKDTSILNS-SSIVQAIADAESELRGIDRLIVRA 413
           +K+  K ++ +      +PQ L +V +K  +      +I +AI  AE  L G  R+++RA
Sbjct: 358 LKRSGKTLAQMLEGVTLFPQKLINVRMKPGADWKGSEAIRRAIDSAEQALSGSGRVLIRA 417

Query: 414 SGTESLIRIMAEGDDLSRIKRIVDDLAKVIPMIDS 448
           SGTE ++R+M E    +   R  + +A  +    +
Sbjct: 418 SGTEPVLRVMVEARQATDANRHAEAIADAVKQATA 452


>gi|220904977|ref|YP_002480289.1| phosphoglucosamine mutase [Desulfovibrio desulfuricans subsp.
           desulfuricans str. ATCC 27774]
 gi|254798575|sp|B8J1K3|GLMM_DESDA RecName: Full=Phosphoglucosamine mutase
 gi|219869276|gb|ACL49611.1| phosphoglucosamine mutase [Desulfovibrio desulfuricans subsp.
           desulfuricans str. ATCC 27774]
          Length = 450

 Score =  264 bits (675), Expect = 2e-68,   Method: Composition-based stats.
 Identities = 222/446 (49%), Positives = 300/446 (67%), Gaps = 2/446 (0%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M  R FGTDG+RG  NT+P+T +  +R+G+A G  FR  +   +VVIGKDTRLSGYM E+
Sbjct: 1   MADRLFGTDGLRGTVNTYPMTVDVALRLGLAAGIRFRRGQHQHKVVIGKDTRLSGYMFES 60

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +L AG  AAGM   + GP+P+PA++ LTRS+RAD+GV+ISASHNP+QDNGIK F  DGYK
Sbjct: 61  ALTAGLCAAGMHVIMTGPLPTPAISFLTRSMRADLGVVISASHNPFQDNGIKFFDADGYK 120

Query: 121 VSTDIEDRIETL-LEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRI 179
           +    ED I  + L+   +        +G A +++    RYI + K   P  +TL GLRI
Sbjct: 121 LPDMAEDEIAAMVLDAGFSWPYPDSRGVGRATKIEDAGGRYIVYTKNCFPAHLTLSGLRI 180

Query: 180 VVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIG 239
           VVDCANGASYKVAP    ELGA+V  IG  P+G NIN  CGS +   +  KV EVRADIG
Sbjct: 181 VVDCANGASYKVAPLALEELGAEVFRIGTGPDGTNINEHCGSLHPDVVAAKVREVRADIG 240

Query: 240 IALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAG 299
           +ALDGD DR+I+VDE+G +++GDQIMAL A+  M+   L GN +V T MSN+ LE F+  
Sbjct: 241 LALDGDADRLIVVDERGVVLDGDQIMALCAQAMMARGELPGNLLVATAMSNMALELFMRD 300

Query: 300 LGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYD 359
            G  L RT+VGDRY+ME M+  G  +GGEQSGH+I   Y +TGDGL+AALQ+LR +++ +
Sbjct: 301 HGGQLLRTKVGDRYVMEAMRREGAMLGGEQSGHLIFHRYSTTGDGLLAALQILRIMREKE 360

Query: 360 KPVSTICHCFEEYPQFLRSVSVKDT-SILNSSSIVQAIADAESELRGIDRLIVRASGTES 418
           +P+S +      +PQ L +V V+         +I +A+A  E EL G  R+++R SGTE+
Sbjct: 361 RPLSELAGLLTPFPQKLINVRVEKRLPFEERPAIGEAVAQVEKELGGRGRVLLRYSGTEA 420

Query: 419 LIRIMAEGDDLSRIKRIVDDLAKVIP 444
           L R+M EG+   R++   +DLA+V+ 
Sbjct: 421 LCRVMVEGEHEDRVRTYAEDLAQVVE 446


>gi|77359821|ref|YP_339396.1| phosphoglucosamine mutase [Pseudoalteromonas haloplanktis TAC125]
 gi|84029251|sp|Q3IE61|GLMM_PSEHT RecName: Full=Phosphoglucosamine mutase
 gi|76874732|emb|CAI85953.1| phosphoglucosamine mutase [Pseudoalteromonas haloplanktis TAC125]
          Length = 449

 Score =  264 bits (675), Expect = 2e-68,   Method: Composition-based stats.
 Identities = 191/446 (42%), Positives = 289/446 (64%), Gaps = 6/446 (1%)

Query: 1   MK-RRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLE 59
           MK R++FGTDG+RG     PI P F M++G A G +   +   ++V+IGKDTR+SGYMLE
Sbjct: 1   MKERKYFGTDGVRGLVGEHPINPEFAMKLGWAAGRVL-SENGTKKVMIGKDTRISGYMLE 59

Query: 60  NSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGY 119
            +L AG  AAG+D  +LGP+P+PA+A L ++ RA+ G++ISASHNPY DNGIK F   G 
Sbjct: 60  TALQAGLIAAGIDVVLLGPMPTPAIAYLAQTFRAEAGIVISASHNPYYDNGIKFFNCRGL 119

Query: 120 KVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRI 179
           K+   +E  IE +L++ +T      D +G A R+     RYIE  K   P+ ++L+GL+I
Sbjct: 120 KLDDKVELEIEAMLDEPMT--CVESDKLGKASRLTSADGRYIEFCKSQFPQSLSLEGLKI 177

Query: 180 VVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIG 239
           V+DCANGA+Y +AP V  ELGA+++    +PNG+NIN +CG+T+V +L+RKV E  AD+G
Sbjct: 178 VLDCANGATYHIAPSVMRELGANIITHACEPNGVNINHECGATHVDTLKRKVLEHNADVG 237

Query: 240 IALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAG 299
           IA DGDGDRV++VD  G + +GD ++ +IA    +     G G+V TVMSN+GLE  +  
Sbjct: 238 IAYDGDGDRVMMVDHNGRVFDGDDLVYIIA-CQAAQDDNLGGGVVGTVMSNMGLENALKA 296

Query: 300 LGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYD 359
            G+   R++VGDRY+ME ++  G+ +GGE SGH++  D  STGDG++++LQVL  +   +
Sbjct: 297 KGIEFARSKVGDRYVMELLQQKGWTIGGESSGHVLNLDLISTGDGIISSLQVLAAMVAQN 356

Query: 360 KPVSTICHCFEEYPQFLRSVS-VKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTES 418
           K +  +   F +YP  + +V     T    + +++ A+A+ E  L    R+++R SGTE 
Sbjct: 357 KTLQDLGTGFTKYPMKMINVRYTPGTDPTKAPAVLAAVAEVEQTLGEKGRVLLRKSGTEP 416

Query: 419 LIRIMAEGDDLSRIKRIVDDLAKVIP 444
           ++R+M E +    +    + +A V+ 
Sbjct: 417 VVRVMVEAEQEKLVIDSAEKIAAVVE 442


>gi|154707057|ref|YP_001424785.1| phosphoglucosamine mutase [Coxiella burnetii Dugway 5J108-111]
 gi|189040781|sp|A9KGE3|GLMM_COXBN RecName: Full=Phosphoglucosamine mutase
 gi|154356343|gb|ABS77805.1| phosphoglucosamine mutase [Coxiella burnetii Dugway 5J108-111]
          Length = 446

 Score =  264 bits (674), Expect = 2e-68,   Method: Composition-based stats.
 Identities = 198/446 (44%), Positives = 300/446 (67%), Gaps = 4/446 (0%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M++++FGTDGIRGK     I   FM+++G AVG +         V+IGKDTR+SGYM+E+
Sbjct: 1   MQKKYFGTDGIRGKVGNSLINAEFMLKLGWAVGRVLAN-SHSATVLIGKDTRISGYMIES 59

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +L AG +AAG++  + GP+P+PA+A LT S+RAD G++ISASHN Y DNG+K F  DG+K
Sbjct: 60  ALQAGLSAAGVNIKLTGPMPTPAIAYLTNSVRADAGIVISASHNHYPDNGVKFFNKDGFK 119

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +S ++E  IE  ++  + + +   D +G A R++  H RYIE  K T P ++TL+GL+IV
Sbjct: 120 LSDELELAIEKQIDKPMKTVV--ADRLGKAARMNEAHGRYIEFCKSTFPSNLTLKGLKIV 177

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           VDCANGA+Y VAP +F ELGA+VV I D P+G NIN  CG+T+   LQ  V +  AD+GI
Sbjct: 178 VDCANGAAYAVAPSIFHELGAEVVAIADDPDGFNINQTCGATDTAHLQEMVVKHNADVGI 237

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           A DGDGDR+I+VD  G  V+GD+++ ++A +          G+V T+MSN+GLE+ +   
Sbjct: 238 AFDGDGDRLIMVDHHGLRVDGDELLCIMAIDRFYLKENAPLGVVGTIMSNLGLEQTLKRH 297

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
            ++ +R+ VGDRY+++ M+  G+ +GGE SGHI+   + +TGDG++ ALQ+LR ++Q +K
Sbjct: 298 HIAFERSPVGDRYVLDLMQQKGWFLGGESSGHIVDLGFTTTGDGVITALQILRIMQQAEK 357

Query: 361 PVSTICHCFEEYPQFLRSVSVKD-TSILNSSSIVQAIADAESELRGIDRLIVRASGTESL 419
           P++ +     + PQ L +V +K    I  + +I +AI +AE +L G  R+++R SGTE +
Sbjct: 358 PLADLKKVMVKNPQVLINVPIKGILDIAQNPNIKKAITEAEKQLNGAGRILLRPSGTEPV 417

Query: 420 IRIMAEGDDLSRIKRIVDDLAKVIPM 445
           IR+M EG D   +++  + LA  +  
Sbjct: 418 IRVMVEGSDEGIVRQTAEMLAAAVQQ 443


>gi|114571034|ref|YP_757714.1| phosphoglucosamine mutase [Maricaulis maris MCS10]
 gi|122315282|sp|Q0ALR7|GLMM_MARMM RecName: Full=Phosphoglucosamine mutase
 gi|114341496|gb|ABI66776.1| phosphoglucosamine mutase [Maricaulis maris MCS10]
          Length = 449

 Score =  264 bits (674), Expect = 2e-68,   Method: Composition-based stats.
 Identities = 238/447 (53%), Positives = 314/447 (70%), Gaps = 2/447 (0%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M +++FGTDG+RG++N+FP+T    +R+G+A G  F        VVIGKDTRLSGYM+E+
Sbjct: 1   MGKKYFGTDGVRGQTNSFPMTAENALRLGMAAGRYFVRHTGRHSVVIGKDTRLSGYMIES 60

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +LVAGFT+ GMD F  GP+P+PAVA++TRSLRAD+GVMI+ASHNPY DNG+KLFGPDG K
Sbjct: 61  ALVAGFTSVGMDVFQFGPLPTPAVALMTRSLRADLGVMITASHNPYHDNGMKLFGPDGRK 120

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +    E  IE L++  L   L+    +G AKRVD    RY+E VK + PR   L  LR+V
Sbjct: 121 LDDKAELEIEALMDGSLVDGLAAPSDLGRAKRVDDAQARYVEIVKSSFPRAQRLSNLRLV 180

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           VDCANGA YKVAP   WELGADV+ IG +PNG N+N +CGST    L ++V + RAD+GI
Sbjct: 181 VDCANGAGYKVAPAALWELGADVIPIGVEPNGFNVNEECGSTAPARLSKEVIKYRADLGI 240

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           ALDGDGDRV++ DEKG +++GDQI+ L+A  W     LR   IV+TVMSN+GLE+++AG 
Sbjct: 241 ALDGDGDRVVLCDEKGRVIDGDQILGLLAGHWQDIGELRHPAIVSTVMSNLGLEQYLAGR 300

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           G++L+RT VGDRY+ E M+  G N+GGE SGHI++ DY  TGDGL+AALQVLR +    K
Sbjct: 301 GIALERTRVGDRYVSERMRETGINLGGEASGHIVMPDYSPTGDGLIAALQVLRVLGDSGK 360

Query: 361 PVSTICHCFEEYPQFLRSVSVK-DTSILNSSSIVQAIADAESELRGIDRLIVRASGTESL 419
             S +   F+  PQ L +V V      L S ++  AIA+AE  +    RL+VRASGTE +
Sbjct: 361 RASELLKVFKPAPQLLENVRVPRGRKPLESEAVKAAIAEAEVRMGVAGRLVVRASGTEPV 420

Query: 420 IRIMAEGDDLSRIKRIVDDLAKVIPMI 446
           +R+MAEG+    I+ +VDD+   I  +
Sbjct: 421 VRVMAEGE-QKLIRSVVDDVRGAIETV 446


>gi|254460809|ref|ZP_05074225.1| phosphoglucosamine mutase [Rhodobacterales bacterium HTCC2083]
 gi|206677398|gb|EDZ41885.1| phosphoglucosamine mutase [Rhodobacteraceae bacterium HTCC2083]
          Length = 448

 Score =  264 bits (674), Expect = 2e-68,   Method: Composition-based stats.
 Identities = 223/450 (49%), Positives = 296/450 (65%), Gaps = 4/450 (0%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFR-GKKKHRRVVIGKDTRLSGYMLE 59
           M R+ FGTDG+RGK+NT+P+T    +RIG A G  FR    K  RVVIGKDTR SGYMLE
Sbjct: 1   MSRKLFGTDGVRGKANTYPMTAEMALRIGAAAGIYFRRNHSKVHRVVIGKDTRRSGYMLE 60

Query: 60  NSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGY 119
           ++L AG T+ GM  F++GPIP+PAV MLT S+RAD+G+MISASHNP++DNGIK FGPDGY
Sbjct: 61  SALTAGLTSTGMSVFLMGPIPTPAVGMLTPSMRADLGIMISASHNPHEDNGIKFFGPDGY 120

Query: 120 KVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRI 179
           K+S + E  IE L+       L     IG  + +     RY E VK   P +++L GL++
Sbjct: 121 KLSDEAEMEIEALVASG--GDLVEPMKIGRTRHIYDGRSRYNERVKAAFPSNLSLGGLKV 178

Query: 180 VVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIG 239
           V+DCANGA+Y+ APEV WELGA+V+ +G  PNG NIN +CGST  ++    V    A +G
Sbjct: 179 VIDCANGAAYRAAPEVLWELGAEVIPVGVSPNGYNINDNCGSTMPMTASETVIAHGAHVG 238

Query: 240 IALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAG 299
           I LDGD DR II+DE G + +GDQ M LIA  W     L+G+ +V TVMSN+GLER +  
Sbjct: 239 ICLDGDADRCIILDETGKVADGDQFMGLIAGRWAQEGRLKGDTLVATVMSNLGLERHLES 298

Query: 300 LGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYD 359
            GL+L RT VGDRY++E M+ N FN+GGEQSGHI+++DY +TGDGL+A LQ L  + +  
Sbjct: 299 KGLTLARTGVGDRYVVEEMRKNDFNLGGEQSGHIVMTDYATTGDGLMAGLQFLGELARTG 358

Query: 360 KPVSTICHCFEEYPQFLRSVSV-KDTSILNSSSIVQAIADAESELRGIDRLIVRASGTES 418
           +  S +   FE  PQ L++V        L  S +   I  AE +L G  RL++R SGTE 
Sbjct: 359 RKASELISVFEPVPQMLQNVRYAAGQIPLEDSKVQSVIVGAEKDLSGKGRLLIRKSGTEP 418

Query: 419 LIRIMAEGDDLSRIKRIVDDLAKVIPMIDS 448
           LIR+MAE +D   +  +V+ +   +    +
Sbjct: 419 LIRVMAECEDPDLLNEVVERIVGEVARATA 448


>gi|75758462|ref|ZP_00738584.1| Phosphoglucosamine mutase [Bacillus thuringiensis serovar
           israelensis ATCC 35646]
 gi|218895291|ref|YP_002443702.1| phosphoglucosamine mutase [Bacillus cereus G9842]
 gi|226722708|sp|B7ITV9|GLMM_BACC2 RecName: Full=Phosphoglucosamine mutase
 gi|74494089|gb|EAO57183.1| Phosphoglucosamine mutase [Bacillus thuringiensis serovar
           israelensis ATCC 35646]
 gi|218543698|gb|ACK96092.1| phosphoglucosamine mutase [Bacillus cereus G9842]
          Length = 448

 Score =  264 bits (674), Expect = 2e-68,   Method: Composition-based stats.
 Identities = 193/444 (43%), Positives = 276/444 (62%), Gaps = 5/444 (1%)

Query: 4   RFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSLV 63
           ++FGTDG+RG +N   +TP    +IG   GY+        +V+IG+DTR+SG+MLE +LV
Sbjct: 3   KYFGTDGVRGVANK-ELTPELAFKIGRFGGYVLTKDTDRPKVIIGRDTRVSGHMLEGALV 61

Query: 64  AGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVST 123
           AG  + G +   LG I +P VA LT++L A  GVMISASHNP QDNGIK FG DG+K++ 
Sbjct: 62  AGLLSTGAEVMRLGVISTPGVAYLTKALDAQAGVMISASHNPVQDNGIKFFGSDGFKLTD 121

Query: 124 DIEDRIETLLEDDLTSYLSCYD-SIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVVD 182
           + E  IE LL+ ++         ++G          +Y++++K+T+  +    GL I +D
Sbjct: 122 EQEAEIEALLDKEVDELPRPTGTNLGQVSDYFEGGQKYLQYIKQTV--EEDFSGLHIALD 179

Query: 183 CANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIAL 242
           CA+GA+  +AP +F +L AD+  +G  PNG+NIN   GST+   L   V E  ADIG+A 
Sbjct: 180 CAHGATSSLAPYLFADLEADISTMGTSPNGMNINEGVGSTHPEVLAELVKEKGADIGLAF 239

Query: 243 DGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLGL 302
           DGDGDR+I VDEKG IV+GDQIM + A+       L+ N +V+TVMSN+G  + +    +
Sbjct: 240 DGDGDRLIAVDEKGNIVDGDQIMFICAKYMKETGQLKHNTVVSTVMSNLGFYKALEANNI 299

Query: 303 SLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKPV 362
           +  +T VGDRY+ME MK  G+N+GGEQSGHIIL DY +TGDG+++ALQ++  +K   KP+
Sbjct: 300 TSDKTAVGDRYVMEEMKRGGYNLGGEQSGHIILLDYITTGDGMLSALQLVNIMKMTKKPL 359

Query: 363 STICHCFEEYPQFLRSVSVKDTS-ILNSSSIVQAIADAESELRGIDRLIVRASGTESLIR 421
           S +     ++PQ L +V V D    L +  I + I   E E+ G  R++VR SGTE LIR
Sbjct: 360 SELAGEMTKFPQLLVNVRVTDKKLALENEKIKEIIRVVEEEMNGDGRILVRPSGTEPLIR 419

Query: 422 IMAEGDDLSRIKRIVDDLAKVIPM 445
           +MAE          V  + +V+  
Sbjct: 420 VMAEAPTQEVCDAFVHRIVEVVKA 443


>gi|42523409|ref|NP_968789.1| phosphoglucosamine mutase [Bdellovibrio bacteriovorus HD100]
 gi|81617316|sp|Q6MLS4|GLMM_BDEBA RecName: Full=Phosphoglucosamine mutase
 gi|39575615|emb|CAE79782.1| phosphoglucosamine mutase [Bdellovibrio bacteriovorus HD100]
          Length = 457

 Score =  264 bits (674), Expect = 2e-68,   Method: Composition-based stats.
 Identities = 216/454 (47%), Positives = 309/454 (68%), Gaps = 9/454 (1%)

Query: 1   MKRR--FFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHR-----RVVIGKDTRL 53
           M+++   FGTDGIRG +N +P+TP+ +++IG A+GYL R + + +     +VVIGKDTRL
Sbjct: 1   MEKKTRLFGTDGIRGTANQYPMTPDMVVKIGQAIGYLLRKEAEEKSSSVRKVVIGKDTRL 60

Query: 54  SGYMLENSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKL 113
           SGYM+E +L +G  + G+   ++GP+P+P +  LTR++RA  G++ISASHNP+ DNGIK+
Sbjct: 61  SGYMIEQALASGLNSMGVFVQLVGPLPTPGIGYLTRTMRAAAGIVISASHNPFHDNGIKV 120

Query: 114 FGPDGYKVSTDIEDRIETL-LEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDV 172
           FG DG+K+S ++E  IE L LE+DLT  L     IG  +R++    RYI +VK T P + 
Sbjct: 121 FGSDGFKISEEMEREIERLVLEEDLTPLLPPSKEIGRTRRIEDSQGRYIVYVKGTFPLEY 180

Query: 173 TLQGLRIVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVH 232
           TL G+RIV+D ANGASYKVAP +F ELGA+V+ +GD PNG NIN   G+     L   V 
Sbjct: 181 TLDGMRIVLDTANGASYKVAPSIFQELGAEVIQLGDDPNGTNINDKVGALYPQKLAESVL 240

Query: 233 EVRADIGIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIG 292
             RAD+GI+LDGD DRVI+VDEKG IVNGD+I+A+ A       LL+G+ +V T MSN G
Sbjct: 241 HYRADVGISLDGDADRVIMVDEKGEIVNGDRILAICALHMKERGLLKGDTLVATQMSNFG 300

Query: 293 LERFIAGLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVL 352
           LE+ +   G+ L +T VGD+Y++E M+ +G+N+GGEQSGHII  D+ +TGDG +AAL VL
Sbjct: 301 LEKRMNEAGIKLVKTGVGDKYVVEEMRKHGYNLGGEQSGHIIFLDHTTTGDGCIAALSVL 360

Query: 353 RYIKQYDKPVSTICHCFEEYPQFLRSVSVKDTSILNSSSIV-QAIADAESELRGIDRLIV 411
             +KQ  K +S + H FE+ PQ L +  VK  + L+  +     I + E +L G  R+ V
Sbjct: 361 AVMKQTGKKMSDLNHVFEDVPQILINCRVKRRAELSELAGYNDMIRNIEKKLAGNGRVFV 420

Query: 412 RASGTESLIRIMAEGDDLSRIKRIVDDLAKVIPM 445
           R SGTE +IR++ EG + ++I +  +++A  +  
Sbjct: 421 RFSGTEPVIRVLVEGTEKAQITQFAEEIASFLEK 454


>gi|299066495|emb|CBJ37685.1| phosphoglucosamine mutase [Ralstonia solanacearum CMR15]
          Length = 447

 Score =  264 bits (674), Expect = 2e-68,   Method: Composition-based stats.
 Identities = 190/450 (42%), Positives = 279/450 (62%), Gaps = 9/450 (2%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKK-----KHRRVVIGKDTRLSG 55
           M R++FGTDGIRG+    PITP+F++R+G A G +              V+IGKDTRLSG
Sbjct: 1   MSRKYFGTDGIRGRVGESPITPDFVLRLGYAAGRVLAHGSEAHGHGRPTVLIGKDTRLSG 60

Query: 56  YMLENSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFG 115
           YMLE +L AGFTAAG+D  + GP+P+P VA LTR+LR   GV+ISASHNPY DNGIK F 
Sbjct: 61  YMLEAALEAGFTAAGVDVLMSGPLPTPGVAYLTRALRLSAGVVISASHNPYYDNGIKFFS 120

Query: 116 PDGYKVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQ 175
             G K+  + E +IE  LE  +    +  D++G A+R+D    RYIE  K T P D+ L 
Sbjct: 121 ATGDKLPDETESQIEAELEKPM--VYAASDALGRARRIDDAAGRYIEFCKSTFPNDLNLF 178

Query: 176 GLRIVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVR 235
           G++IV+D A+GA+Y +AP VF ELGADVV IG++PNG NIN   G+T    L     E  
Sbjct: 179 GMKIVLDSAHGAAYHIAPHVFHELGADVVSIGNQPNGRNINDGYGATEPAKLIEATREHG 238

Query: 236 ADIGIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLER 295
           AD+G+A DGD DR+ +VD  G + NGD+++ ++ +   +        + T  M+N+ +E 
Sbjct: 239 ADLGLAFDGDADRLQVVDRNGRLYNGDELLYVMVQARRAAGQAVPGAVGTL-MTNLAVEL 297

Query: 296 FIAGLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYI 355
            +   G+   R +VGDRY++E +K +G+ +GGE SGH++  D  STGDG+++ALQVL  +
Sbjct: 298 ALKAQGVEFVRAKVGDRYVLEELKKHGWLLGGEGSGHLLCLDKHSTGDGIISALQVLAAL 357

Query: 356 KQYDKPVSTICHCFEEYPQFLRSVSV-KDTSILNSSSIVQAIADAESELRGIDRLIVRAS 414
           ++  + +  +      +PQ L +V V K       +++  A+  +E+EL G  R+++R S
Sbjct: 358 RRSGQTLEQVLDGVHLFPQKLINVRVEKGFDWKAHAALQAALKVSEAELSGKGRILIRPS 417

Query: 415 GTESLIRIMAEGDDLSRIKRIVDDLAKVIP 444
           GTE ++R+M E  D +   +  + LA  + 
Sbjct: 418 GTEPVVRVMVEAQDAALATKYAEQLAATLQ 447


>gi|295402537|ref|ZP_06812487.1| phosphoglucosamine mutase [Geobacillus thermoglucosidasius
           C56-YS93]
 gi|312109308|ref|YP_003987624.1| phosphoglucosamine mutase [Geobacillus sp. Y4.1MC1]
 gi|294975431|gb|EFG51059.1| phosphoglucosamine mutase [Geobacillus thermoglucosidasius
           C56-YS93]
 gi|311214409|gb|ADP73013.1| phosphoglucosamine mutase [Geobacillus sp. Y4.1MC1]
          Length = 448

 Score =  264 bits (674), Expect = 2e-68,   Method: Composition-based stats.
 Identities = 190/444 (42%), Positives = 279/444 (62%), Gaps = 5/444 (1%)

Query: 4   RFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSLV 63
           ++FGTDG+RG +N   +TP    +IG   GY+    +K  +V+IG+DTR+SG+MLE +LV
Sbjct: 3   KYFGTDGVRGVANR-ELTPELAFKIGRCGGYVLTKSEKRPKVLIGRDTRISGHMLEGALV 61

Query: 64  AGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVST 123
           AG  + G +   LG I +P VA LT++L A  G+MISASHNP QDNGIK FGPDG+K+S 
Sbjct: 62  AGLLSIGAEVMRLGVISTPGVAYLTKALGAQAGIMISASHNPVQDNGIKFFGPDGFKLSD 121

Query: 124 DIEDRIETLLEDDLTS-YLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVVD 182
           + E  IE L++           +++G          +Y++++K+T+       G++I +D
Sbjct: 122 EQEQEIEALIDSPEDMLPRPIGEALGQVNDYFEGGQKYLQYLKQTIDE--DFSGIKIALD 179

Query: 183 CANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIAL 242
           CA+GA+  +A  +F +L ADVV +G  PNGININ   GST+  +L   V E  AD+G+A 
Sbjct: 180 CAHGATSSLATHLFADLEADVVTMGASPNGININEGVGSTHPEALAAFVKEKGADVGLAF 239

Query: 243 DGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLGL 302
           DGDGDR+I VDE G IV+GDQIM + A+       L+   +V+TVMSN+G  + +   G+
Sbjct: 240 DGDGDRLIAVDEYGNIVDGDQIMYICAKYLKEIGRLKQQTVVSTVMSNLGFYKALEAQGI 299

Query: 303 SLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKPV 362
              +T VGDRY++E M+ NG+N+GGEQSGHII  DY +TGDGL+ ALQ++  +K  +KP+
Sbjct: 300 QSVQTAVGDRYVVEEMRKNGYNLGGEQSGHIIFLDYNTTGDGLLTALQLVNIMKIKEKPL 359

Query: 363 STICHCFEEYPQFLRSVSVKDT-SILNSSSIVQAIADAESELRGIDRLIVRASGTESLIR 421
           S +    ++YPQ L +V V D   ++ +  +   I + E E+    R++VR SGTE L+R
Sbjct: 360 SELASEVKKYPQLLVNVKVADKHKVMENEKVKAVIQEVEKEMSENGRVLVRPSGTEPLVR 419

Query: 422 IMAEGDDLSRIKRIVDDLAKVIPM 445
           +M E       +  V+ +A VI  
Sbjct: 420 VMVEAPTEETCRNYVERIASVIRE 443


>gi|46579693|ref|YP_010501.1| phosphoglucosamine mutase [Desulfovibrio vulgaris str.
           Hildenborough]
 gi|120602827|ref|YP_967227.1| phosphoglucosamine mutase [Desulfovibrio vulgaris DP4]
 gi|81566867|sp|Q72CK1|GLMM_DESVH RecName: Full=Phosphoglucosamine mutase
 gi|158513915|sp|A1VED4|GLMM_DESVV RecName: Full=Phosphoglucosamine mutase
 gi|46449108|gb|AAS95760.1| phosphoglucosamine mutase [Desulfovibrio vulgaris str.
           Hildenborough]
 gi|120563056|gb|ABM28800.1| phosphoglucosamine mutase [Desulfovibrio vulgaris DP4]
 gi|311233488|gb|ADP86342.1| phosphoglucosamine mutase [Desulfovibrio vulgaris RCH1]
          Length = 450

 Score =  264 bits (673), Expect = 2e-68,   Method: Composition-based stats.
 Identities = 217/447 (48%), Positives = 310/447 (69%), Gaps = 2/447 (0%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M RR FGTDG+RG+ N +P+T +  +R+G+A G  FR   +  RVVIGKDTRLSGYM E+
Sbjct: 1   MGRRLFGTDGLRGQVNIYPMTADMALRLGLAAGTRFRNGNRRHRVVIGKDTRLSGYMFES 60

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +L AG  AAGMD F +GP+P+PA++ LTR++RAD+GV+ISASHNP+ DNGIK F   G+K
Sbjct: 61  ALTAGLCAAGMDVFQVGPLPTPAISFLTRNMRADLGVVISASHNPFMDNGIKFFDRSGFK 120

Query: 121 VSTDIEDRI-ETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRI 179
           +  D+E+++ + +L+ D        + +G A ++     RYI ++K + P D+TL GLR+
Sbjct: 121 LPDDVENQMTDMVLDPDWQWDYPASEKVGRAYKIADAPGRYIVYIKSSFPADLTLDGLRV 180

Query: 180 VVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIG 239
           V+DCANGA+YKVAP    ELGA+V+ +G +PNG+NIN  CGS     +  KV E RADIG
Sbjct: 181 VIDCANGANYKVAPLALEELGAEVIKLGTEPNGLNINHQCGSLYPEVVAAKVRETRADIG 240

Query: 240 IALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAG 299
           +ALDGD DR+I+VDEKG I++GDQIMAL A++ M+   L GN +V TVMSN+ LE F+  
Sbjct: 241 LALDGDADRLIVVDEKGTILDGDQIMALCAQDLMAKGKLPGNMLVATVMSNMALEVFMKE 300

Query: 300 LGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYD 359
            G +L RT VGDRY++E M+ +G  +GGEQSGH+I  +Y +TGDGL+AALQ+LR +++  
Sbjct: 301 HGGTLLRTAVGDRYVVEAMRQHGALLGGEQSGHLIFREYSTTGDGLLAALQILRIMRERG 360

Query: 360 KPVSTICHCFEEYPQFLRSVSVKDT-SILNSSSIVQAIADAESELRGIDRLIVRASGTES 418
           KP+S +    + +PQ L +V V+          +  A+A  E+EL    R+++R SGTES
Sbjct: 361 KPLSELAGQLQLFPQQLINVHVERKIPFAECQPVADAVAAIETELGDRGRVLLRYSGTES 420

Query: 419 LIRIMAEGDDLSRIKRIVDDLAKVIPM 445
           + R+M EG+   ++ R+ + LA+ +  
Sbjct: 421 VCRVMVEGEHPEQVARLAEMLAETVQK 447


>gi|114331002|ref|YP_747224.1| phosphoglucosamine mutase [Nitrosomonas eutropha C91]
 gi|122314097|sp|Q0AHC3|GLMM_NITEC RecName: Full=Phosphoglucosamine mutase
 gi|114308016|gb|ABI59259.1| phosphoglucosamine mutase [Nitrosomonas eutropha C91]
          Length = 458

 Score =  264 bits (673), Expect = 2e-68,   Method: Composition-based stats.
 Identities = 194/452 (42%), Positives = 280/452 (61%), Gaps = 10/452 (2%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKK------KHRRVVIGKDTRLS 54
           MK+++FGTDGIRGK   FPITP F +R+G AVG +           K   ++IGKDTR+S
Sbjct: 1   MKKKYFGTDGIRGKVGEFPITPEFFLRLGYAVGKVLLASDWKLAADKRPTILIGKDTRIS 60

Query: 55  GYMLENSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLF 114
           GYMLE++L AGF+AAG+D  + GP+P+PAVA L R+LR   G +ISASHNP+ DNGIK F
Sbjct: 61  GYMLESALEAGFSAAGVDVLLSGPLPTPAVAYLVRALRIQAGAVISASHNPFYDNGIKFF 120

Query: 115 GPDGYKVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTL 174
             +G K+   +E +IE  L+  + +  S    +G  +R+     RYIE  K T P  + L
Sbjct: 121 SSEGSKLPDSMELQIEAELDFPIETAPSI--KLGRVQRLKDEEGRYIEFCKSTFPNQLDL 178

Query: 175 QGLRIVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEV 234
           +G +IVVDCANGA Y+VA  V  ELGADVV I   P+G NIN +CG+T++++LQ  V + 
Sbjct: 179 RGWKIVVDCANGADYQVAGHVMHELGADVVTIHANPDGFNINHECGATHIMTLQGAVLQH 238

Query: 235 RADIGIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLE 294
            AD GIA+DGDGDRV++V  +G + +GD +  +IA+       +   G+V T+M+N+ +E
Sbjct: 239 GADFGIAVDGDGDRVLMVSGEGVVYDGDSLAYIIAKHRQQR-GVLQGGVVGTLMTNLAVE 297

Query: 295 RFIAGLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRY 354
           +    +G+   R  VGDRY+ E ++ N + +G E SGHII  D  +TGDG+++ALQVL  
Sbjct: 298 QAFERIGIPFARANVGDRYVSELLQQNDWYLGAENSGHIICRDKHTTGDGIISALQVLYA 357

Query: 355 IKQYDKPVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIA-DAESELRGIDRLIVRA 413
           ++      + + H    +PQ L +V +       +   V+    +AE  L    R+++RA
Sbjct: 358 LRDTGLMFADLMHDVTFFPQRLINVKISRDFDFQNDQAVEICKNEAEQALGNDGRILLRA 417

Query: 414 SGTESLIRIMAEGDDLSRIKRIVDDLAKVIPM 445
           SGTE LIR+M EG D  +I+   + +A  I  
Sbjct: 418 SGTEPLIRVMVEGKDPQQIEYWAEKIAGTIQQ 449


>gi|303228634|ref|ZP_07315460.1| phosphoglucosamine mutase [Veillonella atypica ACS-134-V-Col7a]
 gi|302516726|gb|EFL58642.1| phosphoglucosamine mutase [Veillonella atypica ACS-134-V-Col7a]
          Length = 450

 Score =  264 bits (673), Expect = 2e-68,   Method: Composition-based stats.
 Identities = 185/444 (41%), Positives = 265/444 (59%), Gaps = 3/444 (0%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M R  FGTDG+RG  N F +TP     +G A    F  +K+H   +IG+DTR+SG MLE 
Sbjct: 1   MAR-LFGTDGVRGVVNEF-LTPELAYHLGRAAATHFGKEKEHPTFLIGRDTRISGSMLEC 58

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +L +G  + G +  + G IP+PAVA L +    D G +ISASHNP+ DNGIK F   G+K
Sbjct: 59  ALASGICSVGGNVVMAGVIPTPAVAYLVKQQGFDAGAVISASHNPFPDNGIKFFDGSGFK 118

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +  ++ED++E  +     + L      G  +     +  +          D +L+GL IV
Sbjct: 119 LPDEVEDQLEVYVRQSADNELPRPTGAGIGRVEYNANLAHHYAHFVRHTIDTSLEGLTIV 178

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
            D ANGA+  V PE+   LGA V+ I   P+G+NIN  CGST++  LQ  V +  AD+GI
Sbjct: 179 YDGANGAASSVGPEILSGLGAKVININVNPDGLNINHHCGSTHIEGLQVAVQQHHADLGI 238

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           A DGD DR ++VDEKG +++GDQIM L A +      L+G+ +V TVMSNIG  +    L
Sbjct: 239 ANDGDADRCLLVDEKGQVLDGDQIMLLCALKLKEEGKLKGDTVVGTVMSNIGFHKAAEEL 298

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           G+    T VGDRY++EYM+ +  ++GGEQSGH+I  D+ +TGDG++ A+QV   +K+  +
Sbjct: 299 GMKTVSTAVGDRYVLEYMREHDLSIGGEQSGHVIFLDHNTTGDGMLTAVQVAALVKEKGQ 358

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTS-ILNSSSIVQAIADAESELRGIDRLIVRASGTESL 419
           P+S +     +YPQ L +V V   +    +  I  AI  AE EL    R++VRASGTE L
Sbjct: 359 PLSELAGIMTKYPQVLINVRVATKTGWEENDIIKAAIVTAEGELGDEGRVLVRASGTEPL 418

Query: 420 IRIMAEGDDLSRIKRIVDDLAKVI 443
           IR+MAEG D   ++ +  ++A +I
Sbjct: 419 IRVMAEGPDQEALQALCQEIADII 442


>gi|88705680|ref|ZP_01103390.1| phosphoglucosamine mutase [Congregibacter litoralis KT71]
 gi|88700193|gb|EAQ97302.1| phosphoglucosamine mutase [Congregibacter litoralis KT71]
          Length = 451

 Score =  264 bits (673), Expect = 3e-68,   Method: Composition-based stats.
 Identities = 202/448 (45%), Positives = 288/448 (64%), Gaps = 7/448 (1%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGK---KKHRRVVIGKDTRLSGYM 57
           MK+R+FGTDGIRG     PITP+F++++G A G +F  +   +    V+IGKDTR+SGYM
Sbjct: 1   MKKRYFGTDGIRGLVGEAPITPDFVLKLGWACGRVFTRQMAAQGRCSVIIGKDTRVSGYM 60

Query: 58  LENSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPD 117
            E++L AG  AAG+D  +LGP+P+PAVA++TR+  AD G++ISASHN Y DNGIK F   
Sbjct: 61  FESALEAGLVAAGVDVKLLGPMPTPAVALMTRTQNADAGIVISASHNAYFDNGIKFFSAT 120

Query: 118 GYKVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGL 177
           G K+  +IE  IE  LE  L    S    IG  +RV     RYIE  K T+P   +L+GL
Sbjct: 121 GSKLPDEIELAIEAELELPLACVESH--DIGKVQRVVDAAGRYIEFCKSTVPEGFSLRGL 178

Query: 178 RIVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRAD 237
           RI +DCA+GA+Y +AP V  ELGA+V+ IG  P+G NIN   GST++ +L   V E   D
Sbjct: 179 RIAMDCAHGATYHIAPSVLSELGAEVISIGVSPDGFNINEGVGSTHMDTLAATVRERNCD 238

Query: 238 IGIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFI 297
           +GIA DGDGDRV+ VD++GA V+GDQ++ +IA   +         + T  MSN+GLE  +
Sbjct: 239 LGIAYDGDGDRVLFVDDQGATVDGDQLLYVIAMHRLQEGSSDTGVVGTL-MSNLGLELAL 297

Query: 298 AGLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQ 357
              GL   R +VGDRY+ E M+  G+++GGE SGHII SD  +TGDG+V++LQVLR ++ 
Sbjct: 298 REQGLQFVRAQVGDRYVREMMETQGWHLGGESSGHIICSDVTTTGDGIVSSLQVLRALQS 357

Query: 358 YDKPVSTICHCFEEYPQFLRSVSV-KDTSILNSSSIVQAIADAESELRGIDRLIVRASGT 416
             + +  +       PQ + +V +    SI +   +++A+A  E+EL    R+++R SGT
Sbjct: 358 GGRSLREVLSDVPLLPQTMINVRISPGASIASQPEVLEAVAQVEAELGDNGRVLLRPSGT 417

Query: 417 ESLIRIMAEGDDLSRIKRIVDDLAKVIP 444
           E +IR+M EG D +++ R+   LA+ + 
Sbjct: 418 EPVIRVMIEGRDAAQVDRLCRSLAQTVE 445


>gi|304321222|ref|YP_003854865.1| phosphoglucomutase/phosphomannomutase family protein [Parvularcula
           bermudensis HTCC2503]
 gi|303300124|gb|ADM09723.1| phosphoglucomutase/phosphomannomutase family protein [Parvularcula
           bermudensis HTCC2503]
          Length = 454

 Score =  264 bits (673), Expect = 3e-68,   Method: Composition-based stats.
 Identities = 240/444 (54%), Positives = 315/444 (70%)

Query: 2   KRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENS 61
           +RR FGTDG+RG +N  P+ P+ ++R+G+A G  FR  +   RVVIGKDTRLSGYM+E +
Sbjct: 9   ERRIFGTDGVRGLANKGPLAPDQLLRLGMAAGRHFRRGQHRHRVVIGKDTRLSGYMIEPA 68

Query: 62  LVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKV 121
           L AGF A GMD  +LGP+P+PA A++TRS+RAD+GVMISASHNPY DNGIK FGPDG+K+
Sbjct: 69  LTAGFIATGMDVILLGPLPTPATALMTRSMRADLGVMISASHNPYHDNGIKFFGPDGFKL 128

Query: 122 STDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVV 181
           S   E  IE L+ED   + L   +++G A R+D    RYIE  K TLPR ++ +GLRIV+
Sbjct: 129 SDTTELTIERLMEDGAETGLCGPENLGRASRIDDAGARYIEFAKSTLPRRLSFEGLRIVL 188

Query: 182 DCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIA 241
           DCA+GA+YKVAP V +ELGA+V  IG  P+G NIN   GST+ L LQ  V E RADIGIA
Sbjct: 189 DCAHGAAYKVAPTVLYELGAEVKSIGVNPDGFNINRGVGSTDPLKLQDMVLEYRADIGIA 248

Query: 242 LDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLG 301
           LDGD DRVI+ DE G +++GDQI+A IA       LLRG G+V+TVMSNIG E ++   G
Sbjct: 249 LDGDADRVIMCDENGKLIDGDQILAAIATSLAEQDLLRGGGVVSTVMSNIGFELYLKKCG 308

Query: 302 LSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKP 361
           L L RT+VGDRY++E M+    NVGGE SGH++LSDY STGDGL+ ALQ+L  + + +KP
Sbjct: 309 LDLTRTKVGDRYVVEQMRARDINVGGEPSGHVVLSDYTSTGDGLITALQILGLVAETEKP 368

Query: 362 VSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLIR 421
           VS +C  FE +P  L++V       L + ++  AIA+ ++ L G  R ++R SGTE +IR
Sbjct: 369 VSEVCSLFEPFPSVLKNVRFTSGDPLAAETVKAAIAEGKALLGGEGRTVIRKSGTEPVIR 428

Query: 422 IMAEGDDLSRIKRIVDDLAKVIPM 445
           +MAEG D   ++R+VDD+   I  
Sbjct: 429 VMAEGPDAGLVERVVDDICDAIEQ 452


>gi|303230364|ref|ZP_07317125.1| phosphoglucosamine mutase [Veillonella atypica ACS-049-V-Sch6]
 gi|302514903|gb|EFL56884.1| phosphoglucosamine mutase [Veillonella atypica ACS-049-V-Sch6]
          Length = 450

 Score =  264 bits (673), Expect = 3e-68,   Method: Composition-based stats.
 Identities = 185/444 (41%), Positives = 265/444 (59%), Gaps = 3/444 (0%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M R  FGTDG+RG  N F +TP     +G A    F  +K+H   +IG+DTR+SG MLE 
Sbjct: 1   MAR-LFGTDGVRGVVNEF-LTPELAYHLGRAAATHFGKEKEHPTFLIGRDTRISGSMLEC 58

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +L +G  + G +  + G IP+PAVA L +    D G +ISASHNP+ DNGIK F   G+K
Sbjct: 59  ALASGICSVGGNVVMAGVIPTPAVAYLVKQQGFDAGAVISASHNPFPDNGIKFFDGSGFK 118

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +  ++ED++E  +     + L      G  +     +  +          D +L+GL IV
Sbjct: 119 LPDEVEDQLEVYVRQSADNELPRPTGAGIGRVEYNANLAHHYAHFVRHTIDTSLEGLTIV 178

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
            D ANGA+  V PE+   LGA V+ I   P+G+NIN  CGST++  LQ  V +  AD+GI
Sbjct: 179 YDGANGAASSVGPEILSGLGAKVININVDPDGLNINHHCGSTHIEGLQVAVQQHHADLGI 238

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           A DGD DR ++VDEKG +++GDQIM L A +      L+G+ +V TVMSNIG  +    L
Sbjct: 239 ANDGDADRCLLVDEKGQVLDGDQIMLLCALKLKEEGKLKGDTVVGTVMSNIGFHKAAEEL 298

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           G+    T VGDRY++EYM+ +  ++GGEQSGH+I  D+ +TGDG++ A+QV   +K+  +
Sbjct: 299 GMKTVSTAVGDRYVLEYMREHDLSIGGEQSGHVIFLDHNTTGDGMLTAVQVAALVKEKGQ 358

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTS-ILNSSSIVQAIADAESELRGIDRLIVRASGTESL 419
           P+S +     +YPQ L +V V   +    +  I  AI  AE EL    R++VRASGTE L
Sbjct: 359 PLSELAGIMTKYPQVLINVRVATKTGWEENDIIKAAIVTAEGELGDEGRVLVRASGTEPL 418

Query: 420 IRIMAEGDDLSRIKRIVDDLAKVI 443
           IR+MAEG D   ++ +  ++A +I
Sbjct: 419 IRVMAEGPDQEALQALCQEIADII 442


>gi|134094402|ref|YP_001099477.1| phosphoglucosamine mutase [Herminiimonas arsenicoxydans]
 gi|158513565|sp|A4G4B3|GLMM_HERAR RecName: Full=Phosphoglucosamine mutase
 gi|133738305|emb|CAL61350.1| phosphoglucosamine mutase [Herminiimonas arsenicoxydans]
          Length = 448

 Score =  264 bits (673), Expect = 3e-68,   Method: Composition-based stats.
 Identities = 194/450 (43%), Positives = 282/450 (62%), Gaps = 11/450 (2%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLF------RGKKKHRRVVIGKDTRLS 54
           M R++FGTDG+RGK    PITP+F+MR+G A G +       +       V+IGKDTR+S
Sbjct: 1   MTRKYFGTDGVRGKVGVSPITPDFVMRLGYAAGSVLTKFETTKTPGSRPTVLIGKDTRIS 60

Query: 55  GYMLENSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLF 114
           GYMLE +L AGF+AAG+D  + GP+P+PAVA LTR+LR   GV+ISASHNPY DNGIK F
Sbjct: 61  GYMLEAALEAGFSAAGVDVMLAGPVPTPAVAYLTRALRLSAGVVISASHNPYDDNGIKFF 120

Query: 115 GPDGYKVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTL 174
              G K++   E  IE  L  D+       + +G  KR+D    RYIE  K T P ++ L
Sbjct: 121 SASGNKLADATELEIEAAL--DVPMSCVASEKLGRVKRLDDARGRYIEFCKSTFPNELDL 178

Query: 175 QGLRIVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEV 234
           +G +IVVDCA+GA+Y +AP+VF ELGA+VV IG++P+G NIN   G+T   +L   V   
Sbjct: 179 RGTKIVVDCAHGAAYHIAPDVFHELGAEVVAIGNQPSGFNINDKVGATAPAALVEAVRAN 238

Query: 235 RADIGIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLE 294
           +ADIGIALDGD DR+I+VD  G I  GD+++ ++ ++ MS       G V T+M+N+ LE
Sbjct: 239 QADIGIALDGDADRLIVVDASGRIFTGDEMLYIMVKDRMSVQA--VAGAVGTLMTNMALE 296

Query: 295 RFIAGLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRY 354
                +G+   R  VGDRY++E ++  G+ +GGE SGH++  D  +TGDG+++ALQ+L  
Sbjct: 297 VAFRKMGIGFVRANVGDRYVLEALQERGWLLGGEGSGHMLFLDKHTTGDGIISALQILSA 356

Query: 355 IKQYDKPVSTICHCFEEYPQFLRSVSVKDTSILNSSS-IVQAIADAESELRGIDRLIVRA 413
           +K+  K ++ +      +PQ L +V V+       ++ ++      E+EL    R+++RA
Sbjct: 357 LKRSGKTLAQLTADIAMFPQTLINVKVRPGFDWKKNAGLLAEKEQVEAELGDEGRVLIRA 416

Query: 414 SGTESLIRIMAEGDDLSRIKRIVDDLAKVI 443
           SGTE LIR+M E  +     ++   +A  +
Sbjct: 417 SGTEPLIRVMVEAKNGEMADKMARRIAATL 446


>gi|167836221|ref|ZP_02463104.1| phosphoglucosamine mutase [Burkholderia thailandensis MSMB43]
          Length = 452

 Score =  264 bits (673), Expect = 3e-68,   Method: Composition-based stats.
 Identities = 196/455 (43%), Positives = 279/455 (61%), Gaps = 10/455 (2%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFR------GKKKHRRVVIGKDTRLS 54
           M RR+FGTDGIRGK    PITP+F++R+G A G +               V+IGKDTR+S
Sbjct: 1   MGRRYFGTDGIRGKVGDAPITPDFVLRLGYAAGKVLASAPGRAASGARPTVLIGKDTRVS 60

Query: 55  GYMLENSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLF 114
           GYMLE +L AGF+AAG+D  + GP+P+P VA LTR+LR   GV+ISASHNPY DNGIK F
Sbjct: 61  GYMLEAALEAGFSAAGVDVMLAGPMPTPGVAYLTRALRLSAGVVISASHNPYHDNGIKFF 120

Query: 115 GPDGYKVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTL 174
             DG K+  +IE  IE  L+  L       D +G A+R+D    RYIE  K T P    L
Sbjct: 121 SADGNKLPDEIEAEIEARLDKPLECAP--SDGLGKARRLDDAAGRYIEFCKSTFPAAFDL 178

Query: 175 QGLRIVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEV 234
           +G+++VVDCA+GA+Y+VAP VF ELGADV+ IG  PNG NIN   G+T   +L R V   
Sbjct: 179 RGMKLVVDCAHGAAYQVAPHVFHELGADVIPIGVAPNGFNINDGVGATAPDALMRAVRAN 238

Query: 235 RADIGIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLE 294
            AD+GIALDGD DR+++VD  G + NGD+++ ++ ++ ++ +      + T  M+N  +E
Sbjct: 239 HADLGIALDGDADRLLVVDHTGRLYNGDELLYVLVKDRIATNGQVEGAVGTL-MTNFAVE 297

Query: 295 RFIAGLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRY 354
             +   G+   R  VGDRY++E ++  G+ +G E SGHI+  D  STGDG+V+AL VL  
Sbjct: 298 VALKDAGVQFVRAAVGDRYVLEQLRERGWQLGAEGSGHILSLDRHSTGDGIVSALLVLAA 357

Query: 355 IKQYDKPVSTICHCFEEYPQFLRSVSVKDTSILNS-SSIVQAIADAESELRGIDRLIVRA 413
           +K+  K ++ +      +PQ L +V +K  +      +I +AI  AE  L G  R+++RA
Sbjct: 358 LKRSGKTLAQMLEGVTLFPQKLINVRMKPGADWKGSDTIRRAIDSAEQALAGSGRVLIRA 417

Query: 414 SGTESLIRIMAEGDDLSRIKRIVDDLAKVIPMIDS 448
           SGTE ++R+M E    +      + +A  +    +
Sbjct: 418 SGTEPVLRVMVEARQAADANHHAEAIADAVRQATA 452


>gi|283850236|ref|ZP_06367525.1| phosphoglucosamine mutase [Desulfovibrio sp. FW1012B]
 gi|283574262|gb|EFC22233.1| phosphoglucosamine mutase [Desulfovibrio sp. FW1012B]
          Length = 450

 Score =  264 bits (673), Expect = 3e-68,   Method: Composition-based stats.
 Identities = 205/446 (45%), Positives = 295/446 (66%), Gaps = 2/446 (0%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M+++ FGTDG+RGK NT+P+TP  +MR+G+A G + R   +  +V+IGKDTRLSGY+ E 
Sbjct: 1   MEKKLFGTDGLRGKVNTYPMTPEVVMRLGLAAGQVLRDGGRRHKVLIGKDTRLSGYIYEY 60

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +L +GF AAGMD  ++GP+P+PA++ LTR +R DVGV+ISASHNPY DNGIK F   G+K
Sbjct: 61  ALTSGFCAAGMDVILVGPLPTPAISFLTRDMRVDVGVVISASHNPYHDNGIKFFDHMGFK 120

Query: 121 VSTDIEDRIETLLED-DLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRI 179
           +   +E  I  L++       L   +++G A ++     RY   +K T+P DV+ + ++I
Sbjct: 121 LPDAVEAEIAALVDGCGQEWNLPAPEAVGRASKIQDSTGRYNVFLKNTVPLDVSFEDMKI 180

Query: 180 VVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIG 239
           V+DCANGA+++VAP VF ELGA V  +G +P+G+NIN   GS     +   V    ADIG
Sbjct: 181 VLDCANGAAFRVAPMVFEELGAKVFKMGVEPDGVNINRGVGSLYPEQVAANVVATGADIG 240

Query: 240 IALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAG 299
           IALDGD DRVI+ DEKG I++GDQIMA+ A + M    L GN +V TVMSN+ LE F+A 
Sbjct: 241 IALDGDADRVIVSDEKGRILDGDQIMAICALDCMERGSLPGNLLVATVMSNMALEVFMAA 300

Query: 300 LGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYD 359
            G  L RT VGDRY++E M+  G  +GGEQSGH+I  ++ +TGDG +AALQ+++ + +  
Sbjct: 301 HGGRLLRTPVGDRYVVEAMRAEGAVLGGEQSGHLIFLNHSTTGDGTLAALQLMKIMARKG 360

Query: 360 KPVSTICHCFEEYPQFLRSVSVKDTSIL-NSSSIVQAIADAESELRGIDRLIVRASGTES 418
           KP+S +      +PQ L +V V        +  I +A  +AE  L G  R+++R SGTES
Sbjct: 361 KPLSELATLLSPFPQKLVNVPVARKIPFSEAPEIARATVEAERLLAGRGRVLLRYSGTES 420

Query: 419 LIRIMAEGDDLSRIKRIVDDLAKVIP 444
           L R+M E +D + ++ + + LA+ + 
Sbjct: 421 LARVMVEAEDPALVESLCERLAQAVA 446


>gi|323526822|ref|YP_004228975.1| phosphoglucosamine mutase [Burkholderia sp. CCGE1001]
 gi|323383824|gb|ADX55915.1| phosphoglucosamine mutase [Burkholderia sp. CCGE1001]
          Length = 452

 Score =  264 bits (673), Expect = 3e-68,   Method: Composition-based stats.
 Identities = 197/455 (43%), Positives = 286/455 (62%), Gaps = 10/455 (2%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLF------RGKKKHRRVVIGKDTRLS 54
           M RR+FGTDGIRGK    PITP F++R+G A G +               V+IGKDTR+S
Sbjct: 1   MARRYFGTDGIRGKVGEGPITPEFVLRLGYAAGKVLVGADRWARTGTRPTVLIGKDTRVS 60

Query: 55  GYMLENSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLF 114
           GYMLE +L +GF+AAG+D  + GP+P+P +A LTR+LR   GV+ISASHNPY DNGIK F
Sbjct: 61  GYMLEAALESGFSAAGVDVMLAGPMPTPGIAYLTRALRLAAGVVISASHNPYYDNGIKFF 120

Query: 115 GPDGYKVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTL 174
             DG K+  ++E +IE  LE  L    +  + +G A+R+D    RYIE  K T P    L
Sbjct: 121 SADGNKLPDEVESQIEEQLE--LPLACAASEQLGKARRLDDAAGRYIEFCKSTFPAAFDL 178

Query: 175 QGLRIVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEV 234
           +GL++VVDCA+GA+Y VAP VF ELGA+V+ IG  PNG NIN   G+T   +L R V   
Sbjct: 179 RGLKLVVDCAHGAAYDVAPHVFHELGAEVIPIGVAPNGFNINDGVGATAPDALVRAVRAN 238

Query: 235 RADIGIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLE 294
            AD+GIALDGD DR+ +VD  G + NGD+++ ++ ++ ++        + T  M+N+ +E
Sbjct: 239 HADLGIALDGDADRLQVVDAAGRLYNGDELLYVLVKDRIATDGKVEGAVGTL-MTNMAVE 297

Query: 295 RFIAGLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRY 354
             +  +G+   R  VGDRY++E ++ +G+ +G E SGHI+  D  STGDG+V+AL VL  
Sbjct: 298 VALQAVGVKFVRAAVGDRYVLEQLREHGWQLGAEGSGHILSLDRHSTGDGIVSALLVLAA 357

Query: 355 IKQYDKPVSTICHCFEEYPQFLRSVSVK-DTSILNSSSIVQAIADAESELRGIDRLIVRA 413
           +K+ D+ ++ +      +PQ L +V +K D    +S +I +AIA AE  L G  R+++RA
Sbjct: 358 MKRSDRTLAELLDGVTLFPQKLINVRMKPDADWKSSDTIRRAIASAEDALDGRGRVLIRA 417

Query: 414 SGTESLIRIMAEGDDLSRIKRIVDDLAKVIPMIDS 448
           SGTE ++R+M E + +    R  + +A  +    +
Sbjct: 418 SGTEPVLRVMVEAEHVDDAVRHAESIAAAVQQATA 452


>gi|296313471|ref|ZP_06863412.1| phosphoglucosamine mutase [Neisseria polysaccharea ATCC 43768]
 gi|296839989|gb|EFH23927.1| phosphoglucosamine mutase [Neisseria polysaccharea ATCC 43768]
          Length = 444

 Score =  263 bits (672), Expect = 3e-68,   Method: Composition-based stats.
 Identities = 197/445 (44%), Positives = 291/445 (65%), Gaps = 6/445 (1%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKK--KHRRVVIGKDTRLSGYML 58
           M +++FGTDG+RG+   FPITP+F++++G A G +       +   V+IGKDTR+SGYML
Sbjct: 1   MAKKYFGTDGVRGEVGQFPITPDFVLKLGYAAGQVLVQHDTDQKPTVLIGKDTRISGYML 60

Query: 59  ENSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDG 118
           E +LVAGFTAAG++    GP+P+P VA LTR+LR   GVMISASHN Y DNGIK F   G
Sbjct: 61  EAALVAGFTAAGVNVIQTGPLPTPGVAYLTRALRLSAGVMISASHNAYSDNGIKFFAEGG 120

Query: 119 YKVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLR 178
            K+S +IE  IE  +++++ +       +G A+R+ G  DRYIE  K T P    L+GL+
Sbjct: 121 VKLSDEIELEIEAKIDEEMKTQP--SARLGRARRISGADDRYIEFCKSTFPSHSDLRGLK 178

Query: 179 IVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADI 238
           +V+D ANGA Y VAP+VF ELGA VV IGD+PNG NIN  CG+T   +LQ  V +  AD 
Sbjct: 179 LVIDTANGAGYGVAPKVFHELGAQVVSIGDEPNGYNINEKCGATYTKTLQAAVLQHEADY 238

Query: 239 GIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIA 298
           GIALDGDGDR+++VD+ G + +GD ++ +IA+   +   +   G+V TVM+N+ +E  + 
Sbjct: 239 GIALDGDGDRLMMVDKNGKVYDGDSLIYVIAK-ARAREGINIGGVVGTVMTNMAMEIALK 297

Query: 299 GLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQY 358
             G+   R +VGDRY++E +   G+ +GGE SGHI+  D  +TGDG+++ALQVL  ++  
Sbjct: 298 EQGVDFCRAKVGDRYVLEQLNQRGWLIGGEASGHILCMDKHNTGDGIISALQVLAALQIL 357

Query: 359 DKPVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTES 418
           ++ ++T+C  ++ YPQ + +V ++       +S    +A+ E EL G  R+++RASGTE 
Sbjct: 358 NQDLATVCADWQPYPQTMINVRIQKGQKWQEAS-KDVLAEVEKELEGKGRVVLRASGTEP 416

Query: 419 LIRIMAEGDDLSRIKRIVDDLAKVI 443
           ++R+M E       +   + +A  I
Sbjct: 417 VVRVMVEARQADWAREGAERIASAI 441


>gi|311031029|ref|ZP_07709119.1| phosphoglucosamine mutase [Bacillus sp. m3-13]
          Length = 448

 Score =  263 bits (672), Expect = 3e-68,   Method: Composition-based stats.
 Identities = 185/444 (41%), Positives = 273/444 (61%), Gaps = 5/444 (1%)

Query: 4   RFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSLV 63
           ++FGTDG+RG +N   +TP    ++G   GY+    +   +V+IG+DTR+SG+MLE +LV
Sbjct: 3   KYFGTDGVRGVAN-SELTPELAFKVGRLGGYVLTKDQTRPKVLIGRDTRISGHMLEGALV 61

Query: 64  AGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVST 123
           AG  + G +   LG I +P VA LT++L A  GVMISASHNP  DNGIK FGPDG+K+S 
Sbjct: 62  AGLLSIGAEVMRLGVISTPGVAYLTKALGAQAGVMISASHNPVADNGIKFFGPDGFKLSD 121

Query: 124 DIEDRIETLLEDDLTSYLSCYD-SIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVVD 182
           + E  IE L++++  S        +G          +Y++ +K+T+       G+ I +D
Sbjct: 122 EQEAEIEALMDEETDSLPRPVGADLGQVNDYFEGGQKYLQFLKQTVDE--DFSGIHIALD 179

Query: 183 CANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIAL 242
           CA+GA+   A  +F +L AD+  +G  PNG+NIN   GST+  +L + V E  ADIG+A 
Sbjct: 180 CAHGATSSHATHLFADLEADISTMGSSPNGLNINDGVGSTHPEALAQLVLEKGADIGLAF 239

Query: 243 DGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLGL 302
           DGDGDR+I VDEKG IV+GDQIM + A+       LR N +V+TVMSN+G  + +    +
Sbjct: 240 DGDGDRIIAVDEKGQIVDGDQIMFICAKYLSEQGRLRHNTVVSTVMSNLGFYKALEAANV 299

Query: 303 SLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKPV 362
             K+T VGDRY++E MKN  + +GGEQSGHII  DY +TGDG++  LQ++  +K   K +
Sbjct: 300 ETKQTAVGDRYVVEEMKNGNYLLGGEQSGHIIFLDYNTTGDGMLTGLQLVNIMKLTKKSL 359

Query: 363 STICHCFEEYPQFLRSVSVKDTS-ILNSSSIVQAIADAESELRGIDRLIVRASGTESLIR 421
           S +     ++PQ L ++ V D   +  +  +   I + E+E+ G  R++VR SGTE L+R
Sbjct: 360 SELAGEMTKFPQLLVNIKVTDKHRVTENEKVKAVIEEVEAEMNGNGRILVRPSGTEPLVR 419

Query: 422 IMAEGDDLSRIKRIVDDLAKVIPM 445
           +MAE     +    V+ +A V+  
Sbjct: 420 VMAEAPTQEQCDEYVERIAAVVRA 443


>gi|162146634|ref|YP_001601093.1| phosphoglucosamine mutase [Gluconacetobacter diazotrophicus PAl 5]
 gi|209543374|ref|YP_002275603.1| phosphoglucosamine mutase [Gluconacetobacter diazotrophicus PAl 5]
 gi|226722754|sp|A9HB20|GLMM_GLUDA RecName: Full=Phosphoglucosamine mutase
 gi|161785209|emb|CAP54755.1| putative phosphoglucosamine mutase [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|209531051|gb|ACI50988.1| phosphoglucosamine mutase [Gluconacetobacter diazotrophicus PAl 5]
          Length = 452

 Score =  263 bits (672), Expect = 3e-68,   Method: Composition-based stats.
 Identities = 241/442 (54%), Positives = 310/442 (70%)

Query: 2   KRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENS 61
            R  FGTDGIRG +N  P+T     ++G A G  F       RV++GKDTRLSGYM+E +
Sbjct: 4   TRHLFGTDGIRGLANQDPMTVEIAQKLGQAAGLRFTRGVHRHRVLLGKDTRLSGYMIECA 63

Query: 62  LVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKV 121
           LV+GF +AGMD  ++GP+P+PA+AMLTRSLRAD+GVMISASHNP+ DNGIKLFGPDG+K+
Sbjct: 64  LVSGFLSAGMDVTLVGPMPTPAIAMLTRSLRADLGVMISASHNPFGDNGIKLFGPDGFKL 123

Query: 122 STDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVV 181
           S + E  IE L+  DL   L+  D IG A R++    RYIE+ K + PR   L GLRIV+
Sbjct: 124 SDETEAEIEELMRSDLAGRLAAPDRIGRASRLNDAAGRYIENAKASFPRGRRLDGLRIVI 183

Query: 182 DCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIA 241
           DCANGA+Y+VAP   WELGA+V+ IG +P+GININ  CGST   SL   V    A IGIA
Sbjct: 184 DCANGAAYRVAPTALWELGAEVIRIGCEPDGININEQCGSTKPESLCEAVVAHGAHIGIA 243

Query: 242 LDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLG 301
           LDGD DRV+I DEKG +++GDQI+ALIAR W     L    IV TVMSN+GL R + GLG
Sbjct: 244 LDGDADRVLIADEKGRLIDGDQILALIARSWGRQGRLNSAQIVATVMSNMGLARCLEGLG 303

Query: 302 LSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKP 361
           L L RT VGDRY++E M+  G N+GGEQSGH++LSD+ +TGDGLVAALQVL  + +  +P
Sbjct: 304 LELVRTAVGDRYVVERMRELGANLGGEQSGHMVLSDFATTGDGLVAALQVLAVLVEEGRP 363

Query: 362 VSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLIR 421
            S +C  F  +PQ LR+V     S L++ S+  A   AE+EL    RL++R SGTE L+R
Sbjct: 364 ASEVCRMFTPFPQMLRNVRFTGKSPLHAPSVQDARRRAEAELGTAGRLLLRESGTEPLVR 423

Query: 422 IMAEGDDLSRIKRIVDDLAKVI 443
           +MAE +D + ++RIV ++ + I
Sbjct: 424 VMAEAEDPALVERIVAEMCEAI 445


>gi|295677136|ref|YP_003605660.1| phosphoglucosamine mutase [Burkholderia sp. CCGE1002]
 gi|295436979|gb|ADG16149.1| phosphoglucosamine mutase [Burkholderia sp. CCGE1002]
          Length = 452

 Score =  263 bits (672), Expect = 3e-68,   Method: Composition-based stats.
 Identities = 194/451 (43%), Positives = 283/451 (62%), Gaps = 10/451 (2%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRG------KKKHRRVVIGKDTRLS 54
           M RR+FGTDGIRGK    PITP F++R+G A G +  G            V+IGKDTR+S
Sbjct: 1   MARRYFGTDGIRGKVGEGPITPEFVLRLGYAAGKVLAGADQWAKTGARPTVLIGKDTRVS 60

Query: 55  GYMLENSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLF 114
           GYMLE +L +GF+AAG+D  + GP+P+P +A LTR+LR   GV+ISASHNPY DNGIK F
Sbjct: 61  GYMLEAALESGFSAAGVDVMLAGPMPTPGIAYLTRALRLAAGVVISASHNPYYDNGIKFF 120

Query: 115 GPDGYKVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTL 174
             DG K+  D+E +IE  LE  L    +  + +G A+R+D    RYIE  K T P    L
Sbjct: 121 SADGNKLPDDVEAQIEEQLE--LPLACAASEQLGKARRLDDAAGRYIEFCKSTFPAAYDL 178

Query: 175 QGLRIVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEV 234
           +G+++VVDCA+GA+Y VAP VF ELGA+V+ IG  PNG NIN   G+T   +L R V   
Sbjct: 179 RGMKLVVDCAHGAAYDVAPHVFHELGAEVIPIGVSPNGFNINDGVGATAPDALVRAVRAN 238

Query: 235 RADIGIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLE 294
            AD+GIALDGD DR+ +VDE G + NGD+++ ++ ++ ++ +      + T  M+N+ +E
Sbjct: 239 HADLGIALDGDADRLQVVDESGRLFNGDELLYVLVKDRIATAGHVEGAVGTL-MTNMAVE 297

Query: 295 RFIAGLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRY 354
             +   G+   R  VGDRY++E ++ +G+ +G E SGHI+  D  STGDG+V+AL VL  
Sbjct: 298 VALQRAGVKFVRAAVGDRYVLEQLREHGWQLGAEGSGHILSLDRHSTGDGIVSALLVLAA 357

Query: 355 IKQYDKPVSTICHCFEEYPQFLRSVSVKDTSILNS-SSIVQAIADAESELRGIDRLIVRA 413
           +++  K ++ +      +PQ L +V +K  +      +I  AI  AE  L G  R+++RA
Sbjct: 358 MQRSGKSLADLLDGVTLFPQKLINVRMKPGADWKGSDAIRSAIKVAEGALDGRGRVLIRA 417

Query: 414 SGTESLIRIMAEGDDLSRIKRIVDDLAKVIP 444
           SGTE ++R+M E  +++      + +A+ + 
Sbjct: 418 SGTEPVLRVMVEAQNVADALEHSEAIAEAVR 448


>gi|84501304|ref|ZP_00999509.1| Phosphoglucomutase/phosphomannomutase [Oceanicola batsensis
           HTCC2597]
 gi|84390595|gb|EAQ03083.1| Phosphoglucomutase/phosphomannomutase [Oceanicola batsensis
           HTCC2597]
          Length = 442

 Score =  263 bits (672), Expect = 3e-68,   Method: Composition-based stats.
 Identities = 237/441 (53%), Positives = 311/441 (70%), Gaps = 3/441 (0%)

Query: 5   FFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSLVA 64
            FGTDG+RG++NT P+T    MR+  A G  FR  ++  RVVIGKDTRLSGYMLEN+L A
Sbjct: 1   MFGTDGVRGRTNTHPMTAELAMRLAAAAGRFFRRDQQEHRVVIGKDTRLSGYMLENALTA 60

Query: 65  GFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVSTD 124
           GFT+ GM+ F+LGP+P+PAV  LTRS+RADVGVMISASHNP +DNGIK FGPDG+K+S D
Sbjct: 61  GFTSTGMNVFLLGPVPTPAVGFLTRSMRADVGVMISASHNPAEDNGIKFFGPDGFKLSDD 120

Query: 125 IEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVVDCA 184
            E  IE L+E  ++  L+    IG AKR+D    RY+E+VK T PR   L GLRIVVDCA
Sbjct: 121 AETEIERLMEAGVS--LAHPQRIGRAKRIDDSGSRYVEYVKTTFPRQFRLDGLRIVVDCA 178

Query: 185 NGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIALDG 244
           NGA+++V P + WELGADV+ +G  PNG+NIN  CGST+      KV E RAD+G+ LDG
Sbjct: 179 NGAAHRVGPSILWELGADVIPVGTSPNGLNINDKCGSTHPDLAAAKVLETRADVGLCLDG 238

Query: 245 DGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLGLSL 304
           D DR+I++D+ G  V+GDQIM LIA  W     L G+ +VTTVMSN+GLERF+   G+++
Sbjct: 239 DADRLILIDQNGQRVDGDQIMGLIASRWKEDGRLAGDTLVTTVMSNLGLERFLESRGIAI 298

Query: 305 KRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKPVST 364
           +RT+VGDRY++E M+  GFN+GGEQSGHI+++D+ +TGDGLVAALQVL  + +     S 
Sbjct: 299 ERTKVGDRYVVERMRQGGFNLGGEQSGHIVMTDHATTGDGLVAALQVLAAMVETGARASD 358

Query: 365 ICHCFEEYPQFLRSVSV-KDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLIRIM 423
           +   F   PQ L +V     T  L+  S+ QAIAD E +L    RL++R SGTE LIR+M
Sbjct: 359 LLRVFTPIPQVLHNVRYASGTEPLDRDSVRQAIADGEKKLGTSGRLLIRKSGTEPLIRVM 418

Query: 424 AEGDDLSRIKRIVDDLAKVIP 444
            E +D   +  ++D + + + 
Sbjct: 419 GEAEDQDTLHSVLDTICRAVE 439


>gi|163938164|ref|YP_001643048.1| phosphoglucosamine mutase [Bacillus weihenstephanensis KBAB4]
 gi|229131165|ref|ZP_04260075.1| Phosphoglucosamine mutase [Bacillus cereus BDRD-ST196]
 gi|226722711|sp|A9VPC3|GLMM_BACWK RecName: Full=Phosphoglucosamine mutase
 gi|163860361|gb|ABY41420.1| phosphoglucosamine mutase [Bacillus weihenstephanensis KBAB4]
 gi|228652275|gb|EEL08202.1| Phosphoglucosamine mutase [Bacillus cereus BDRD-ST196]
          Length = 448

 Score =  263 bits (672), Expect = 4e-68,   Method: Composition-based stats.
 Identities = 193/444 (43%), Positives = 276/444 (62%), Gaps = 5/444 (1%)

Query: 4   RFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSLV 63
           ++FGTDG+RG +N   +TP    +IG   GY+        +V+IG+DTR+SG+MLE +LV
Sbjct: 3   KYFGTDGVRGVANK-ELTPELAFKIGRFGGYVLTKDTDRPKVIIGRDTRVSGHMLEGALV 61

Query: 64  AGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVST 123
           AG  + G +   LG I +P VA LT++L A  GVMISASHNP QDNGIK FG DG+K++ 
Sbjct: 62  AGLLSTGAEVMRLGVISTPGVAYLTKALGAQAGVMISASHNPVQDNGIKFFGSDGFKLTD 121

Query: 124 DIEDRIETLLEDDLTSYLSCYD-SIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVVD 182
           + E  IE LL+ ++         ++G          +Y++++K+T+  +    GL I +D
Sbjct: 122 EQEAEIEALLDKEVDELPRPTGTNLGQVSDYFEGGQKYLQYIKQTV--EEDFSGLHIALD 179

Query: 183 CANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIAL 242
           CA+GA+  +AP +F +L AD+  +G  PNG+NIN   GST+   L   V E  ADIG+A 
Sbjct: 180 CAHGATSSLAPYLFADLEADISTMGTSPNGMNINAGVGSTHPEVLAELVKEKGADIGLAF 239

Query: 243 DGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLGL 302
           DGDGDR+I VDEKG IV+GDQIM + A+       L+ N +V+TVMSN+G  + +    +
Sbjct: 240 DGDGDRLIAVDEKGNIVDGDQIMFICAKYMKETGQLKHNTVVSTVMSNLGFYKALEANNI 299

Query: 303 SLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKPV 362
           +  +T VGDRY+ME MK  G+N+GGEQSGHIIL DY +TGDG+++ALQ++  +K   KP+
Sbjct: 300 TSDKTAVGDRYVMEEMKRGGYNLGGEQSGHIILLDYITTGDGMLSALQLVNIMKMTKKPL 359

Query: 363 STICHCFEEYPQFLRSVSVKDTS-ILNSSSIVQAIADAESELRGIDRLIVRASGTESLIR 421
           S +     ++PQ L +V V D    L +  I + I   E E+ G  R++VR SGTE LIR
Sbjct: 360 SELAGEMTKFPQLLVNVRVTDKKLALENEKIKEIIRVVEEEMNGDGRILVRPSGTEPLIR 419

Query: 422 IMAEGDDLSRIKRIVDDLAKVIPM 445
           +MAE          V  + +V+  
Sbjct: 420 VMAEAPTQEICDGYVHRIVEVVKA 443


>gi|239637449|ref|ZP_04678431.1| phosphoglucosamine mutase [Staphylococcus warneri L37603]
 gi|239597049|gb|EEQ79564.1| phosphoglucosamine mutase [Staphylococcus warneri L37603]
          Length = 451

 Score =  263 bits (672), Expect = 4e-68,   Method: Composition-based stats.
 Identities = 192/445 (43%), Positives = 277/445 (62%), Gaps = 7/445 (1%)

Query: 4   RFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKK--KHRRVVIGKDTRLSGYMLENS 61
           ++FGTDG+RG +N   +TP    ++G   GY+    K  K+ RV++G+DTR+SG MLE++
Sbjct: 3   KYFGTDGVRGVANE-ELTPELAFKLGRYGGYVLAHNKGEKNPRVLVGRDTRVSGEMLESA 61

Query: 62  LVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKV 121
           L+AG  + G +   LG I +P VA LTR + A +GVMISASHNP  DNGIK FG DG+K+
Sbjct: 62  LIAGLISIGAEVMRLGIISTPGVAYLTREMDAGLGVMISASHNPVADNGIKFFGSDGFKL 121

Query: 122 STDIEDRIETLLEDDLTSYLSCYD-SIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           S D E+ IE LL+ D  S        I H         +Y+ ++K T+   V L+G++IV
Sbjct: 122 SDDQEEEIEALLDQDEPSLPRPVGTDIVHYSDYFEGAQKYLSYLKSTVD--VNLEGMKIV 179

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           +D ANG++  +AP +F +L AD   +G  P+G NIN +CGST+  +L  KV E  AD G+
Sbjct: 180 LDGANGSTSSLAPFLFGDLEADTETVGCSPDGYNINEECGSTHPQALAEKVLETGADFGL 239

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           A DGDGDR+I VDEKG IV+GDQIM +I +E   +  L  N IV+TVMSN+G  + +   
Sbjct: 240 AFDGDGDRIIAVDEKGHIVDGDQIMFIIGQEMHKNQELNNNMIVSTVMSNLGFYKALENE 299

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           G+   +T+VGDRY++E M+   +N+GGEQSGHI+L DY +TGDGL+  +Q+   +K   K
Sbjct: 300 GIQSNKTKVGDRYVVEEMRRGNYNLGGEQSGHIVLMDYNTTGDGLLTGVQLAAIVKMSGK 359

Query: 361 PVSTICHCFEEYPQFLRSVSVKDT-SILNSSSIVQAIADAESELRGIDRLIVRASGTESL 419
            +S +    + YPQ L +V V D   +  +  + + +   E E+ G  R++VR SGTE L
Sbjct: 360 SLSELVSQMKTYPQSLINVRVTDKYRVEENIDVKEVMTKVEVEMNGEGRILVRPSGTEPL 419

Query: 420 IRIMAEGDDLSRIKRIVDDLAKVIP 444
           +R+M E       +R    +A V+ 
Sbjct: 420 VRVMVEASTDEDAQRFAQQIADVVE 444


>gi|261378882|ref|ZP_05983455.1| phosphoglucosamine mutase [Neisseria cinerea ATCC 14685]
 gi|269144698|gb|EEZ71116.1| phosphoglucosamine mutase [Neisseria cinerea ATCC 14685]
          Length = 444

 Score =  263 bits (672), Expect = 4e-68,   Method: Composition-based stats.
 Identities = 197/448 (43%), Positives = 292/448 (65%), Gaps = 6/448 (1%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKK--KHRRVVIGKDTRLSGYML 58
           M +++FGTDG+RG+   FPITP+F++++G A G +       +   V+IGKDTR+SGYML
Sbjct: 1   MAKKYFGTDGVRGEVGQFPITPDFVLKLGYAAGQVLVQHDTDQKPTVLIGKDTRISGYML 60

Query: 59  ENSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDG 118
           E +LVAGFTAAG++    GP+P+P VA LTR+LR   GVMISASHN Y DNGIK F   G
Sbjct: 61  EAALVAGFTAAGVNVIQTGPLPTPGVAYLTRALRLSAGVMISASHNAYSDNGIKFFAEGG 120

Query: 119 YKVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLR 178
            K+S +IE  IE  +++++ +       +G A+R+ G  +RYIE  K T P    L+GL+
Sbjct: 121 VKLSDEIELEIEAKIDEEMKTQP--SARLGRARRISGADERYIEFCKSTFPSHSDLRGLK 178

Query: 179 IVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADI 238
           +V+D ANGA Y VAP+VF ELGA VV IGD+PNG NIN  CG+T   +LQ  V +  AD 
Sbjct: 179 LVIDTANGAGYGVAPKVFHELGAQVVSIGDEPNGYNINEKCGATYTKTLQAAVLQHEADY 238

Query: 239 GIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIA 298
           GIALDGDGDR+++VD+ G + +GD ++ +IA+   +   +   G+V TVM+N+ +E  + 
Sbjct: 239 GIALDGDGDRLMMVDKNGKVYDGDSLIYVIAK-ARAREGINIGGVVGTVMTNMAMEIALK 297

Query: 299 GLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQY 358
             G+   R +VGDRY++E +   G+ +GGE SGHI+  D  +TGDG+++ALQVL  ++  
Sbjct: 298 EQGVDFCRAKVGDRYVLEQLNQRGWLIGGEASGHILCMDKHNTGDGIISALQVLAALQIL 357

Query: 359 DKPVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTES 418
           ++ ++T+C  ++ YPQ + +V ++       +S    +A+ E EL G  R+++RASGTE 
Sbjct: 358 NQDLATVCADWQPYPQTMINVRIQKGQKWQEAS-KDVLAEVEKELEGKGRVVLRASGTEP 416

Query: 419 LIRIMAEGDDLSRIKRIVDDLAKVIPMI 446
           ++R+M E       +   + +A  I  I
Sbjct: 417 VVRVMVEARQADWAREGAERIASAIGSI 444


>gi|85706230|ref|ZP_01037325.1| Phosphoglucomutase/phosphomannomutase [Roseovarius sp. 217]
 gi|85669394|gb|EAQ24260.1| Phosphoglucomutase/phosphomannomutase [Roseovarius sp. 217]
          Length = 446

 Score =  263 bits (672), Expect = 4e-68,   Method: Composition-based stats.
 Identities = 233/446 (52%), Positives = 315/446 (70%), Gaps = 3/446 (0%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M  + FGTDG+RG++N++P+T +  +++G A G  FR  K+  RVVIGKDTR SGYM+E 
Sbjct: 1   MGAKLFGTDGVRGQANSWPMTADVALQLGAAAGRYFRRDKQEHRVVIGKDTRRSGYMIEY 60

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +L AGFT+ GM+ F+LGP+P+PA+  LT SLRADVGVMISASHNP  DNGIKLFGPDGYK
Sbjct: 61  ALTAGFTSTGMNVFLLGPVPTPAIGYLTHSLRADVGVMISASHNPASDNGIKLFGPDGYK 120

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +S ++E  I  LL++   + L+  ++IG AKR+D    RY+E+ K T P    L+GLRIV
Sbjct: 121 LSDEVEAGIAQLLDEG--ARLASPENIGRAKRIDDARGRYVEYAKTTFPHRRRLEGLRIV 178

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           +DCANGA+Y+ APEV WELGA+V+ +G +P+G NINLDCGST   +  RKV E RAD+GI
Sbjct: 179 LDCANGAAYRTAPEVLWELGAEVITMGVEPDGFNINLDCGSTKPQAAARKVLETRADLGI 238

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
            LDGD DRV+++DE+G I +GDQ MALIA  W     L GN +V TVMSN+GLER +   
Sbjct: 239 CLDGDADRVVLIDEEGKIADGDQFMALIATRWAREGRLAGNTLVATVMSNLGLERHLEAQ 298

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           G++L+RT VGDRY++E M+  G N+GGEQSGHI+++DY +TGDGL+ ALQ L  + +  +
Sbjct: 299 GINLRRTAVGDRYVVEAMRAGGHNLGGEQSGHIVMTDYATTGDGLIGALQFLAAMVETGE 358

Query: 361 PVSTICHCFEEYPQFLRSVSV-KDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESL 419
             S +   FE  PQ L +V   K    + S ++  A+A AE  L G  RL+VR SGTE L
Sbjct: 359 KASGLAQVFEPVPQKLINVRFAKGKDPMASDAVQSAMAAAEKLLGGDGRLLVRPSGTEPL 418

Query: 420 IRIMAEGDDLSRIKRIVDDLAKVIPM 445
           IR+MAE  + + + +++D +   +  
Sbjct: 419 IRVMAEALNPAVLDQVMDAVVGAVRQ 444


>gi|253577077|ref|ZP_04854399.1| phosphoglucosamine mutase [Paenibacillus sp. oral taxon 786 str.
           D14]
 gi|251843571|gb|EES71597.1| phosphoglucosamine mutase [Paenibacillus sp. oral taxon 786 str.
           D14]
          Length = 446

 Score =  263 bits (672), Expect = 4e-68,   Method: Composition-based stats.
 Identities = 192/444 (43%), Positives = 289/444 (65%), Gaps = 5/444 (1%)

Query: 4   RFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSLV 63
           ++FGTDG+RG +N   +T     +IG   GY+  G+    +VVIG DTR+SG MLE++LV
Sbjct: 3   KYFGTDGVRGIANK-ELTAELAYQIGRCGGYVLAGQVPKPKVVIGMDTRISGVMLESALV 61

Query: 64  AGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVST 123
           AG  + G +   LG + +PAVA LTR L+AD GVMISASHNP +DNGIK FG DG+K+S 
Sbjct: 62  AGLLSIGAEVIRLGVVTTPAVAYLTRLLKADAGVMISASHNPVEDNGIKFFGSDGFKLSD 121

Query: 124 DIEDRIETLLEDDLTS-YLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVVD 182
           + E +IE LL+  +          +G     +    +Y+EH+K T+    + +GL++V+D
Sbjct: 122 ETELQIEELLDKAVDELPRPIGGDLGTVTVDNESKLKYLEHLKTTINS--SFKGLKVVLD 179

Query: 183 CANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIAL 242
           CANGA+Y++AP +F ELGA+V  +  +PNG+NIN  CGST+   L+ +V  + A +G+A 
Sbjct: 180 CANGAAYELAPRLFRELGAEVHTLAAEPNGLNINDHCGSTHPERLKEEVVRLGAHVGLAF 239

Query: 243 DGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLGL 302
           DGD DR+I +DE G  V+GD I+ +          L+ + +V+TVMSN G  +    LGL
Sbjct: 240 DGDADRLIAIDELGQEVDGDYILCICGDAMNKAGKLKDSTVVSTVMSNFGFYKAAKKLGL 299

Query: 303 SLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKPV 362
           + ++T VGDRY+M  M   G+N+GGEQSGH+I  DY +TGDG++ A+Q++  +    KP+
Sbjct: 300 ATQQTSVGDRYVMAEMLRGGYNLGGEQSGHVIFLDYNTTGDGILTAIQLVDTMLASGKPL 359

Query: 363 STICHCFEEYPQFLRSVSVKDTSILNSSSIV-QAIADAESELRGIDRLIVRASGTESLIR 421
           S +    ++YPQ L +V V+D S    ++++ +AIA+ E EL    R++VR SGTESLIR
Sbjct: 360 SELKKVMKQYPQVLVNVRVQDKSKFAGNAVIAEAIAEVEQELGDNGRVLVRPSGTESLIR 419

Query: 422 IMAEGDDLSRIKRIVDDLAKVIPM 445
           +MAEG + + ++++V  + +V+  
Sbjct: 420 VMAEGPEKAELEKLVAQIVEVVEK 443


>gi|332535626|ref|ZP_08411390.1| phosphoglucosamine mutase [Pseudoalteromonas haloplanktis ANT/505]
 gi|332034953|gb|EGI71476.1| phosphoglucosamine mutase [Pseudoalteromonas haloplanktis ANT/505]
          Length = 449

 Score =  263 bits (672), Expect = 4e-68,   Method: Composition-based stats.
 Identities = 194/446 (43%), Positives = 292/446 (65%), Gaps = 6/446 (1%)

Query: 1   MK-RRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLE 59
           MK R++FGTDG+RG   T PI P F M++G A G +   +   ++V+IGKDTR+SGYMLE
Sbjct: 1   MKERKYFGTDGVRGLVGTPPINPEFAMKLGWAAGRVL-SQSGTKKVIIGKDTRISGYMLE 59

Query: 60  NSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGY 119
            +L AG  AAG+D  +LGP+P+PAVA L ++ RA+ G++ISASHNPY DNGIK F   G 
Sbjct: 60  TALEAGLIAAGIDVVLLGPMPTPAVAYLAQTFRAEAGIVISASHNPYYDNGIKFFNGQGL 119

Query: 120 KVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRI 179
           K+  ++E +IE +L++ +T      D +G A R+     RYIE  K   P+ ++L+GL+I
Sbjct: 120 KLDDEVELQIEAMLDEQMTCVA--SDKLGKASRLVSADGRYIEFCKSQFPQGLSLEGLKI 177

Query: 180 VVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIG 239
           VVDCANGA+Y +AP V  ELGA+V+    +PNG+NIN +CG+T+V +L+RKV E +AD+G
Sbjct: 178 VVDCANGATYHIAPSVMRELGAEVITHACEPNGVNINHECGATHVDTLKRKVLEFKADVG 237

Query: 240 IALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAG 299
           IA DGDGDRV++VD  G + +GD ++ +IA    +   + G G+V TVMSN+GLE  +  
Sbjct: 238 IAYDGDGDRVMMVDHNGRVFDGDDLVYIIA-CQAAEDDMLGGGVVGTVMSNMGLENALKA 296

Query: 300 LGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYD 359
            G+   R++VGDRY+ME ++  G+ +GGE SGH++  D  STGDG++++LQVL  +   +
Sbjct: 297 KGIEFARSKVGDRYVMELLQQKGWKIGGESSGHVLNLDLISTGDGIISSLQVLAAMVAQN 356

Query: 360 KPVSTICHCFEEYPQFLRSVSVK-DTSILNSSSIVQAIADAESELRGIDRLIVRASGTES 418
           + +  +   F +YP  + +V     T    +  ++ A+A+ E  L    R+++R SGTE 
Sbjct: 357 RTLQDLGAGFTKYPMKMINVRYTAGTDPTKAPEVLSAVAEVELALGDKGRVLLRKSGTEP 416

Query: 419 LIRIMAEGDDLSRIKRIVDDLAKVIP 444
           ++R+M E +    +      +A V+ 
Sbjct: 417 VVRVMVEAEQEKIVIDSAQKIAAVVE 442


>gi|153001404|ref|YP_001367085.1| phosphoglucosamine mutase [Shewanella baltica OS185]
 gi|205830870|sp|A6WQD3|GLMM2_SHEB8 RecName: Full=Phosphoglucosamine mutase 2
 gi|151366022|gb|ABS09022.1| phosphoglucosamine mutase [Shewanella baltica OS185]
          Length = 450

 Score =  263 bits (671), Expect = 4e-68,   Method: Composition-based stats.
 Identities = 204/452 (45%), Positives = 290/452 (64%), Gaps = 12/452 (2%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M R++FGTDG+RGK   FPITP+F M++G A G +       + V+IGKDTR SGYMLE+
Sbjct: 1   MSRKYFGTDGVRGKVGEFPITPDFAMKLGWAAGTVLAS-TGTKEVLIGKDTRSSGYMLES 59

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           ++ AGF+AAG++  ++GP+P+PAVA L  + RAD GV+ISASHNP+ DNGIK F   G K
Sbjct: 60  AMEAGFSAAGVNVALIGPMPTPAVAYLASTFRADAGVVISASHNPFYDNGIKFFSNSGTK 119

Query: 121 VSTDIEDRIETLLEDDLTSYLSC---YDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGL 177
           ++   E  IE LLE  L          + +G  +R+D    RYIE  K T P  ++L GL
Sbjct: 120 LNDAQELEIEALLEKALNQNAMQCVASEKLGKVRRIDDAAGRYIEFCKGTFPNHLSLAGL 179

Query: 178 RIVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRAD 237
           +IV+D A+GA+Y +AP V+ ELGA+V+ I DKPNG+NIN  CG+T++ SLQ  V    AD
Sbjct: 180 KIVIDSAHGAAYHIAPNVYRELGAEVISINDKPNGVNINDHCGATHLDSLQTAVMVHEAD 239

Query: 238 IGIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFI 297
           +GIALDGD DRV+ VD  G +V+GD+I+ ++A+   S   + G  + T  MSN+GLE  +
Sbjct: 240 LGIALDGDADRVMFVDHNGHVVDGDEILFILAQAAHSKGEMTGGVVGTL-MSNLGLELAL 298

Query: 298 AGLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQ 357
             + +   R +VGDRY++E +K  G+ +GGE SGHI+   + STGDG+VA+LQVL+ + +
Sbjct: 299 KQMDIPFVRAKVGDRYVVEQLKRTGWQLGGEGSGHILSLQHASTGDGIVASLQVLKAVLE 358

Query: 358 YDKPVSTICHCFEEYPQFLRSVSV---KDTSILNSSSIVQAIADAESELRGIDRLIVRAS 414
             K +S I     + PQ L +V +      SIL ++S+ QA+  AE  L    R+++R S
Sbjct: 359 SQKSLSEIKAGMTKLPQVLINVRLATADADSILATTSVKQAVIKAEEFLGDQGRVLLRKS 418

Query: 415 GTESLIRIMAEGDD----LSRIKRIVDDLAKV 442
           GTE LIR+M E  D     ++ + I D +   
Sbjct: 419 GTEPLIRVMVESTDNIMTQTQAEYIADAVRAA 450


>gi|304405566|ref|ZP_07387225.1| phosphoglucosamine mutase [Paenibacillus curdlanolyticus YK9]
 gi|304345605|gb|EFM11440.1| phosphoglucosamine mutase [Paenibacillus curdlanolyticus YK9]
          Length = 446

 Score =  263 bits (671), Expect = 4e-68,   Method: Composition-based stats.
 Identities = 187/442 (42%), Positives = 275/442 (62%), Gaps = 3/442 (0%)

Query: 4   RFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSLV 63
           ++FGTDG+RG +N   +TP    +IG   GY+  G+    +VVIG DTR+SG MLE +L+
Sbjct: 3   KYFGTDGVRGVANR-ELTPELAYKIGRCGGYVLAGQADKPKVVIGLDTRISGPMLEAALI 61

Query: 64  AGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVST 123
           AG  + G     +G + +PAVA LTR L+AD  VMISASHNP  DNGIK FG DG+K+S 
Sbjct: 62  AGLLSIGASVVRIGVVSTPAVAYLTRELKADAAVMISASHNPVADNGIKFFGGDGFKLSD 121

Query: 124 DIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVVDC 183
           + E  IE L++ ++                D           +T     + +G+++V+DC
Sbjct: 122 ETELEIERLMDAEIDELPRPEGGDIGTVTSDDTAKYRYLEFLKTTI-QSSFEGVKVVLDC 180

Query: 184 ANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIALD 243
           A+G++Y++AP VF ELGA+V+ +G +PNG NIN   GST+   L+ +V +  A +G++ D
Sbjct: 181 AHGSAYELAPRVFRELGAEVITVGAEPNGRNINDGVGSTHPEYLRDQVLKHGAQLGLSFD 240

Query: 244 GDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLGLS 303
           GD DR+I +DE G  V+GD I+ +          L+G  IVTTVM+NIG  +    LGL 
Sbjct: 241 GDADRLIAIDENGEEVDGDYILCICGDAMRRQGRLQGETIVTTVMANIGFFKATEKLGLK 300

Query: 304 LKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKPVS 363
             +T VGDRY+ME M+  GFN+GGEQSGH+I  DY +TGDG++ A+Q++  + Q  K +S
Sbjct: 301 TAQTAVGDRYVMEEMRRGGFNLGGEQSGHVIFLDYNTTGDGILTAMQLVDTLVQSGKKLS 360

Query: 364 TICHCFEEYPQFLRSVSVKDTSILN-SSSIVQAIADAESELRGIDRLIVRASGTESLIRI 422
            +     +YPQ L +V V D ++ N +++I +A++  E+EL    R++VR SGTESLIR+
Sbjct: 361 ELKQLMRKYPQVLVNVRVADKTLYNDNAAIAEAVSAVEAELGDNGRVLVRPSGTESLIRV 420

Query: 423 MAEGDDLSRIKRIVDDLAKVIP 444
           MAEG D  +++  V  +  V+ 
Sbjct: 421 MAEGPDKDQVEAYVHRIVDVVK 442


>gi|94311124|ref|YP_584334.1| phosphoglucosamine mutase [Cupriavidus metallidurans CH34]
 gi|158564224|sp|Q1LLB1|GLMM_RALME RecName: Full=Phosphoglucosamine mutase
 gi|93354976|gb|ABF09065.1| phosphoglucosamine mutase [Cupriavidus metallidurans CH34]
          Length = 447

 Score =  263 bits (671), Expect = 4e-68,   Method: Composition-based stats.
 Identities = 194/450 (43%), Positives = 286/450 (63%), Gaps = 8/450 (1%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLF----RGKKKHRRVVIGKDTRLSGY 56
           M R++FGTDG+RG+    PITP+F+MR+G A G +     +  +    V+IGKDTR+SGY
Sbjct: 1   MTRKYFGTDGVRGRVGDAPITPDFVMRLGHAAGKVLALGQKTSQGKPTVLIGKDTRISGY 60

Query: 57  MLENSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGP 116
           MLE +L AGFTAAG++  + GP+P+P +A LTR+LR   GV+ISASHNPY DNGIK F  
Sbjct: 61  MLEAALEAGFTAAGVNVLLTGPLPTPGIAYLTRTLRLAAGVVISASHNPYYDNGIKFFSA 120

Query: 117 DGYKVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQG 176
            G K+  D+E +IE ++E+ +T      D +G A+R+D    RYIE  K T P +  L G
Sbjct: 121 SGDKLPDDVESQIEAMVEEPMT--CVHSDELGRARRIDDAAGRYIEFCKSTFPYEHDLHG 178

Query: 177 LRIVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRA 236
           L+IVVDCANGA+Y +AP VF ELGA+V+ IG++PNG NIN   G+T    L   V    A
Sbjct: 179 LKIVVDCANGAAYHIAPHVFHELGAEVISIGNQPNGRNINAGYGATAPEKLIEAVKANGA 238

Query: 237 DIGIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERF 296
           D+G+A DGD DR+ +VD  G + NGD+++ LI R+  +        + T  M+N+ +E  
Sbjct: 239 DLGLAFDGDADRLQVVDADGRLYNGDELLYLIVRDRQASGQRVEGAVGTL-MTNMAVELA 297

Query: 297 IAGLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIK 356
           +  LG+S  R +VGDRY++E +  + + +GGE SGH++  D  +TGDG+V+ALQVL  ++
Sbjct: 298 LKRLGVSFVRAKVGDRYVLEELNRHHWQLGGEGSGHLLCLDRHTTGDGIVSALQVLAALR 357

Query: 357 QYDKPVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIAD-AESELRGIDRLIVRASG 415
           +  K +  +      +PQ L +V V+      + + ++A+ D  E EL G  R+++RASG
Sbjct: 358 RSGKTLPQLLDGVSLFPQTLINVRVEKGFDWQNHAGLKAVRDRVEPELEGRGRVLIRASG 417

Query: 416 TESLIRIMAEGDDLSRIKRIVDDLAKVIPM 445
           TE ++R+M E + +   +R   +LA  +  
Sbjct: 418 TEPVVRVMVEAEQVETAERAAQELAAALRA 447


>gi|167039601|ref|YP_001662586.1| phosphoglucosamine mutase [Thermoanaerobacter sp. X514]
 gi|256751502|ref|ZP_05492379.1| phosphoglucosamine mutase [Thermoanaerobacter ethanolicus CCSD1]
 gi|300915149|ref|ZP_07132464.1| phosphoglucosamine mutase [Thermoanaerobacter sp. X561]
 gi|307725073|ref|YP_003904824.1| phosphoglucosamine mutase [Thermoanaerobacter sp. X513]
 gi|226723931|sp|B0K5X4|GLMM_THEPX RecName: Full=Phosphoglucosamine mutase
 gi|166853841|gb|ABY92250.1| phosphoglucosamine mutase [Thermoanaerobacter sp. X514]
 gi|256749586|gb|EEU62613.1| phosphoglucosamine mutase [Thermoanaerobacter ethanolicus CCSD1]
 gi|300888873|gb|EFK84020.1| phosphoglucosamine mutase [Thermoanaerobacter sp. X561]
 gi|307582134|gb|ADN55533.1| phosphoglucosamine mutase [Thermoanaerobacter sp. X513]
          Length = 447

 Score =  263 bits (671), Expect = 4e-68,   Method: Composition-based stats.
 Identities = 202/447 (45%), Positives = 283/447 (63%), Gaps = 7/447 (1%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M R  FGTDG+RG +N + +TP     +G A  Y+        +VV+GKD+R+SG MLE 
Sbjct: 1   MAR-LFGTDGVRGIAN-YDLTPQLAFELGRAGAYVLTHGTHRPKVVVGKDSRISGDMLEC 58

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +L AG T+ G +   +G IP+PAVA LTR  +AD GVMISASHNP + NGIK F  DGYK
Sbjct: 59  ALTAGLTSVGAEVISVGIIPTPAVAYLTRLYQADAGVMISASHNPVEYNGIKFFDKDGYK 118

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +  ++EDRIE ++++ +         IG  K     H  YIE +K T+     L+G++IV
Sbjct: 119 LPDEVEDRIENIIKEKIELPSPIGTGIGTRKEYTNSHRDYIEFLKSTIDG--DLKGMKIV 176

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           +DCA GAS  +AP +F ELGA+V++ G +P G  IN++CGST+   LQ+ V E  ADIG+
Sbjct: 177 IDCAYGASSTIAPILFKELGAEVILHGAEPIGEKINVNCGSTHPEKLQQLVIENGADIGL 236

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           A DGD DR+I VDEKG +V+GD IMA+ A +      L+ N +V TVMSNIG E  +   
Sbjct: 237 AFDGDADRLIAVDEKGNVVDGDHIMAICAIDLKKKGRLKNNTVVATVMSNIGFEIALKEQ 296

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           G++L RT+VGDRY++E M   G+++GGEQSGHII  D  +TGDG + AL++    K+  K
Sbjct: 297 GINLIRTKVGDRYVLEEMTKGGYSIGGEQSGHIIFLDDNTTGDGEITALKLCSISKESGK 356

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTSI---LNSSSIVQAIADAESELRGIDRLIVRASGTE 417
            +S +  C   YPQ L +  VK+      L    I + I + E E+RG  R+++R SGTE
Sbjct: 357 KLSELAACMITYPQVLINAKVKNELKNAYLEDEEIKREIENLEREMRGEGRVLIRPSGTE 416

Query: 418 SLIRIMAEGDDLSRIKRIVDDLAKVIP 444
            L+R+M EG D  +I ++  +LA++I 
Sbjct: 417 PLVRVMVEGKDYDKISQMAKELAELIE 443


>gi|237809593|ref|YP_002894033.1| phosphoglucosamine mutase [Tolumonas auensis DSM 9187]
 gi|237501854|gb|ACQ94447.1| phosphoglucosamine mutase [Tolumonas auensis DSM 9187]
          Length = 445

 Score =  263 bits (671), Expect = 5e-68,   Method: Composition-based stats.
 Identities = 203/451 (45%), Positives = 304/451 (67%), Gaps = 9/451 (1%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M R++FGTDG+RG    FPITP+F +++G A G +       R V+IGKDTR+SGYMLE+
Sbjct: 1   MNRKYFGTDGVRGLVGQFPITPDFALKLGWAAGKVLAA-SGTREVIIGKDTRISGYMLES 59

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           ++ +GF AAG++  + GP+P+PA+A L R+ RAD GV+ISASHNPY DNGIK F   G K
Sbjct: 60  AMASGFAAAGVNVALTGPLPTPAIAYLARTFRADAGVVISASHNPYHDNGIKFFSGAGVK 119

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIG--HAKRVDGVHDRYIEHVKRTLPRDVTLQGLR 178
           ++    D +E  LE  LT  L C DS     A+R+     RY+E  K   P  ++L+GLR
Sbjct: 120 LN----DEVELALEAQLTQDLQCVDSAHLGKARRITDAIGRYVEFCKSQFPAHLSLEGLR 175

Query: 179 IVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADI 238
           +VVDCA+GA+Y++AP V  ELGA+V  IG +P+G+NIN  CG+T++++L  KV E+RAD+
Sbjct: 176 VVVDCAHGATYQIAPAVLRELGAEVFTIGVEPSGVNINEHCGATDLVALSAKVQELRADV 235

Query: 239 GIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIA 298
           G ALDGDGDR+++VD  G +V+GDQI+ ++AR W         G+V T M+N+GLE+ + 
Sbjct: 236 GFALDGDGDRIMLVDHLGRVVDGDQILFILARHWHER-GELRGGVVGTQMANLGLEKALN 294

Query: 299 GLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQY 358
           GLG+   R++VGDRY++E +   G+ +GGE SGHI+   + +TGDG++A LQVLR + + 
Sbjct: 295 GLGIPFARSKVGDRYVVELLHELGWQLGGENSGHILSLSHTTTGDGIIAGLQVLRTMVER 354

Query: 359 DKPVSTICHCFEEYPQFLRSVSVKDT-SILNSSSIVQAIADAESELRGIDRLIVRASGTE 417
            + ++T C      PQ L ++  +     L S ++ QA+A AE+   G  R+++R SGTE
Sbjct: 355 GQNLATCCEGMTLMPQVLINIRYQGQHDPLTSDAVRQAMAQAEAVFAGQGRILLRKSGTE 414

Query: 418 SLIRIMAEGDDLSRIKRIVDDLAKVIPMIDS 448
            L+R+MAEG++ ++++ + + +A  I  + +
Sbjct: 415 PLLRVMAEGENETQVREMAEQIAASIRTVTA 445


>gi|304409915|ref|ZP_07391534.1| phosphoglucosamine mutase [Shewanella baltica OS183]
 gi|304351324|gb|EFM15723.1| phosphoglucosamine mutase [Shewanella baltica OS183]
          Length = 450

 Score =  263 bits (671), Expect = 5e-68,   Method: Composition-based stats.
 Identities = 204/452 (45%), Positives = 289/452 (63%), Gaps = 12/452 (2%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M R++FGTDG+RGK   FPITP+F M++G A G +       + V+IGKDTR SGYMLE+
Sbjct: 1   MSRKYFGTDGVRGKVGEFPITPDFAMKLGWAAGTVLAS-SGTKEVLIGKDTRSSGYMLES 59

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           ++ AGF+AAG++  ++GP+P+PAVA L  +  AD GV+ISASHNP+ DNGIK F   G K
Sbjct: 60  AIEAGFSAAGVNVALIGPMPTPAVAYLASTFHADAGVVISASHNPFYDNGIKFFSNSGTK 119

Query: 121 VSTDIEDRIETLLEDDLTSYLSC---YDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGL 177
           ++   E  IE LLE  L          + +G  +R+D    RYIE  K T P  ++L GL
Sbjct: 120 LNDAQELEIEALLEKALNQNAMQCVSSEKLGKVRRIDDAAGRYIEFCKGTFPNHLSLAGL 179

Query: 178 RIVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRAD 237
           +IV+D A+GA+Y +AP V+ ELGA+V+ I DKPNG+NIN  CG+T++ SLQ  V    AD
Sbjct: 180 KIVIDSAHGAAYHIAPNVYRELGAEVISINDKPNGVNINDHCGATHLDSLQTAVMVHEAD 239

Query: 238 IGIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFI 297
           +GIALDGD DRV+ VD  G +V+GD+I+ ++A    S   + G  + T  MSN+GLE  +
Sbjct: 240 LGIALDGDADRVMFVDHNGHVVDGDEILFILAHAAHSKGEMTGGVVGTL-MSNLGLELAL 298

Query: 298 AGLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQ 357
             + +   R +VGDRY++E +K  G+ +GGE SGHI+   + STGDG+VA+LQVL+ + +
Sbjct: 299 KQMDIPFVRAKVGDRYVVEQLKATGWQLGGEGSGHILSLQHASTGDGIVASLQVLKAVLE 358

Query: 358 YDKPVSTICHCFEEYPQFLRSVSV---KDTSILNSSSIVQAIADAESELRGIDRLIVRAS 414
           + K +S I     + PQ L +V +      SIL +SS+ QA+  AE  L    R+++R S
Sbjct: 359 FQKSLSEIKAGMTKLPQVLINVRLATADADSILATSSVQQAVIKAEGILGDQGRVLLRKS 418

Query: 415 GTESLIRIMAEGDD----LSRIKRIVDDLAKV 442
           GTE LIR+M E  D     ++ + I D +   
Sbjct: 419 GTEPLIRVMVESTDNLMTHTQAEYIADAVRAA 450


>gi|323144911|ref|ZP_08079474.1| phosphoglucosamine mutase [Succinatimonas hippei YIT 12066]
 gi|322415309|gb|EFY06080.1| phosphoglucosamine mutase [Succinatimonas hippei YIT 12066]
          Length = 447

 Score =  263 bits (671), Expect = 5e-68,   Method: Composition-based stats.
 Identities = 201/445 (45%), Positives = 299/445 (67%), Gaps = 5/445 (1%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           MKR++FGTDG+RG+   +PITP+F++++G+A G +   +KK  +V+IGKDTRLSGYMLE 
Sbjct: 1   MKRKYFGTDGVRGRVGQYPITPDFVLKLGMAAGKVL-SRKKGGKVIIGKDTRLSGYMLEA 59

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +L +GF+AAG+   +LGP+P+PA++ LT++ RAD+GV+ISASHNPY DNGIK F  +G K
Sbjct: 60  ALESGFSAAGVSTVLLGPMPTPAISYLTKAFRADLGVVISASHNPYYDNGIKFFSREGTK 119

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +  ++E  IE +LE D+   L+     G A R +    RYIE  K +    ++L GL+IV
Sbjct: 120 LPDEVELEIEKILESDI--VLADSAEFGRAYRQEDAPGRYIEFCKSSFANHMSLSGLKIV 177

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           +DCANGA+Y VAP VF ELGA V+ IGD+P+GININ   GST+  +L  KV   +AD+GI
Sbjct: 178 IDCANGATYHVAPMVFRELGAKVITIGDRPDGININDGVGSTHPEALIEKVLATKADLGI 237

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           A DGDGDRV++VD  G +++GD ++ +IA++    + L G  + T  MSN+GLE  +   
Sbjct: 238 AFDGDGDRVMMVDSHGHLLDGDALLYIIAKDRFVQNKLHGGVVGTL-MSNLGLELALKRE 296

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           G+   R+ VGDRY+ME + +  +N+GGE SGHII  +Y STGDG+V+ALQVL+   +  K
Sbjct: 297 GIEFTRSAVGDRYVMETLLDKKWNLGGENSGHIICLNYVSTGDGIVSALQVLKAAIRQGK 356

Query: 361 PVSTICHCFEEYPQFLRSVSVK-DTSILNSSSIVQAIADAESELRGIDRLIVRASGTESL 419
            +  +    + +PQ L ++ +      L+   ++  +   E+EL    R+++R SGTE +
Sbjct: 357 SLEDLVRSLDMFPQELVNLRLSAGFDALSDEKVLSEVKAVENELGSRGRVLLRKSGTEPV 416

Query: 420 IRIMAEGDDLSRIKRIVDDLAKVIP 444
           +R+M EG+D   + R+   ++ VI 
Sbjct: 417 VRVMVEGEDREYVHRLAQRISNVIR 441


>gi|291287212|ref|YP_003504028.1| phosphoglucosamine mutase [Denitrovibrio acetiphilus DSM 12809]
 gi|290884372|gb|ADD68072.1| phosphoglucosamine mutase [Denitrovibrio acetiphilus DSM 12809]
          Length = 454

 Score =  263 bits (671), Expect = 5e-68,   Method: Composition-based stats.
 Identities = 217/450 (48%), Positives = 298/450 (66%), Gaps = 5/450 (1%)

Query: 3   RRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKH-RRVVIGKDTRLSGYMLENS 61
           R++FGTDG+RGK+N FP+T  F +R+G AV   F    K   +VVIGKDTR+SGYM E++
Sbjct: 2   RKYFGTDGVRGKANEFPMTATFALRLGQAVAKQFSNGGKKIHKVVIGKDTRVSGYMFESA 61

Query: 62  LVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKV 121
           LV+G T+ G+DA ++G +P+PA++ +TRSLRAD GV+ISASHNPY DNGIK F  DGYK+
Sbjct: 62  LVSGITSMGLDAVLVGVLPTPAISFITRSLRADAGVVISASHNPYYDNGIKFFSGDGYKL 121

Query: 122 STDIEDRIETLLEDDLT--SYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRI 179
             + E  IE   ++ +         D IG A RVD    RY+E  K T  +D+ L G+R+
Sbjct: 122 PDETEISIEQTTDEMIQNGEIPISTDRIGKAYRVDTAIGRYVEFSKSTFDKDIDLSGMRL 181

Query: 180 VVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIG 239
           VVDC+NGA+YKVAP  F EL A + V+G++P+G+NIN  CGS    ++  KV E  AD+G
Sbjct: 182 VVDCSNGANYKVAPMAFEELAAKINVMGNEPDGMNINSGCGSVYPEAMCAKVKEKGADLG 241

Query: 240 IALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAG 299
           I+ DGDGDRVI  DE G +V+GD IM + A+   S   L  N +V TVMSN G E+ +  
Sbjct: 242 ISFDGDGDRVIFSDENGEMVDGDIIMGICAKYMNSLGYLNKNTMVCTVMSNFGFEKSMLE 301

Query: 300 LGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYD 359
            G+ L RT+VGDRY+M  M  NG+N+GGEQSGHII SDY +TGDGLV+A+Q+L+ I +  
Sbjct: 302 AGVKLVRTDVGDRYVMAEMLKNGYNLGGEQSGHIIFSDYNTTGDGLVSAMQLLKVIVRSG 361

Query: 360 KPVSTICHCFEEYPQFLRSVSVKDTSILNSSSIV-QAIADAESELRGIDRLIVRASGTES 418
           KP+S +      YPQ L++  V+    ++      + I     EL G  R++VR SGTE+
Sbjct: 362 KPLSELKKFITLYPQVLKNFKVQKKIPVDYLERTSKEIQAVNKELDGTGRVLVRYSGTEN 421

Query: 419 LIRIMAEGDDLSRIKRIVDDL-AKVIPMID 447
            +R+M EG+DLSRI    +++ A  +  I+
Sbjct: 422 KLRVMLEGEDLSRITEYAENIGANAVKEIE 451


>gi|217972666|ref|YP_002357417.1| phosphoglucosamine mutase [Shewanella baltica OS223]
 gi|217497801|gb|ACK45994.1| phosphoglucosamine mutase [Shewanella baltica OS223]
          Length = 450

 Score =  263 bits (671), Expect = 5e-68,   Method: Composition-based stats.
 Identities = 204/451 (45%), Positives = 289/451 (64%), Gaps = 8/451 (1%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M R++FGTDG+RGK   FPI P+F M++G A G +       + V+IGKDTR SGYMLE+
Sbjct: 1   MSRKYFGTDGVRGKVGEFPINPDFAMKLGWAAGTVLAS-MGTKEVLIGKDTRSSGYMLES 59

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           ++ AGF+AAG++  ++GP+P+PAVA L  + RAD GV+ISASHNP+ DNGIK F   G K
Sbjct: 60  AMEAGFSAAGVNVALIGPMPTPAVAYLASTFRADAGVVISASHNPFYDNGIKFFSNSGTK 119

Query: 121 VSTDIEDRIETLLEDDLTSYLSC---YDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGL 177
           ++   E  IE LLE  L          +++G  +R+D    RYIE  K T P  ++L GL
Sbjct: 120 LNDAQELEIEALLEKALNQNAMQCVASENLGKVRRIDDAAGRYIEFCKGTFPNHLSLTGL 179

Query: 178 RIVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRAD 237
           +IVVD A+GA+Y +AP V+ ELGA+V+ I DKPNG+NIN  CG+T++ SLQ  V    AD
Sbjct: 180 KIVVDSAHGAAYHIAPNVYRELGAEVISINDKPNGVNINDHCGATHLDSLQTAVMVHEAD 239

Query: 238 IGIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFI 297
           +GIALDGD DRV+ VD  G +V+GD+I+ ++A    S   + G  + T  MSN+GLE  +
Sbjct: 240 LGIALDGDADRVMFVDHNGHVVDGDEILFILAHAAHSKGEMTGGVVGTL-MSNLGLELAL 298

Query: 298 AGLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQ 357
             + +   R +VGDRY++E +K  G+ +GGE SGHI+   + STGDG+VA+LQVL+ + +
Sbjct: 299 KQMDIPFLRAKVGDRYVVEQLKATGWQLGGEGSGHILSLQHASTGDGIVASLQVLKAVLE 358

Query: 358 YDKPVSTICHCFEEYPQFLRSVSV---KDTSILNSSSIVQAIADAESELRGIDRLIVRAS 414
             K +S I     + PQ L +V +      SIL ++S+ QA+  AE  L    R+++R S
Sbjct: 359 SQKSLSEIKAGMTKLPQVLINVRLATADADSILATASVQQAVIKAEGILGDRGRVLLRKS 418

Query: 415 GTESLIRIMAEGDDLSRIKRIVDDLAKVIPM 445
           GTE LIR+M E  D    +   + +A V+  
Sbjct: 419 GTEPLIRVMVESTDNIMTQTQAEYIADVVRA 449


>gi|254509672|ref|ZP_05121739.1| phosphoglucosamine mutase [Rhodobacteraceae bacterium KLH11]
 gi|221533383|gb|EEE36371.1| phosphoglucosamine mutase [Rhodobacteraceae bacterium KLH11]
          Length = 447

 Score =  263 bits (671), Expect = 5e-68,   Method: Composition-based stats.
 Identities = 232/446 (52%), Positives = 309/446 (69%), Gaps = 4/446 (0%)

Query: 3   RRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKH-RRVVIGKDTRLSGYMLENS 61
           R+ FGTDG+RG +NT P+T    +RIG AVG  FR       RVVIGKDTRLSGYMLEN+
Sbjct: 2   RKLFGTDGVRGTANTHPMTAEMALRIGAAVGRYFRRDASGVHRVVIGKDTRLSGYMLENA 61

Query: 62  LVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKV 121
           L AG T+ GM+  +LGP+P+PAV ++TRS+RAD+GVMISASHNP +DNGIK FGPDG+K+
Sbjct: 62  LTAGLTSTGMNVLLLGPVPTPAVGLMTRSMRADLGVMISASHNPAEDNGIKFFGPDGFKL 121

Query: 122 STDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVV 181
           S   E  IE L+E+ ++       +IG A+RVD    RY E VK +LPRDV L GL++V+
Sbjct: 122 SDQAEVEIERLIEEGVSPA--QAQNIGRARRVDDARFRYGERVKSSLPRDVRLDGLKVVI 179

Query: 182 DCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIA 241
           DCANGA+++ APEV WELGADV+ IG  P+G NINL CGST        V    AD+GI 
Sbjct: 180 DCANGAAHRTAPEVLWELGADVIPIGTAPDGKNINLGCGSTQPRVAAETVVAHGADVGIC 239

Query: 242 LDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLG 301
           LDGD DRV+++DE G + +GDQ+MAL+A  W     L+G  +V TVMSN+GLER +   G
Sbjct: 240 LDGDADRVVVIDETGKVADGDQLMALLASAWSKADQLKGGALVATVMSNLGLERHLTDQG 299

Query: 302 LSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKP 361
           L L+RT VGDRY++E M+  GFN+GGEQSGHI++SDY +TGDGL+A L  L  +   D+ 
Sbjct: 300 LRLERTAVGDRYVVERMRAGGFNLGGEQSGHIVMSDYATTGDGLMAGLHFLAEMVLSDRK 359

Query: 362 VSTICHCFEEYPQFLRSVSVK-DTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
            S +   FE  PQ L++V      + L ++++  AI +AE+ L G  RL++R SGTE LI
Sbjct: 360 ASELSRQFETVPQLLKNVRFTAGQAPLEAANVKSAITEAEARLNGQGRLLIRKSGTEPLI 419

Query: 421 RIMAEGDDLSRIKRIVDDLAKVIPMI 446
           R+MAE +D + + ++VD +   +  +
Sbjct: 420 RVMAECEDAALLTQVVDGIVAEVEAV 445


>gi|329770208|ref|ZP_08261598.1| phosphoglucosamine mutase [Gemella sanguinis M325]
 gi|328837014|gb|EGF86658.1| phosphoglucosamine mutase [Gemella sanguinis M325]
          Length = 447

 Score =  263 bits (671), Expect = 5e-68,   Method: Composition-based stats.
 Identities = 185/444 (41%), Positives = 283/444 (63%), Gaps = 4/444 (0%)

Query: 3   RRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSL 62
           R++FGTDGIRG +    +T +   ++G A+G L   KK   +V+IG+DTR+S  M+E SL
Sbjct: 2   RKYFGTDGIRGVAGE-TLTADLSFKVGKALGKLLTDKKDRPKVIIGRDTRISCDMIEYSL 60

Query: 63  VAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVS 122
            AG T+ G+D   +G IP+PA+A LT+++  D G+MISASHNPYQDNGIK+FGPDG+K++
Sbjct: 61  TAGLTSVGVDVMTVGVIPTPAIAYLTKTIETDSGIMISASHNPYQDNGIKIFGPDGFKLT 120

Query: 123 TDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVVD 182
            + E  IE L+++      + Y+ IG+      +  +YI+H+K+++     L G++I +D
Sbjct: 121 DEQEIEIEHLIDNVEQIKAASYEHIGNLYSGSELSQKYIQHIKQSISD--DLSGIKIALD 178

Query: 183 CANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIAL 242
           CA+GA+  VAP +F +L AD+  IG  P G NIN + GST + ++   V     D+G A 
Sbjct: 179 CAHGATTGVAPFLFGDLEADIETIGCAPTGTNINDNVGSTKINTIAEFVKVHNVDLGFAF 238

Query: 243 DGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLGL 302
           DGDGDRV+ VD +G +V+GD+IM ++A+       L+ N +V+TVMSNIG  + +   G+
Sbjct: 239 DGDGDRVLAVDSEGNVVDGDKIMFILAKHLKEQGELKDNMVVSTVMSNIGFYKAVEEHGM 298

Query: 303 SLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKPV 362
              +T VGDRY++E M+NN +++GGEQSGHIIL +Y +TGDG++ A+++   IK   K +
Sbjct: 299 QSVKTSVGDRYVVEEMRNNNYSLGGEQSGHIILMNYATTGDGILTAVKLADIIKTTGKSL 358

Query: 363 STICHCFEEYPQFLRSVSVKDTSI-LNSSSIVQAIADAESELRGIDRLIVRASGTESLIR 421
             +      YPQ L ++ V D  I +    I++     E EL G  R+++RASGTE+LIR
Sbjct: 359 KELADEVSIYPQKLVNIKVTDKKIAMEDKEILEECEKVEKELEGNGRILLRASGTENLIR 418

Query: 422 IMAEGDDLSRIKRIVDDLAKVIPM 445
           +M E        +  + +AK++  
Sbjct: 419 VMVEASSDELTDKYCEQVAKIVRK 442


>gi|323138987|ref|ZP_08074047.1| phosphoglucosamine mutase [Methylocystis sp. ATCC 49242]
 gi|322395741|gb|EFX98282.1| phosphoglucosamine mutase [Methylocystis sp. ATCC 49242]
          Length = 448

 Score =  262 bits (670), Expect = 5e-68,   Method: Composition-based stats.
 Identities = 255/445 (57%), Positives = 332/445 (74%), Gaps = 2/445 (0%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M R +FGTDGIRG +N   ITP   +++G A G +F   +   RVVIGKDTRLSGYM+E 
Sbjct: 1   MTRTYFGTDGIRGLANVK-ITPELALKVGQAAGLIFHRGEGRHRVVIGKDTRLSGYMIEY 59

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +LVAGFT+ GMD  +LGP+P+PAVAMLTRS+RADVGVMISASHN Y+DNGIKLFGPDG+K
Sbjct: 60  ALVAGFTSVGMDPLLLGPMPTPAVAMLTRSMRADVGVMISASHNSYEDNGIKLFGPDGHK 119

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +S  IE  IE L++ DLT  L+    +G A+R+D V  RYIE  KRTLPR+++ +GLR+V
Sbjct: 120 LSDSIEMEIEKLIDGDLTRKLAGPTELGRARRIDDVRARYIEFAKRTLPRNMSFEGLRVV 179

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           +DCANGA+YKVAPE  WELGA+V+ IG +P+G NIN D GST+  +L+ KV E+RAD+GI
Sbjct: 180 IDCANGAAYKVAPEALWELGAEVIAIGVEPDGFNINRDVGSTSPQALREKVRELRADVGI 239

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           ALDGD DRVI+VDE+G +++GDQ+MA++A  W    LL   G+V T+MSN+GLER ++ L
Sbjct: 240 ALDGDADRVIMVDERGQVIDGDQLMAVVAESWRDQGLLAKPGLVATIMSNLGLERHLSSL 299

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           GL+L+RT VGDRY++E M+  G+NVGGEQSGH+ILSD+ +TGDGLV A+QVL  +K+  +
Sbjct: 300 GLTLERTAVGDRYVIERMRQAGYNVGGEQSGHVILSDFSTTGDGLVTAMQVLAEVKRQQR 359

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
            VS +CHCFE  PQ L++V  +    L   S+V AI  A   L G  RLIVRASGTE +I
Sbjct: 360 RVSDVCHCFEPLPQVLKNVRAQ-KRTLEKDSVVMAIDSARERLNGSGRLIVRASGTEPVI 418

Query: 421 RIMAEGDDLSRIKRIVDDLAKVIPM 445
           R+M EGDD   ++ +V  +   +  
Sbjct: 419 RVMGEGDDPDLVETLVSQVCNALKE 443


>gi|329767715|ref|ZP_08259232.1| phosphoglucosamine mutase [Gemella haemolysans M341]
 gi|328838953|gb|EGF88545.1| phosphoglucosamine mutase [Gemella haemolysans M341]
          Length = 447

 Score =  262 bits (670), Expect = 6e-68,   Method: Composition-based stats.
 Identities = 190/444 (42%), Positives = 288/444 (64%), Gaps = 4/444 (0%)

Query: 3   RRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSL 62
           R++FGTDGIRG +    +T +   ++G A+G L   KK+H +V+IG+DTR+S  M+E +L
Sbjct: 2   RKYFGTDGIRGIAGE-SLTADLSFKVGKALGKLLTEKKEHPKVIIGRDTRISCDMIEQAL 60

Query: 63  VAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVS 122
            AG T+ G++   +G IP+PA+A LT+++  D G+MISASHNPYQDNGIK+FGPDG+K++
Sbjct: 61  TAGLTSTGVNVMTVGTIPTPAIAYLTKTIETDSGIMISASHNPYQDNGIKIFGPDGFKLT 120

Query: 123 TDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVVD 182
            D E  IE L+++      + ++ IG     + +  +Y++H+K+++     L G++I +D
Sbjct: 121 DDQELEIEHLIDNSDEIKNASFEKIGKLYSGNELTQKYVQHIKQSISG--DLSGIKIALD 178

Query: 183 CANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIAL 242
           CANGA+  VAP +F +L AD+  IG  PNGININ + GST + ++   V E   D+G A 
Sbjct: 179 CANGATTGVAPFIFGDLEADIETIGCNPNGININDNVGSTKINTIANFVKENNVDVGFAF 238

Query: 243 DGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLGL 302
           DGDGDRV+ VD KG IV+GD+IM ++A+       L+ N +V+TVMSNIG  + I   GL
Sbjct: 239 DGDGDRVLAVDSKGNIVDGDKIMFILAKHLKEQGELKDNMVVSTVMSNIGFYKAIEENGL 298

Query: 303 SLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKPV 362
              +T VGDRY++E M+NN +++GGEQSGHIIL +Y +TGDG++ A+++   IK   K +
Sbjct: 299 QSVKTAVGDRYVVEEMRNNDYSLGGEQSGHIILMNYATTGDGILTAVKLADIIKSSGKSL 358

Query: 363 STICHCFEEYPQFLRSVSVKDTS-ILNSSSIVQAIADAESELRGIDRLIVRASGTESLIR 421
             + +    YPQ L ++ V D    +  + I+      E EL G  R+++RASGTE+LIR
Sbjct: 359 EELANEVSIYPQKLVNIKVVDKKSAMEDAEILAECEKVEKELEGNGRILLRASGTENLIR 418

Query: 422 IMAEGDDLSRIKRIVDDLAKVIPM 445
           +M E        +  + +AK++  
Sbjct: 419 VMVEASSDELTDKYCEQVAKIVRE 442


>gi|163854234|ref|YP_001642277.1| phosphoglucosamine mutase [Methylobacterium extorquens PA1]
 gi|218533180|ref|YP_002423996.1| phosphoglucosamine mutase [Methylobacterium chloromethanicum CM4]
 gi|240141695|ref|YP_002966175.1| phosphoglucosamine mutase [Methylobacterium extorquens AM1]
 gi|254564203|ref|YP_003071298.1| phosphoglucosamine mutase [Methylobacterium extorquens DM4]
 gi|226723578|sp|A9W9G7|GLMM_METEP RecName: Full=Phosphoglucosamine mutase
 gi|254798584|sp|B7KWJ1|GLMM_METC4 RecName: Full=Phosphoglucosamine mutase
 gi|163665839|gb|ABY33206.1| phosphoglucosamine mutase [Methylobacterium extorquens PA1]
 gi|218525483|gb|ACK86068.1| phosphoglucosamine mutase [Methylobacterium chloromethanicum CM4]
 gi|240011672|gb|ACS42898.1| phosphoglucosamine mutase [Methylobacterium extorquens AM1]
 gi|254271481|emb|CAX27496.1| phosphoglucosamine mutase [Methylobacterium extorquens DM4]
          Length = 446

 Score =  262 bits (670), Expect = 6e-68,   Method: Composition-based stats.
 Identities = 257/429 (59%), Positives = 331/429 (77%), Gaps = 1/429 (0%)

Query: 3   RRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSL 62
           R+ FGTDGIRG++N   ITP   +++G A G +F+      RVVIGKDTRLSGYM+E +L
Sbjct: 2   RKHFGTDGIRGRANVV-ITPELALKVGQAAGVIFQRGDHRHRVVIGKDTRLSGYMIETAL 60

Query: 63  VAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVS 122
           VAGFT+ GMD  +LGP+P+PAVAMLTRS+RAD+GVMISASHNPY+DNGIKLFGPDG+K++
Sbjct: 61  VAGFTSVGMDVLLLGPMPTPAVAMLTRSMRADIGVMISASHNPYEDNGIKLFGPDGFKLN 120

Query: 123 TDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVVD 182
            D+E  IE+L++ D+ + LS    +G AKR++ VH RYIE  KRTLPR VTL GLR+VVD
Sbjct: 121 DDLELEIESLIDGDMRNRLSASRDLGRAKRIESVHARYIEFAKRTLPRHVTLDGLRVVVD 180

Query: 183 CANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIAL 242
           CANGA+Y+VAPE  WELGA+V+ IG +P+G NIN D GST   +L +KV E+RAD+GIAL
Sbjct: 181 CANGAAYRVAPETLWELGAEVISIGVEPDGFNINHDVGSTAPETLVQKVRELRADVGIAL 240

Query: 243 DGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLGL 302
           DGD DRV+IVDEKG  V+GDQ+MA +AR W     L   G+V T+MSN+GLER+I  +GL
Sbjct: 241 DGDADRVLIVDEKGQKVDGDQLMAAVARSWQEDERLTQPGLVATIMSNLGLERYINSIGL 300

Query: 303 SLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKPV 362
           +L RT VGDRY++E+M+ +G+N+GGEQSGHII+SDY +TGDGLVAALQ+L  +K+ + PV
Sbjct: 301 TLARTAVGDRYVLEHMRQHGYNLGGEQSGHIIMSDYATTGDGLVAALQLLSVVKRRNLPV 360

Query: 363 STICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLIRI 422
           S +CHCFE  PQ L++V  +    L + S+V AIA A+  L    RL++R SGTE +IR+
Sbjct: 361 SEVCHCFEPLPQILKNVRFRSGEPLRADSVVTAIAHAKDRLGQSGRLVIRPSGTEPVIRV 420

Query: 423 MAEGDDLSR 431
           MAEGDD   
Sbjct: 421 MAEGDDRDL 429


>gi|296332139|ref|ZP_06874602.1| phosphoglucosamine mutase [Bacillus subtilis subsp. spizizenii ATCC
           6633]
 gi|305672879|ref|YP_003864550.1| phosphoglucosamine mutase [Bacillus subtilis subsp. spizizenii str.
           W23]
 gi|283824523|gb|ADB43058.1| putative phosphoglucosamine mutase [Bacillus subtilis subsp.
           spizizenii ATCC 6633]
 gi|296150631|gb|EFG91517.1| phosphoglucosamine mutase [Bacillus subtilis subsp. spizizenii ATCC
           6633]
 gi|305411122|gb|ADM36240.1| phosphoglucosamine mutase [Bacillus subtilis subsp. spizizenii str.
           W23]
          Length = 448

 Score =  262 bits (670), Expect = 6e-68,   Method: Composition-based stats.
 Identities = 184/443 (41%), Positives = 279/443 (62%), Gaps = 5/443 (1%)

Query: 4   RFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSLV 63
           ++FGTDG+RG +N   +TP    ++G   GY+    K+  +V+IG+DTR+SG+MLE +LV
Sbjct: 3   KYFGTDGVRGVAN-SELTPELAFKVGRFGGYVLTKDKQRPKVLIGRDTRISGHMLEGALV 61

Query: 64  AGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVST 123
           AG  + G +   LG I +P V+ LT+++ A+ GVMISASHNP QDNGIK FG DG+K+S 
Sbjct: 62  AGLLSIGAEVMRLGVISTPGVSYLTKAMDAEAGVMISASHNPVQDNGIKFFGGDGFKLSD 121

Query: 124 DIEDRIETLLEDDLTSYLSCYD-SIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVVD 182
           + E  IE L+++            +G          +Y++ +K+T   D T  G+ + +D
Sbjct: 122 EQEAEIERLMDEPEDRLPRPVGADLGLVNDYFEGGQKYLQFLKQTADEDFT--GIHVALD 179

Query: 183 CANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIAL 242
           CA+GA+  +A  +F +L ADV  +G  PNG+NIN   GST+  +L   V E  AD+G+A 
Sbjct: 180 CAHGATSSLATHLFADLDADVSTMGTSPNGLNINDGVGSTHPEALSAFVKEKNADLGLAF 239

Query: 243 DGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLGL 302
           DGDGDR+I VDEKG IV+GDQIM + ++   S   L+ + +V+TVMSN+G  + +   G+
Sbjct: 240 DGDGDRLIAVDEKGNIVDGDQIMYICSKHLKSEGRLKDDTVVSTVMSNLGFYKALEKEGI 299

Query: 303 SLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKPV 362
              +T VGDRY++E MK +G+NVGGEQSGH+I  DY +TGDGL++A+ ++  +K   KP+
Sbjct: 300 KSVQTAVGDRYVVEAMKKDGYNVGGEQSGHLIFLDYNTTGDGLLSAIMLMNTLKATGKPL 359

Query: 363 STICHCFEEYPQFLRSVSVKDT-SILNSSSIVQAIADAESELRGIDRLIVRASGTESLIR 421
           S +    +++PQ L +V V D   +  +  +   I++ E E+ G  R++VR SGTE L+R
Sbjct: 360 SELAAEMQKFPQLLVNVRVTDKYKVEENEKVKAVISEVEKEMNGDGRILVRPSGTEPLVR 419

Query: 422 IMAEGDDLSRIKRIVDDLAKVIP 444
           +MAE          V+ + +V+ 
Sbjct: 420 VMAEAKTKELCDEYVNRIVEVVR 442


>gi|298505917|gb|ADI84640.1| phosphoglucosamine mutase [Geobacter sulfurreducens KN400]
          Length = 451

 Score =  262 bits (670), Expect = 6e-68,   Method: Composition-based stats.
 Identities = 209/445 (46%), Positives = 292/445 (65%), Gaps = 2/445 (0%)

Query: 3   RRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSL 62
           ++ FGTDG+RG +N +P+T    M+IG A  YLF+   +  R+VIGKDTRLSGYMLEN+L
Sbjct: 2   KKLFGTDGVRGVANVYPMTTEMAMQIGRAAAYLFKDGNRRHRIVIGKDTRLSGYMLENAL 61

Query: 63  VAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVS 122
           VAG  + G+D  ++GP+P+P +A +T S+RAD GV+ISASHNP+QDNGIK F  DG+K+ 
Sbjct: 62  VAGICSMGVDVLVVGPLPTPGIANITSSMRADAGVVISASHNPFQDNGIKFFSRDGFKLP 121

Query: 123 TDIEDRIETLL-EDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVV 181
            ++E +IE L+    + S       +G A R+D    RY+  +K + P+D+ L G++IV+
Sbjct: 122 DEMELKIEDLIFSGKIDSLRPVATEVGKAYRIDDAVGRYVVFLKNSFPKDLDLAGMKIVL 181

Query: 182 DCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIA 241
           DCANGA+YKVAP V  ELGA+V+  G KPNG NIN  CGS     +   V E RAD+GIA
Sbjct: 182 DCANGAAYKVAPAVLEELGAEVIPYGVKPNGTNINAGCGSLYPQVISEAVKEHRADLGIA 241

Query: 242 LDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLG 301
           LDGD DRVI VDE G  V+GD IMA+ A + +    LR N +V TVMSN+GL+  +   G
Sbjct: 242 LDGDADRVIFVDEFGNEVDGDHIMAICATQMLKQKKLRKNTLVATVMSNMGLDIAVKRAG 301

Query: 302 LSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKP 361
             + +T VGDRY++E M   G+N+GGEQSGH+I  D+ +TGDG+++ALQVL  +++ DK 
Sbjct: 302 GKVVKTAVGDRYVVEEMIKGGYNLGGEQSGHMIFLDHNTTGDGVLSALQVLATMRRADKS 361

Query: 362 VSTICHCFEEYPQFLRSVSVKDTSIL-NSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
           +S +       PQ L +V VK+   +     +   I D E +L    R+++R SGTE L+
Sbjct: 362 LSELAEVMIPLPQVLVNVRVKEKKDITTIPEVALLIGDIEKKLGDEGRILIRYSGTEPLL 421

Query: 421 RIMAEGDDLSRIKRIVDDLAKVIPM 445
           RIM EG D  +I     ++A ++  
Sbjct: 422 RIMLEGQDKYQITGWAKEIADLVEK 446


>gi|186475646|ref|YP_001857116.1| phosphoglucosamine mutase [Burkholderia phymatum STM815]
 gi|226722719|sp|B2JFP2|GLMM_BURP8 RecName: Full=Phosphoglucosamine mutase
 gi|184192105|gb|ACC70070.1| phosphoglucosamine mutase [Burkholderia phymatum STM815]
          Length = 452

 Score =  262 bits (670), Expect = 6e-68,   Method: Composition-based stats.
 Identities = 193/455 (42%), Positives = 282/455 (61%), Gaps = 10/455 (2%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRG------KKKHRRVVIGKDTRLS 54
           M RR+FGTDGIRGK    PITP+F++R+G A G +  G            V+IGKDTR+S
Sbjct: 1   MARRYFGTDGIRGKVGDPPITPDFVLRLGYAAGKVLAGADTWAKTGSRPTVLIGKDTRVS 60

Query: 55  GYMLENSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLF 114
           GYMLE +L +GF+AAG+D  + GP+P+P VA LTR+LR   GV+ISASHNPY DNGIK F
Sbjct: 61  GYMLEAALESGFSAAGVDVMLAGPMPTPGVAYLTRALRLAAGVVISASHNPYYDNGIKFF 120

Query: 115 GPDGYKVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTL 174
             DG K+  ++E +IE  L+  L       + +G A+R+D    RYIE  K T P+   L
Sbjct: 121 SADGNKLPDEVESQIEEQLDKPLECAP--SERLGKARRLDDAAGRYIEFCKGTFPQAFDL 178

Query: 175 QGLRIVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEV 234
           +G+++VVDCA+GA+Y VAP VF ELGADV+ IG  PNG NIN   G+T   +L R V   
Sbjct: 179 RGMKLVVDCAHGAAYDVAPHVFHELGADVITIGVSPNGFNINDGVGATAPDALVRAVRAN 238

Query: 235 RADIGIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLE 294
           +AD+G+ALDGD DR+ IVD  G + NGD+++ ++ ++ ++        + T  M+N+ +E
Sbjct: 239 KADLGVALDGDADRLQIVDANGRLYNGDELLYVLVQDRIATQGKVDGAVGTL-MTNMAVE 297

Query: 295 RFIAGLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRY 354
             +   G+   R  VGDRY++E ++ +G+ +G E SGHI+  D  STGDG+V+AL VL  
Sbjct: 298 VALKNKGVQFVRAAVGDRYVLEKLREHGWELGAEGSGHILSLDRHSTGDGIVSALLVLAA 357

Query: 355 IKQYDKPVSTICHCFEEYPQFLRSVSVKDTSILNS-SSIVQAIADAESELRGIDRLIVRA 413
           +++  + +  +      +PQ L +V ++  +      +I +AI +AE  L G  R+++RA
Sbjct: 358 MQRSGRSLEQLLEGVTLFPQKLINVRMQPGADWKGNDAIRRAINEAEGALDGSGRVLIRA 417

Query: 414 SGTESLIRIMAEGDDLSRIKRIVDDLAKVIPMIDS 448
           SGTE ++R+M E           + +A V+    S
Sbjct: 418 SGTEPVLRVMVEAAHEKDAVHHAERIATVVKQATS 452


>gi|291482552|dbj|BAI83627.1| hypothetical protein BSNT_00347 [Bacillus subtilis subsp. natto
           BEST195]
          Length = 448

 Score =  262 bits (670), Expect = 6e-68,   Method: Composition-based stats.
 Identities = 184/443 (41%), Positives = 279/443 (62%), Gaps = 5/443 (1%)

Query: 4   RFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSLV 63
           ++FGTDG+RG +N   +TP    ++G   GY+    K+  +V+IG+DTR+SG+MLE +LV
Sbjct: 3   KYFGTDGVRGVAN-SELTPELAFKVGRFGGYVLTKDKQRPKVLIGRDTRISGHMLEGALV 61

Query: 64  AGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVST 123
           AG  + G +   LG I +P V+ LT+++ A+ GVMISASHNP QDNGIK FG DG+K+S 
Sbjct: 62  AGLLSIGAEVMRLGVISTPGVSYLTKAMDAEAGVMISASHNPVQDNGIKFFGGDGFKLSD 121

Query: 124 DIEDRIETLLEDDLTSYLSCYD-SIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVVD 182
           + E  IE L+++            +G          +Y++ +K+T   D T  G+ + +D
Sbjct: 122 EQEAEIERLMDEPEDKLPRPVGADLGLVNDYFEGGQKYLQFLKQTADEDFT--GIHVALD 179

Query: 183 CANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIAL 242
           CA+GA+  +A  +F +L ADV  +G  PNG+NIN   GST+  +L   V E  AD+G+A 
Sbjct: 180 CAHGATSSLATHLFADLDADVSTMGTSPNGLNINDGVGSTHPEALSAFVKEKNADLGLAF 239

Query: 243 DGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLGL 302
           DGDGDR+I VDEKG IV+GDQIM + ++   S   L+ + +V+TVMSN+G  + +   G+
Sbjct: 240 DGDGDRLIAVDEKGNIVDGDQIMYICSKHLKSEGRLKDDTLVSTVMSNLGFYKALEKEGI 299

Query: 303 SLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKPV 362
              +T VGDRY++E MK +G+NVGGEQSGH+I  DY +TGDGL++A+ ++  +K   KP+
Sbjct: 300 KSVQTAVGDRYVVEAMKKDGYNVGGEQSGHLIFLDYNTTGDGLLSAIMLMNTLKATGKPL 359

Query: 363 STICHCFEEYPQFLRSVSVKDT-SILNSSSIVQAIADAESELRGIDRLIVRASGTESLIR 421
           S +    +++PQ L +V V D   +  +  +   I++ E E+ G  R++VR SGTE L+R
Sbjct: 360 SELAAEMQKFPQLLVNVRVTDKYKVEENEKVKAVISEVEKEMNGDGRILVRPSGTEPLVR 419

Query: 422 IMAEGDDLSRIKRIVDDLAKVIP 444
           +MAE          V+ + +V+ 
Sbjct: 420 VMAEAKTKELCDEYVNRIVEVVR 442


>gi|307730489|ref|YP_003907713.1| phosphoglucosamine mutase [Burkholderia sp. CCGE1003]
 gi|307585024|gb|ADN58422.1| phosphoglucosamine mutase [Burkholderia sp. CCGE1003]
          Length = 452

 Score =  262 bits (670), Expect = 6e-68,   Method: Composition-based stats.
 Identities = 200/450 (44%), Positives = 283/450 (62%), Gaps = 10/450 (2%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLF------RGKKKHRRVVIGKDTRLS 54
           M RR+FGTDGIRGK    PITP F++R+G A G +               V+IGKDTR+S
Sbjct: 1   MARRYFGTDGIRGKVGEGPITPEFVLRLGYAAGKVLVGADRWARTGTRPTVLIGKDTRVS 60

Query: 55  GYMLENSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLF 114
           GYMLE +L AGF+AAG+D  + GP+P+P +A LTR+LR   GV+ISASHNPY DNGIK F
Sbjct: 61  GYMLEAALEAGFSAAGVDVMLAGPMPTPGIAYLTRALRLAAGVVISASHNPYYDNGIKFF 120

Query: 115 GPDGYKVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTL 174
             DG K+  D+E +IE  LE  L    +  + +G A+R+D    RYIE  K T P    L
Sbjct: 121 SADGNKLPDDVESQIEEQLE--LPLACAASEQLGKARRLDDAAGRYIEFCKSTFPATFDL 178

Query: 175 QGLRIVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEV 234
           +GL++VVDCA+GA+Y VAP VF ELGA+V+ IG  PNG NIN   G+T   +L R V   
Sbjct: 179 RGLKLVVDCAHGAAYDVAPHVFHELGAEVIPIGVAPNGFNINDGVGATAPDALVRAVRAN 238

Query: 235 RADIGIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLE 294
            AD+GIALDGD DR+ +VD  G + NGD+++ ++ ++ ++        + T  M+N+ +E
Sbjct: 239 HADLGIALDGDADRLQVVDAAGRLYNGDELLYVLVKDRIATDGKVEGAVGTL-MTNMAVE 297

Query: 295 RFIAGLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRY 354
             +   G+   R  VGDRY++E ++ +G+ +G E SGHI+  D  STGDG+V+AL VL  
Sbjct: 298 VALQAAGVKFVRAAVGDRYVLEQLREHGWQLGAEGSGHILSLDRHSTGDGIVSALLVLAA 357

Query: 355 IKQYDKPVSTICHCFEEYPQFLRSVSVK-DTSILNSSSIVQAIADAESELRGIDRLIVRA 413
           +K+ DK ++ +      +PQ L +V +K D     S +I +AIA AE  L G  R+++RA
Sbjct: 358 MKRSDKTLAELLDGVTLFPQKLINVRMKPDADWKGSDAIRRAIASAEDALNGRGRVLIRA 417

Query: 414 SGTESLIRIMAEGDDLSRIKRIVDDLAKVI 443
           SGTE ++R+M E + +    R  + +A  +
Sbjct: 418 SGTEPVLRVMVEAEQVDDAVRHAEAIAAAV 447


>gi|126741348|ref|ZP_01757024.1| phosphoglucosamine mutase [Roseobacter sp. SK209-2-6]
 gi|126717553|gb|EBA14279.1| phosphoglucosamine mutase [Roseobacter sp. SK209-2-6]
          Length = 453

 Score =  262 bits (670), Expect = 7e-68,   Method: Composition-based stats.
 Identities = 229/445 (51%), Positives = 308/445 (69%), Gaps = 4/445 (0%)

Query: 3   RRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKH-RRVVIGKDTRLSGYMLENS 61
           R+FFGTDG+RG +N  P+T    +RIG AVG  FR +     RVVIGKDTRLSGYM EN+
Sbjct: 2   RKFFGTDGVRGTANIHPMTAEMALRIGAAVGRYFRREAGGVHRVVIGKDTRLSGYMFENA 61

Query: 62  LVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKV 121
           L AG T+ GM+  +LGP+P+PAV ++TRS+RAD+GVMISASHNP QDNGIK FGPDG+K+
Sbjct: 62  LTAGLTSTGMNVLLLGPVPTPAVGLMTRSMRADLGVMISASHNPAQDNGIKFFGPDGFKL 121

Query: 122 STDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVV 181
           S   E  IE L+E+ +        +IG AKR+D    RY E VK +LPR + L GL++V+
Sbjct: 122 SDQAELEIEALIENGVAPA--QPQNIGRAKRIDDARFRYGERVKSSLPRGIRLDGLKVVL 179

Query: 182 DCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIA 241
           DCANGA++++APEV WELGADVV +G  P+G+NIN DCGST   +    V   RAD+GI 
Sbjct: 180 DCANGAAHRIAPEVLWELGADVVPLGIAPDGVNINHDCGSTKPEAAAATVVAHRADVGIC 239

Query: 242 LDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLG 301
           LDGD DRVI++DE G + +GDQ+MAL+A  W    LL  N +V TVMSN+GLER +   G
Sbjct: 240 LDGDADRVILIDENGQVADGDQLMALLAGRWAKADLLAQNTLVATVMSNLGLERCLEAQG 299

Query: 302 LSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKP 361
           L L RT VGDRY++E M+  G+N+GGEQSGHI++SD+ +TGDGL+A L +L  + +  + 
Sbjct: 300 LKLARTAVGDRYVVEEMRAKGYNLGGEQSGHIVMSDHATTGDGLMAGLHMLAAMVETGEK 359

Query: 362 VSTICHCFEEYPQFLRSVSVK-DTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
            S + + F   PQ L++   +   + L  +++ QAI+ AE  L G  RL++R SGTE LI
Sbjct: 360 ASQLLNQFTPVPQLLKNTRFERGQTPLEDAAVQQAISAAEQALNGQGRLLIRKSGTEPLI 419

Query: 421 RIMAEGDDLSRIKRIVDDLAKVIPM 445
           R+MAE +D   +++ VD +   +  
Sbjct: 420 RVMAECEDAVLLEQTVDQVVAAVEA 444


>gi|270158117|ref|ZP_06186774.1| phosphoglucosamine mutase [Legionella longbeachae D-4968]
 gi|289163618|ref|YP_003453756.1| phosphoglucomutase [Legionella longbeachae NSW150]
 gi|269990142|gb|EEZ96396.1| phosphoglucosamine mutase [Legionella longbeachae D-4968]
 gi|288856791|emb|CBJ10602.1| putative phosphoglucomutase [Legionella longbeachae NSW150]
          Length = 451

 Score =  262 bits (670), Expect = 7e-68,   Method: Composition-based stats.
 Identities = 202/447 (45%), Positives = 288/447 (64%), Gaps = 5/447 (1%)

Query: 2   KRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENS 61
           +R++FGTDGIRG      I P F++++G A+G +       ++VVIGKDTR+SGYMLE++
Sbjct: 3   QRKYFGTDGIRGHVGLSNINPEFVLKLGWAIGQVLAN-GHRKKVVIGKDTRVSGYMLESA 61

Query: 62  LVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKV 121
           L AG +AAG+D  +LGP+P+P +A LT++LRA+ G++ISASHN ++DNGIK F  +G K+
Sbjct: 62  LEAGLSAAGVDVALLGPMPTPGIAYLTQTLRANAGIVISASHNQFEDNGIKFFSAEGGKL 121

Query: 122 STDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVV 181
              +E  IE  LE  + +     + +G A R++    RYIE  K T+P    L GL++VV
Sbjct: 122 PDSVELAIEEELEKKMQTVP--SEKLGKATRINDATGRYIEFCKSTIPSLTRLSGLKVVV 179

Query: 182 DCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIA 241
           DCANGA+Y VAP VF ELGA V+ I ++P+G NIN +CGST+   L++KV    ADIGI 
Sbjct: 180 DCANGATYHVAPNVFAELGAQVISIANRPDGFNINDNCGSTSPELLRQKVISTGADIGIG 239

Query: 242 LDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLG 301
           LDGDGDR I++D +G IVNGDQI+ +IA++      +   GIV T+MSN GLER +  LG
Sbjct: 240 LDGDGDRAILIDSEGNIVNGDQILYIIAKDRHQR-GVLHGGIVGTLMSNYGLERALKELG 298

Query: 302 LSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKP 361
           +   R++VGDRY++E +  N + +GGE SGHI+  D  +TGDG+VAALQVL  + +  K 
Sbjct: 299 VPFIRSKVGDRYVLEALHKNDWKIGGEPSGHIVCLDKTTTGDGIVAALQVLSMMVKQGKT 358

Query: 362 VSTICHCFEEYPQFLRSVSVKDTSILNS-SSIVQAIADAESELRGIDRLIVRASGTESLI 420
           +  +       PQ L +        L     +++ I   E  L+G  R+++R SGTE L+
Sbjct: 359 LQQLTQGITLLPQSLVNFKTNHAERLAKNPQVIERIKALEKNLKGDGRVLLRPSGTEPLL 418

Query: 421 RIMAEGDDLSRIKRIVDDLAKVIPMID 447
           R+M EG + S +K+    L   I  ID
Sbjct: 419 RVMVEGINESLVKQYAQKLCDDIRQID 445


>gi|323341312|ref|ZP_08081556.1| phosphoglucosamine mutase [Lactobacillus ruminis ATCC 25644]
 gi|323091189|gb|EFZ33817.1| phosphoglucosamine mutase [Lactobacillus ruminis ATCC 25644]
          Length = 448

 Score =  262 bits (670), Expect = 7e-68,   Method: Composition-based stats.
 Identities = 186/446 (41%), Positives = 273/446 (61%), Gaps = 7/446 (1%)

Query: 4   RFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLF--RGKKKHRRVVIGKDTRLSGYMLENS 61
           ++FGTDG+RG +N   +TP    ++G   GY+     + K  RV++ +DTR+SG MLE +
Sbjct: 2   KYFGTDGVRGIANE-TLTPELAFKLGRCGGYVLTQHAEGKQPRVLVARDTRISGQMLEQA 60

Query: 62  LVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKV 121
           L+AG  + G++ F LG + +P VA L R   AD G+MISASHNP QDNGIK FG DGYK+
Sbjct: 61  LIAGLLSVGIEVFTLGVMTTPGVAYLVRLQDADAGIMISASHNPVQDNGIKFFGGDGYKL 120

Query: 122 STDIEDRIETLLEDDLTS-YLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           S D E+ IE LLE +         + +G          +Y++ +++T+P    L+G+ I 
Sbjct: 121 SDDQEEEIEALLEKNTDDLPRPSAEGLGTVSSYREGALKYLQFLEQTIPD--DLEGMHIA 178

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           VD ANG++  +   +F +L A+   +   P+G+NIN   GST+  +L + V E  A +G+
Sbjct: 179 VDGANGSTSNLVSRLFADLSAEFDTMATNPDGLNINKGVGSTHPEALAKFVVEQGAQVGV 238

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           A DGDGDR I VDE G IV+GD+IM +  +       L+ + IVTTVMSNIGL + +A  
Sbjct: 239 AFDGDGDRCIAVDELGNIVDGDKIMFICGKYMCERGRLKKDTIVTTVMSNIGLYKAMAKN 298

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
            L+  +T+VGDRY++E M+ +G+NVGGEQSGH++  D+ +TGDG++ ALQ+L  IKQ  K
Sbjct: 299 DLNSVKTQVGDRYVVEEMRKDGYNVGGEQSGHVVFLDFNTTGDGMLTALQLLNVIKQTGK 358

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTS-ILNSSSIVQAIADAESELRGIDRLIVRASGTESL 419
            +S +      YPQ L +V V D    L++  I  AIA  E ++    R++VR SGTE L
Sbjct: 359 KLSELAAEVTTYPQELVNVRVTDKKAALDNEVIKAAIAKVEDKMGDEGRVLVRPSGTEDL 418

Query: 420 IRIMAEGDDLSRIKRIVDDLAKVIPM 445
           +R+MAE      +   V ++  V+  
Sbjct: 419 LRVMAEAPTQELVHDYVMEIVDVVKK 444


>gi|317152971|ref|YP_004121019.1| phosphoglucosamine mutase [Desulfovibrio aespoeensis Aspo-2]
 gi|316943222|gb|ADU62273.1| phosphoglucosamine mutase [Desulfovibrio aespoeensis Aspo-2]
          Length = 450

 Score =  262 bits (670), Expect = 7e-68,   Method: Composition-based stats.
 Identities = 213/447 (47%), Positives = 297/447 (66%), Gaps = 2/447 (0%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           MK+R FGTDG+RG+ N FP+TP   +++G+A G  FR      RVVIGKDTRLSGY+ E 
Sbjct: 1   MKQRLFGTDGLRGQGNIFPMTPEIALKLGLAAGQYFRNGSGRNRVVIGKDTRLSGYVFET 60

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +L +G  A GMD F++GP+P+PA++ LTR++RAD+GV+ISASHNP+ DNGIK F  +G+K
Sbjct: 61  ALTSGLCANGMDVFLVGPLPTPAISFLTRNMRADLGVVISASHNPFMDNGIKFFDREGFK 120

Query: 121 VSTDIEDRI-ETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRI 179
           +  ++ED I E ++ +         + IG A R+     RYI ++K +    +TL GL++
Sbjct: 121 LPDEVEDEISELVMAEHPRWEYPAPEDIGKAHRIVDAQGRYIVYLKNSFSPRLTLDGLKV 180

Query: 180 VVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIG 239
           V+DCA+GA+Y VAP V  ELGA V+ IG  P+G+NIN  CGS     +   V +  ADIG
Sbjct: 181 VLDCAHGAAYGVAPMVLEELGATVIKIGVSPDGLNINHKCGSLYPEVVSNIVVDEGADIG 240

Query: 240 IALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAG 299
           IALDGD DR+I+ DEKG I++GDQIMAL A E M    L  N +V+TVMSN+ LE F+  
Sbjct: 241 IALDGDADRLIVCDEKGRILDGDQIMALSALEMMEKGRLPKNMLVSTVMSNMALELFMRQ 300

Query: 300 LGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYD 359
            G +L RT VGDRY++E M+  G  +GGEQSGH+I  D+ +TGDGL+AALQ+LR + + D
Sbjct: 301 HGGTLLRTAVGDRYVVEAMRREGARLGGEQSGHLIFMDHSTTGDGLLAALQLLRIMVEKD 360

Query: 360 KPVSTICHCFEEYPQFLRSVSVKDTSILNSSS-IVQAIADAESELRGIDRLIVRASGTES 418
           KP+S +    E +PQ LR+V V+       +  +   +A  E  L G  R+++R SGTE+
Sbjct: 361 KPLSELAGLLEPFPQMLRNVHVERKIPFAQAPGLQAEVARVEQALHGKGRVLLRYSGTEA 420

Query: 419 LIRIMAEGDDLSRIKRIVDDLAKVIPM 445
           + R+M EG DL  ++R V +L +    
Sbjct: 421 VCRVMVEGPDLDTVQRHVMELVEACEK 447


>gi|319427017|gb|ADV55091.1| phosphoglucosamine mutase [Shewanella putrefaciens 200]
          Length = 450

 Score =  262 bits (669), Expect = 7e-68,   Method: Composition-based stats.
 Identities = 205/451 (45%), Positives = 289/451 (64%), Gaps = 8/451 (1%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M R++FGTDG+RGK  TFPITP+F M++G A G +       + V+IGKDTR SGYMLE+
Sbjct: 1   MSRKYFGTDGVRGKVGTFPITPDFAMKLGWAAGTVLAS-TGTKEVLIGKDTRSSGYMLES 59

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           ++ AGF+AAG++  ++GP+P+PAVA L  + RAD GV+ISASHNPY DNGIK F   G K
Sbjct: 60  AMEAGFSAAGVNVALIGPMPTPAVAYLASTFRADAGVVISASHNPYYDNGIKFFSNTGTK 119

Query: 121 VSTDIEDRIETLLEDDLTSYLSC---YDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGL 177
           ++   E  IE LLE  L          + +G  +R+D    RYIE  K T P  ++L GL
Sbjct: 120 LNDAQEIEIEALLEQALEHNAMQCVASEKLGKVRRIDDAAGRYIEFCKGTFPNHLSLAGL 179

Query: 178 RIVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRAD 237
           +IVVD A+GA+Y +AP V+ ELGA+V+ I DKPNG+NIN  CG+T++ SLQ  V    AD
Sbjct: 180 KIVVDSAHGAAYHIAPNVYRELGAEVISINDKPNGMNINDHCGATHLDSLQSAVMIHEAD 239

Query: 238 IGIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFI 297
           +GIALDGD DRV+ VD  G +V+GD+I+ ++A+       ++G  + T  MSN+GLE  +
Sbjct: 240 LGIALDGDADRVMFVDHNGHVVDGDEILFILAQAAHQKGEMQGGVVGTL-MSNLGLELAL 298

Query: 298 AGLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQ 357
             + +   R +VGDRY++E +K  G+ +GGE SGHI+   + STGDG+VA+LQVL+ I +
Sbjct: 299 KQMDIPFVRAKVGDRYVVEQLKQTGWQLGGEGSGHILSLKHASTGDGIVASLQVLKAILE 358

Query: 358 YDKPVSTICHCFEEYPQFLRSVSVKD---TSILNSSSIVQAIADAESELRGIDRLIVRAS 414
             K ++ I     + PQ L +V +      SIL   S+ QA+  AE  L    R+++R S
Sbjct: 359 SGKRLADIKAGMSKLPQVLINVRLSSGSADSILALESVKQAVVKAEGILGDQGRVLLRKS 418

Query: 415 GTESLIRIMAEGDDLSRIKRIVDDLAKVIPM 445
           GTE LIR+M E  D    +   + +A+ +  
Sbjct: 419 GTEPLIRVMVESTDNLMTQTQAEFIAEAVRA 449


>gi|85712948|ref|ZP_01043988.1| Phosphomannomutase family enzyme [Idiomarina baltica OS145]
 gi|85693254|gb|EAQ31212.1| Phosphomannomutase family enzyme [Idiomarina baltica OS145]
          Length = 446

 Score =  262 bits (669), Expect = 7e-68,   Method: Composition-based stats.
 Identities = 192/447 (42%), Positives = 289/447 (64%), Gaps = 6/447 (1%)

Query: 1   MK-RRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLE 59
           M  R++FGTDG+RG     PITP F +++G A G +   K   R+V++GKDTR+SGYMLE
Sbjct: 1   MTERKYFGTDGVRGLVGEHPITPEFAVKLGWAAGKVLAAKG-TRKVLVGKDTRISGYMLE 59

Query: 60  NSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGY 119
           ++L AG +AAG++   LGP+P+P +A LTR+ RA  G++ISASHNPY DNGIK F  +G+
Sbjct: 60  SALEAGLSAAGVNVDFLGPMPTPGIAYLTRTFRAAAGIVISASHNPYYDNGIKFFADNGH 119

Query: 120 KVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRI 179
           K+   +E  IE L++  +       + +G A R++    RYIE  K   P  ++L G+ I
Sbjct: 120 KLPDQVELDIEHLIDQPMDCVA--SEHLGRANRINDAAGRYIEFCKSAFPSHLSLTGMHI 177

Query: 180 VVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIG 239
           VVDCA+GA+Y +AP VF ELGA V  +G +P+G+NIN +CG+T++ +LQ++V + +A +G
Sbjct: 178 VVDCAHGATYHIAPNVFRELGAKVTEVGTRPDGLNINKECGATHLDALQQEVLKQKAHVG 237

Query: 240 IALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAG 299
           IALDGDGDR+++V +KG I++GD+I+ ++    +        G+V T+MSN  LE+    
Sbjct: 238 IALDGDGDRIMMVSDKGRILDGDEILYVLMVNALRS-GTLKGGVVGTLMSNFALEQACQS 296

Query: 300 LGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYD 359
           L +   R +VGDRY++E +K N + +GGE SGHII  D+ +TGDG++A LQVL  +   D
Sbjct: 297 LDVPFIRAKVGDRYVIEQLKANDWALGGESSGHIINRDFHTTGDGILAGLQVLAAMVAED 356

Query: 360 KPVSTICHCFEEYPQFLRSVSVK-DTSILNSSSIVQAIADAESELRGIDRLIVRASGTES 418
             + T+   F++ PQ L +V        LNS  +   +A+ E+ L G  R+++R SGTE 
Sbjct: 357 SDIETLLDGFKKLPQTLVNVRYPSGADPLNSPQVKAVVAEVETALAGKGRVLLRKSGTEP 416

Query: 419 LIRIMAEGDDLSRIKRIVDDLAKVIPM 445
           +IR+M EG D   +K     +A+ +  
Sbjct: 417 VIRVMVEGADTRAVKTFAQQIAQEVEA 443


>gi|330684273|gb|EGG96012.1| phosphoglucosamine mutase [Staphylococcus epidermidis VCU121]
          Length = 451

 Score =  262 bits (669), Expect = 8e-68,   Method: Composition-based stats.
 Identities = 192/445 (43%), Positives = 275/445 (61%), Gaps = 7/445 (1%)

Query: 4   RFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKK--KHRRVVIGKDTRLSGYMLENS 61
           ++FGTDG+RG +N   +TP    ++G   GY+    K  K+ RV++G+DTR+SG MLE +
Sbjct: 3   KYFGTDGVRGVANE-ELTPELAFKLGRYGGYVLAHNKGEKNPRVLVGRDTRVSGEMLEAA 61

Query: 62  LVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKV 121
           L+AG  + G +   LG I +P VA LTR + A +GVMISASHNP  DNGIK FG DG+K+
Sbjct: 62  LIAGLISIGAEVMRLGIISTPGVAYLTREMDAGLGVMISASHNPVADNGIKFFGSDGFKL 121

Query: 122 STDIEDRIETLLEDDLTSYLSCYD-SIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           S D E+ IE LL+ D  S        I H         +Y+ ++K T+   V L+G++IV
Sbjct: 122 SDDQEEEIEALLDQDDPSLPRPVGTDIVHYSDYFEGAQKYLSYLKSTVD--VNLEGMKIV 179

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           +D ANG++  +AP +F +L AD   +G  P+G NIN  CGST+  +L  KV E  AD G+
Sbjct: 180 LDGANGSTSSLAPFLFGDLEADTETVGCSPDGYNINEKCGSTHPQALAEKVLETGADFGL 239

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           A DGDGDR+I VDEKG IV+GDQIM +I +E   +  L  N IV+TVMSN+G  + +   
Sbjct: 240 AFDGDGDRIIAVDEKGQIVDGDQIMFIIGQEMHKNQELNNNMIVSTVMSNLGFYKALENE 299

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           G+   +T+VGDRY++E M+   +N+GGEQSGHI+L DY +TGDGL+  +Q+   +K   K
Sbjct: 300 GIQSNKTKVGDRYVVEEMRRGNYNLGGEQSGHIVLMDYNTTGDGLLTGVQLAAIVKMSGK 359

Query: 361 PVSTICHCFEEYPQFLRSVSVKDT-SILNSSSIVQAIADAESELRGIDRLIVRASGTESL 419
            +S +    + YPQ L +V V D   +  +  + + +   E E+ G  R++VR SGTE L
Sbjct: 360 SLSELASQMKTYPQSLINVRVTDKYRVEENIDVKEVMTKVEVEMNGEGRILVRPSGTEPL 419

Query: 420 IRIMAEGDDLSRIKRIVDDLAKVIP 444
           +R+M E       +R    +A V+ 
Sbjct: 420 VRVMVEASTDEDAQRFAQQIADVVE 444


>gi|289579080|ref|YP_003477707.1| phosphoglucosamine mutase [Thermoanaerobacter italicus Ab9]
 gi|289528793|gb|ADD03145.1| phosphoglucosamine mutase [Thermoanaerobacter italicus Ab9]
          Length = 447

 Score =  262 bits (669), Expect = 8e-68,   Method: Composition-based stats.
 Identities = 199/447 (44%), Positives = 283/447 (63%), Gaps = 7/447 (1%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M R  FGTDG+RG +N + +TP     +G A  Y+        +VV+GKD+R+SG MLE 
Sbjct: 1   MAR-LFGTDGVRGIAN-YDLTPQLAFELGRAGAYVLTQGTHRPKVVVGKDSRISGDMLEC 58

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +L AG T+ G +   +G IP+PAVA LTR  +AD GVMISASHNP + NGIK F  DGYK
Sbjct: 59  ALTAGLTSVGAEVISVGIIPTPAVAYLTRLYQADAGVMISASHNPVEYNGIKFFDKDGYK 118

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +  ++EDRIE ++++           IG  K     H  YIE +K T+     L+G++IV
Sbjct: 119 LPDEVEDRIENIIKEKNELPSPIGTGIGTRKEYTNSHRDYIEFLKSTIDG--DLKGMKIV 176

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           +DCA GAS  VAP +F ELGA+V++ G +P G  IN++CGST+   LQ+ V +  ADIG+
Sbjct: 177 IDCAYGASSTVAPILFKELGAEVILYGAEPMGDKINVNCGSTHPEKLQQLVIKNGADIGL 236

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           A DGD DR+I VDEKG +++GD IMA+ A +      L+ N +V TVMSNIG E  +   
Sbjct: 237 AFDGDADRLIAVDEKGNVIDGDHIMAICAIDLKKKGRLKNNTVVATVMSNIGFEIALKEQ 296

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           G++L RT+VGDRY++E M    +++GGEQSGHII  D  +TGDG + AL++   +K+  K
Sbjct: 297 GINLIRTKVGDRYVLEEMIKGRYSIGGEQSGHIIFLDDNTTGDGEITALKLCSILKESGK 356

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTSI---LNSSSIVQAIADAESELRGIDRLIVRASGTE 417
            +S +  C   YPQ L +  VK+      L    I + I + E E++G  R+++R SGTE
Sbjct: 357 KLSELAACMVTYPQVLINAKVKNELKNAYLEDEEIKREIKNLEREMKGEGRVLIRPSGTE 416

Query: 418 SLIRIMAEGDDLSRIKRIVDDLAKVIP 444
            L+R+M EG D ++I ++  +LA++I 
Sbjct: 417 PLVRVMVEGKDYNKISQMAKELAELIE 443


>gi|212703549|ref|ZP_03311677.1| hypothetical protein DESPIG_01594 [Desulfovibrio piger ATCC 29098]
 gi|212673049|gb|EEB33532.1| hypothetical protein DESPIG_01594 [Desulfovibrio piger ATCC 29098]
          Length = 450

 Score =  262 bits (669), Expect = 8e-68,   Method: Composition-based stats.
 Identities = 218/446 (48%), Positives = 299/446 (67%), Gaps = 2/446 (0%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M  R FGTDG+RG  N +P+T +  +R+G+A G  FR      RVVIGKDTRLSGYM E+
Sbjct: 1   MAERLFGTDGLRGPVNIYPMTVDVALRLGLAAGVRFRKGSHQHRVVIGKDTRLSGYMFES 60

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +L AG  AAGM   + GP+P+PA++ LTR++RAD+GV+ISASHNPY DNGIK F  DG+K
Sbjct: 61  ALTAGLCAAGMHVIMTGPLPTPAISFLTRNMRADLGVVISASHNPYSDNGIKFFDADGFK 120

Query: 121 VSTDIEDRIETL-LEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRI 179
           +  ++E+ I  + L+ D+       + +G A +++    RYI + K   P  +TL GLRI
Sbjct: 121 LPDEVENEISAMVLDPDMRWPYPDSNRVGRASKIEDAGGRYIVYTKSCFPAHLTLSGLRI 180

Query: 180 VVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIG 239
           V+DCANGA+YKVAP    ELGA+V  +G  PNG NIN  CGS +  +L  KV EVRAD+G
Sbjct: 181 VIDCANGAAYKVAPLALEELGAEVFRLGTNPNGTNINDHCGSLHPETLAAKVREVRADVG 240

Query: 240 IALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAG 299
           +ALDGD DR+I+VDEKG +++GDQ+MAL A+  M    L GN +V T MSN+ LE F+  
Sbjct: 241 LALDGDADRLIVVDEKGNVLDGDQLMALGAQAMMERGELPGNMLVATAMSNLALEIFMKE 300

Query: 300 LGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYD 359
              +L RT+VGDRY+ME M+  G  +GGEQSGH+I   Y +TGDGL+AALQ+LR +++ +
Sbjct: 301 RAGTLLRTKVGDRYVMEAMRKTGAMLGGEQSGHLIYRQYSTTGDGLLAALQLLRIVREKE 360

Query: 360 KPVSTICHCFEEYPQFLRSVSVKDT-SILNSSSIVQAIADAESELRGIDRLIVRASGTES 418
           KP+S +      +PQ L +V V+         +I +A+AD E  L G  R+++R SGTE+
Sbjct: 361 KPLSELAGLLHLFPQKLINVRVEKKLPFEERPAIGKAVADVEKALAGRGRVLLRYSGTEA 420

Query: 419 LIRIMAEGDDLSRIKRIVDDLAKVIP 444
           L R+M E +D  ++ R   DLA V+ 
Sbjct: 421 LCRVMVEAEDEDKVVRYARDLADVVS 446


>gi|118443523|ref|YP_877248.1| phosphoglucosamine mutase [Clostridium novyi NT]
 gi|158512403|sp|A0PXZ6|GLMM_CLONN RecName: Full=Phosphoglucosamine mutase
 gi|118133979|gb|ABK61023.1| phosphoglucosamine mutase [Clostridium novyi NT]
          Length = 449

 Score =  262 bits (669), Expect = 9e-68,   Method: Composition-based stats.
 Identities = 186/449 (41%), Positives = 277/449 (61%), Gaps = 8/449 (1%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M R  FGTDG+RG +NT  +T +   ++G A  ++        ++++G DTR+SG MLE 
Sbjct: 1   MGR-LFGTDGVRGVANT-ELTADLAFKLGRAGAFVLTEGTHKPKILVGMDTRISGDMLEA 58

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +LVAG  + G +A  +G +P+PA+A LTR  +AD GV+ISASHNP + NGIK F  +GYK
Sbjct: 59  ALVAGILSVGAEAICVGVVPTPAIAYLTRKYKADAGVVISASHNPVEYNGIKFFNKNGYK 118

Query: 121 VSTDIEDRIETLLEDDLTSYL-SCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRI 179
           +  ++EDRI++++E++         +++G     +   D Y+E  K T+   V L+GL+I
Sbjct: 119 LKDELEDRIQSIIENNFEGVPSPTGENLGRKITCESAIDDYVEFAKSTID--VDLKGLKI 176

Query: 180 VVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIG 239
            +DCANGASYK + E F ELGA+VVVI + P+G+NIN +CGST+   L   V +   D+G
Sbjct: 177 ALDCANGASYKTSVETFRELGAEVVVINNDPDGVNINKNCGSTHPEELMDYVVKQGCDLG 236

Query: 240 IALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAG 299
           +A DGD DR + VDEKG +++GD IM +  +       L+ N +V TVMSN+GL      
Sbjct: 237 LAFDGDADRCLAVDEKGNLIDGDFIMTICGKHLKDQGKLKDNMVVVTVMSNLGLSLAFDK 296

Query: 300 LGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYD 359
             +S  +T+VGDRY++E M  +G+ +GGEQSGHII  DY +TGDGLV  LQ+   +K+  
Sbjct: 297 ENISTIKTKVGDRYVLEEMVKDGYKLGGEQSGHIIFLDYNTTGDGLVTGLQIASIVKETG 356

Query: 360 KPVSTICHCFEEYPQFLRSVSVKDTSI---LNSSSIVQAIADAESELRGIDRLIVRASGT 416
           K +S +     + PQ L +  V +         + I + I   E +L G  R+++R SGT
Sbjct: 357 KTLSELASIMTKLPQVLVNAKVPNNMKDIHEKDAEIAEEIKKIEEKLNGCGRVLIRPSGT 416

Query: 417 ESLIRIMAEGDDLSRIKRIVDDLAKVIPM 445
           E L+R+M EG++   + +I   LAK+I  
Sbjct: 417 EPLVRVMLEGENQEELDKIAHALAKMIEE 445


>gi|303248137|ref|ZP_07334402.1| phosphoglucosamine mutase [Desulfovibrio fructosovorans JJ]
 gi|302490536|gb|EFL50444.1| phosphoglucosamine mutase [Desulfovibrio fructosovorans JJ]
          Length = 450

 Score =  262 bits (669), Expect = 9e-68,   Method: Composition-based stats.
 Identities = 217/447 (48%), Positives = 302/447 (67%), Gaps = 2/447 (0%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M+++ FGTDG+RGK N +P+TP+ +MR+G+AVG + R   +  +V+IGKDTRLSGY+ E 
Sbjct: 1   MEKKLFGTDGLRGKVNVYPMTPDVVMRLGLAVGQVLRNGGRRHKVLIGKDTRLSGYIYEY 60

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +L +GF AAGMD  ++GP+P+PA++ LTR +RADVGV+ISASHNPY DNGIK F   G+K
Sbjct: 61  ALASGFCAAGMDVILVGPLPTPAISFLTRDMRADVGVVISASHNPYTDNGIKFFDHMGFK 120

Query: 121 VSTDIEDRIETLLED-DLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRI 179
           +   +EDRI  L+E       L   + +G A ++     RY   +K T+P DV+   ++I
Sbjct: 121 LPDAVEDRIAGLVEGCGQNWQLPAPEEVGRASKIHDSIGRYNVFLKNTVPLDVSFDNMKI 180

Query: 180 VVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIG 239
           V+DCANGA+Y+VAPEVF ELGA+VV IG +P+G NIN   GS +   + R V    ADIG
Sbjct: 181 VLDCANGAAYRVAPEVFEELGAEVVKIGVEPDGTNINRGVGSLHPEGVARAVVAHGADIG 240

Query: 240 IALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAG 299
           IALDGD DRVI+ DEKG I++GDQIMA+ A ++M    L GN +V TVMSN+ LE F+  
Sbjct: 241 IALDGDADRVIVADEKGRILDGDQIMAICALDFMERGKLPGNLLVATVMSNMALELFMKS 300

Query: 300 LGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYD 359
              +L RT VGDRY++E M+  G  +GGEQSGH+I  ++ +TGDG +AALQ++R + Q  
Sbjct: 301 HNGTLLRTPVGDRYVVEAMRGKGAVLGGEQSGHLIFLNHSTTGDGTLAALQLMRIMVQRG 360

Query: 360 KPVSTICHCFEEYPQFLRSVSVKDTSIL-NSSSIVQAIADAESELRGIDRLIVRASGTES 418
           KP+S +      +PQ L +V V          +I +A A+AE EL G  R+++R SGTES
Sbjct: 361 KPLSELATLVSPFPQELVNVPVARKIPFSEVPAIERATAEAERELAGRGRVLLRYSGTES 420

Query: 419 LIRIMAEGDDLSRIKRIVDDLAKVIPM 445
           L R+M E +D   + R+   LA+++  
Sbjct: 421 LARVMVEAEDPGLVTRLSQGLAEIVAA 447


>gi|283768726|ref|ZP_06341637.1| phosphoglucosamine mutase [Bulleidia extructa W1219]
 gi|283104512|gb|EFC05885.1| phosphoglucosamine mutase [Bulleidia extructa W1219]
          Length = 441

 Score =  262 bits (669), Expect = 9e-68,   Method: Composition-based stats.
 Identities = 181/446 (40%), Positives = 267/446 (59%), Gaps = 8/446 (1%)

Query: 4   RFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSLV 63
           ++FGTDGIRGK+N   +T +   ++G  +GY F  +KK++ +VIGKDTRLS  MLE++L 
Sbjct: 3   KYFGTDGIRGKAN-IDLTVDRAFQVGRYLGYYFSQEKKNK-IVIGKDTRLSSDMLESALA 60

Query: 64  AGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVST 123
           AG TA G D ++LG  P+PA   +  +     G MISASHNP+ DNGIK+F  +G K+S 
Sbjct: 61  AGITAQGCDVYLLGYGPTPATCYIAHNEDFACGAMISASHNPFYDNGIKVFSTEGIKISA 120

Query: 124 DIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVVDC 183
           D+E++IE  ++  +    +  D IG         + Y + V    P  + LQGL I +D 
Sbjct: 121 DLEEQIEDFIDGKVELDYATEDRIGKVYPYSEGLEHYKKWVSNRFP--LNLQGLHIAIDT 178

Query: 184 ANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIALD 243
           ANGA+   A EV   LGA V  I   PNG+NIN  CGST+   +Q  +     DIG+  D
Sbjct: 179 ANGAASYTAKEVLENLGAKVTAIHMNPNGVNINTHCGSTHPEDMQEMMKNGHYDIGLTFD 238

Query: 244 GDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLGLS 303
           GD DR IIVD  G +VNGD ++ L  +       L  + +VTTVM+N+GL +     G+ 
Sbjct: 239 GDADRQIIVDSNGHLVNGDFVLYLFGKFLRDQKKLVNHTVVTTVMANLGLFKAFEREGIK 298

Query: 304 LKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKPVS 363
             +T+VGD+Y+ E M  + + VGGEQSGHII  +Y +TGDGL+ AL VL  +++  K + 
Sbjct: 299 AVKTQVGDKYVYEEMCQHNYQVGGEQSGHIIFKEYATTGDGLLTALAVLYVMQETKKSLL 358

Query: 364 TICHCFEEYPQFLRSVSVKDT-SILNSSSIVQAIADAESELRGIDRLIVRASGTESLIRI 422
            +      YPQ L++V V++  ++L   ++ +AI ++E+ L G  R++VR SGTE L+RI
Sbjct: 359 ELEEGLVIYPQVLKNVRVENKETVLEGETLRKAIQESEARLAGNGRVLVRPSGTEPLLRI 418

Query: 423 MAEGDDLSRIKRIVDDLAKVIPMIDS 448
           M E   L   ++   ++  +I  +D+
Sbjct: 419 MVEATTLEICEK---EVETIISALDA 441


>gi|16077245|ref|NP_388058.1| phosphoglucosamine mutase [Bacillus subtilis subsp. subtilis str.
           168]
 gi|221307990|ref|ZP_03589837.1| hypothetical protein Bsubs1_01008 [Bacillus subtilis subsp.
           subtilis str. 168]
 gi|221312313|ref|ZP_03594118.1| hypothetical protein BsubsN3_01011 [Bacillus subtilis subsp.
           subtilis str. NCIB 3610]
 gi|221317246|ref|ZP_03598540.1| hypothetical protein BsubsJ_01013 [Bacillus subtilis subsp.
           subtilis str. JH642]
 gi|221321509|ref|ZP_03602803.1| hypothetical protein BsubsS_01021 [Bacillus subtilis subsp.
           subtilis str. SMY]
 gi|321313850|ref|YP_004206137.1| phosphoglucosamine mutase [Bacillus subtilis BSn5]
 gi|81556002|sp|O34824|GLMM_BACSU RecName: Full=Phosphoglucosamine mutase
 gi|2632444|emb|CAB11953.1| phosphoglucosamine mutase [Bacillus subtilis subsp. subtilis str.
           168]
 gi|320020124|gb|ADV95110.1| phosphoglucosamine mutase [Bacillus subtilis BSn5]
          Length = 448

 Score =  262 bits (668), Expect = 9e-68,   Method: Composition-based stats.
 Identities = 185/443 (41%), Positives = 279/443 (62%), Gaps = 5/443 (1%)

Query: 4   RFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSLV 63
           ++FGTDG+RG +N   +TP    ++G   GY+    K+  +V+IG+DTR+SG+MLE +LV
Sbjct: 3   KYFGTDGVRGVAN-SELTPELAFKVGRFGGYVLTKDKQRPKVLIGRDTRISGHMLEGALV 61

Query: 64  AGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVST 123
           AG  + G +   LG I +P V+ LT+++ A+ GVMISASHNP QDNGIK FG DG+K+S 
Sbjct: 62  AGLLSIGAEVMRLGVISTPGVSYLTKAMDAEAGVMISASHNPVQDNGIKFFGGDGFKLSD 121

Query: 124 DIEDRIETLLEDDLTSYLSCYD-SIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVVD 182
           + E  IE L+++            +G          +Y++ +K+T   D T  G+ + +D
Sbjct: 122 EQEAEIERLMDEPEDKLPRPVGADLGLVNDYFEGGQKYLQFLKQTADEDFT--GIHVALD 179

Query: 183 CANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIAL 242
           CANGA+  +A  +F +L ADV  +G  PNG+NIN   GST+  +L   V E  AD+G+A 
Sbjct: 180 CANGATSSLATHLFADLDADVSTMGTSPNGLNINDGVGSTHPEALSAFVKEKNADLGLAF 239

Query: 243 DGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLGL 302
           DGDGDR+I VDEKG IV+GDQIM + ++   S   L+ + +V+TVMSN+G  + +   G+
Sbjct: 240 DGDGDRLIAVDEKGNIVDGDQIMYICSKHLKSEGRLKDDTVVSTVMSNLGFYKALEKEGI 299

Query: 303 SLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKPV 362
              +T VGDRY++E MK +G+NVGGEQSGH+I  DY +TGDGL++A+ ++  +K   KP+
Sbjct: 300 KSVQTAVGDRYVVEAMKKDGYNVGGEQSGHLIFLDYNTTGDGLLSAIMLMNTLKATGKPL 359

Query: 363 STICHCFEEYPQFLRSVSVKDT-SILNSSSIVQAIADAESELRGIDRLIVRASGTESLIR 421
           S +    +++PQ L +V V D   +  +  +   I++ E E+ G  R++VR SGTE L+R
Sbjct: 360 SELAAEMQKFPQLLVNVRVTDKYKVEENEKVKAVISEVEKEMNGDGRILVRPSGTEPLVR 419

Query: 422 IMAEGDDLSRIKRIVDDLAKVIP 444
           +MAE          V+ + +V+ 
Sbjct: 420 VMAEAKTKELCDEYVNRIVEVVR 442


>gi|15807065|ref|NP_295794.1| phosphoglucosamine mutase [Deinococcus radiodurans R1]
 gi|81624790|sp|Q9RSQ3|GLMM_DEIRA RecName: Full=Phosphoglucosamine mutase
 gi|6459865|gb|AAF11621.1|AE002043_6 phosphoglucomutase and phosphomannomutase phosphoserine family
           protein [Deinococcus radiodurans R1]
          Length = 444

 Score =  262 bits (668), Expect = 1e-67,   Method: Composition-based stats.
 Identities = 190/447 (42%), Positives = 268/447 (59%), Gaps = 11/447 (2%)

Query: 1   MK-RRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLE 59
           M  R++FGTDG+R  +  FP+TP ++M +G A G +F+ +     VVIGKDTR SG MLE
Sbjct: 1   MTERKYFGTDGVRAVAGEFPLTPAWVMALGAAAGEVFKRRNPRASVVIGKDTRQSGDMLE 60

Query: 60  NSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGY 119
            +L AG T+ G++   LG +P+P V+ LTR L A+ GV+ISASHNPY+DNGIK FGP G 
Sbjct: 61  AALAAGLTSRGVNVVHLGVLPTPGVSYLTRHLGAEAGVVISASHNPYEDNGIKFFGPGGG 120

Query: 120 KVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRI 179
           K+S   E  IE  +++  T       ++G           Y   +    P    L G+RI
Sbjct: 121 KLSDATELEIEAAIDEAATLAPVTGVNLGSVTNYTEAERLYTAFLSSHAPD---LSGMRI 177

Query: 180 VVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIG 239
            +DCANGA+Y+VAP+VF + GADV  +   P+G NIN  CGST++  L+  V E   D+G
Sbjct: 178 ALDCANGAAYRVAPKVFQQAGADVFAVYTTPDGRNINRGCGSTHMDHLRLIVREGDYDLG 237

Query: 240 IALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAG 299
           IA DGD DR + VD +G +++GD ++ L AR            +V T+M+N+ LE  +  
Sbjct: 238 IAFDGDADRALFVDSRGNMIHGDHMLLLSARARGE------KAVVATIMTNMALEVKLQE 291

Query: 300 LGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYD 359
            GL+L+RT VGDRY+ E +   G N+GGEQSGH++  D   TGDG++ AL  L  +K+  
Sbjct: 292 AGLTLERTAVGDRYVHERLHAKGLNLGGEQSGHVLFLDVSPTGDGVLTALLTLSSMKKLG 351

Query: 360 KPVSTICHCFEEYPQFLRSVSVKDTSILNSS-SIVQAIADAESELRGIDRLIVRASGTES 418
             +  +      +PQ L +V VKD   + S  ++  A+ADAE +L G  R+ +R SGTE+
Sbjct: 352 TTLDALYDELVMFPQTLVNVRVKDKKAIASDPAVQHAVADAEKQLAGKGRINLRPSGTEN 411

Query: 419 LIRIMAEGDDLSRIKRIVDDLAKVIPM 445
           LIR+M EG D   I  I   +AKV+  
Sbjct: 412 LIRVMVEGQDEGEIHDIAAAVAKVVEE 438


>gi|15677538|ref|NP_274694.1| phosphoglucomutase/phosphomannomutase family protein [Neisseria
           meningitidis MC58]
 gi|81784321|sp|Q9JY89|GLMM_NEIMB RecName: Full=Phosphoglucosamine mutase
 gi|7226944|gb|AAF42038.1| phosphoglucomutase/phosphomannomutase family protein [Neisseria
           meningitidis MC58]
 gi|316984838|gb|EFV63795.1| phosphoglucosamine mutase [Neisseria meningitidis H44/76]
 gi|325140847|gb|EGC63357.1| phosphoglucosamine mutase [Neisseria meningitidis CU385]
 gi|325199716|gb|ADY95171.1| phosphoglucosamine mutase [Neisseria meningitidis H44/76]
          Length = 444

 Score =  262 bits (668), Expect = 1e-67,   Method: Composition-based stats.
 Identities = 196/445 (44%), Positives = 290/445 (65%), Gaps = 6/445 (1%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKK--KHRRVVIGKDTRLSGYML 58
           M +++FGTDG+RG+   FPITP+F++++G A G +       +   V+IGKDTR+SGYML
Sbjct: 1   MAKKYFGTDGVRGEVGQFPITPDFVLKLGYAAGQVLVQHDTDQKPTVLIGKDTRISGYML 60

Query: 59  ENSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDG 118
           E +LVAGFTAAG++    GP+P+P VA LTR+LR   GVMISASHN Y DNGIK F   G
Sbjct: 61  EAALVAGFTAAGVNVVQTGPLPTPGVAYLTRALRLSAGVMISASHNAYSDNGIKFFAEGG 120

Query: 119 YKVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLR 178
            K+S ++E  IE  ++ ++ +       +G A+R+ G  DRYIE  K T P    L+GL+
Sbjct: 121 VKLSDEVELEIEAKIDGEMKTQP--SARLGRARRISGADDRYIEFCKSTFPSHSDLRGLK 178

Query: 179 IVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADI 238
           +VVD ANGA Y VAP+VF ELGA VV IG++PNG NIN  CG+T   +LQ  V +  AD 
Sbjct: 179 LVVDTANGAGYGVAPKVFHELGAQVVSIGNEPNGYNINEKCGATYTKTLQAAVLQHEADY 238

Query: 239 GIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIA 298
           GIALDGDGDR+++VD+ G + +GD ++ +IA+   +   +   G+V TVM+N+ +E  + 
Sbjct: 239 GIALDGDGDRLMMVDKNGQVYDGDSLIYVIAK-ARAREGINIGGVVGTVMTNMAMEIALK 297

Query: 299 GLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQY 358
             G+   R +VGDRY++E +   G+ +GGE SGHI+  D  +TGDG+++ALQVL  ++  
Sbjct: 298 EQGVDFCRAKVGDRYVLEQLNQRGWLIGGEASGHILCMDKHNTGDGIISALQVLAALQTL 357

Query: 359 DKPVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTES 418
           ++ ++T+C  ++ YPQ + +V ++       +S    +A+ E EL G  R+++RASGTE 
Sbjct: 358 NQDLATVCADWQPYPQTMINVRIQKGQQWQEAS-KDVLAEVEKELEGKGRVVLRASGTEP 416

Query: 419 LIRIMAEGDDLSRIKRIVDDLAKVI 443
           ++R+M E       +   + +A  I
Sbjct: 417 VVRVMVEARQADWAREGAERIAAAI 441


>gi|227551689|ref|ZP_03981738.1| phosphoglucosamine mutase [Enterococcus faecium TX1330]
 gi|257884391|ref|ZP_05664044.1| phosphoglucosamine mutase [Enterococcus faecium 1,231,501]
 gi|257887175|ref|ZP_05666828.1| phosphoglucosamine mutase [Enterococcus faecium 1,141,733]
 gi|257895712|ref|ZP_05675365.1| phosphoglucosamine mutase [Enterococcus faecium Com12]
 gi|257898283|ref|ZP_05677936.1| phosphoglucosamine mutase [Enterococcus faecium Com15]
 gi|293377678|ref|ZP_06623867.1| phosphoglucosamine mutase [Enterococcus faecium PC4.1]
 gi|293571872|ref|ZP_06682888.1| phosphoglucosamine mutase [Enterococcus faecium E980]
 gi|227179130|gb|EEI60102.1| phosphoglucosamine mutase [Enterococcus faecium TX1330]
 gi|257820229|gb|EEV47377.1| phosphoglucosamine mutase [Enterococcus faecium 1,231,501]
 gi|257823229|gb|EEV50161.1| phosphoglucosamine mutase [Enterococcus faecium 1,141,733]
 gi|257832277|gb|EEV58698.1| phosphoglucosamine mutase [Enterococcus faecium Com12]
 gi|257836195|gb|EEV61269.1| phosphoglucosamine mutase [Enterococcus faecium Com15]
 gi|291608126|gb|EFF37432.1| phosphoglucosamine mutase [Enterococcus faecium E980]
 gi|292643678|gb|EFF61799.1| phosphoglucosamine mutase [Enterococcus faecium PC4.1]
          Length = 451

 Score =  262 bits (668), Expect = 1e-67,   Method: Composition-based stats.
 Identities = 186/447 (41%), Positives = 274/447 (61%), Gaps = 8/447 (1%)

Query: 4   RFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLF---RGKKKHRRVVIGKDTRLSGYMLEN 60
           ++FGTDG+RG++N   +TP    ++G   GY+      + K  RV++G+DTR+SG MLE 
Sbjct: 3   KYFGTDGVRGEANK-ELTPELAFKLGRCGGYVLSQHEEEGKRPRVLVGRDTRISGQMLEE 61

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +L++G  + G++ F LG I +P VA LTR  +A  GVMISASHNP QDNGIK FG DG+K
Sbjct: 62  ALISGLLSVGIEVFQLGVISTPGVAYLTRLQKASAGVMISASHNPAQDNGIKFFGADGFK 121

Query: 121 VSTDIEDRIETLLEDDLTS-YLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRI 179
           +  D E  IE LL+ ++        D +G  +       +Y + + +T+     L GL I
Sbjct: 122 LVDDQELEIEALLDAEVDELPRPSADGLGTVEEFPEGLLKYSQFLVQTING--DLSGLTI 179

Query: 180 VVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIG 239
            VD ANGA+      +F +L  D   +G  P+G+NIN   GST+   L   V E  AD G
Sbjct: 180 CVDAANGATSTSVNRLFADLETDFYTMGTNPDGLNINDGVGSTHPERLAEMVVEKGADAG 239

Query: 240 IALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAG 299
           +A DGDGDR+I VDE G IV+GD+IM + A+     + L+ + IVTTVMSN+G  + + G
Sbjct: 240 LAFDGDGDRIIAVDELGNIVDGDKIMFICAKYLAEKNRLKKDTIVTTVMSNLGFHKAVEG 299

Query: 300 LGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYD 359
           +GL    T+VGDRY++E M+ N +N GGEQSGH+I  D+ +TGDG+++ +Q+L  +KQ  
Sbjct: 300 IGLKDVVTQVGDRYVVEEMRKNDYNFGGEQSGHMIFLDFNTTGDGMLSGIQLLNIMKQTG 359

Query: 360 KPVSTICHCFEEYPQFLRSVSVKDTS-ILNSSSIVQAIADAESELRGIDRLIVRASGTES 418
           K +S +      YPQ L ++ V D +  ++  +I + I +AE+E+    R++VR SGTE 
Sbjct: 360 KKLSELAAEVTIYPQKLVNIRVSDKNGAMDVPAIKKVIEEAEAEMGSEGRILVRPSGTEP 419

Query: 419 LIRIMAEGDDLSRIKRIVDDLAKVIPM 445
           L+R+MAE     ++   VD +A V+  
Sbjct: 420 LLRVMAEAPTDEKVNYYVDKIAAVVKE 446


>gi|240014589|ref|ZP_04721502.1| MrsA [Neisseria gonorrhoeae DGI18]
 gi|240121111|ref|ZP_04734073.1| MrsA [Neisseria gonorrhoeae PID24-1]
          Length = 444

 Score =  262 bits (668), Expect = 1e-67,   Method: Composition-based stats.
 Identities = 194/445 (43%), Positives = 291/445 (65%), Gaps = 6/445 (1%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKK--KHRRVVIGKDTRLSGYML 58
           M +++FGTDG+RG+   FPITP+F++++G A G +       +   V+IGKDTR+SGYML
Sbjct: 1   MAKKYFGTDGVRGEVGQFPITPDFVLKLGYAAGQVLVQHDTDQKPTVLIGKDTRISGYML 60

Query: 59  ENSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDG 118
           E +LVAGFTAAG++    GP+P+P VA LTR+LR   GVMISASHN Y DNGIK F   G
Sbjct: 61  EAALVAGFTAAGVNVVQTGPLPTPGVAYLTRALRLSAGVMISASHNTYSDNGIKFFAEGG 120

Query: 119 YKVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLR 178
            K+S ++E  IE  +++++ +       +G A+R+ G  DRYIE  K T P    L+GL+
Sbjct: 121 VKLSDEVELEIEAKIDEEMKTQP--SARLGRARRISGADDRYIEFCKSTFPGHSDLRGLK 178

Query: 179 IVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADI 238
           +V+D ANGA Y VAP+VF ELGA VV IG++PNG NIN  CG+T+  +LQ  V +  AD 
Sbjct: 179 LVIDTANGAGYGVAPKVFHELGAQVVSIGNEPNGYNINEKCGATHTKTLQAAVLQNEADY 238

Query: 239 GIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIA 298
           GIALDGDGDR+++VD+   + +GD ++ +IA+   +   +   G+V TVM+N+ +E  + 
Sbjct: 239 GIALDGDGDRLMMVDKNRQVYDGDSLIYVIAK-ARAREGINIGGVVGTVMTNMAMEIALK 297

Query: 299 GLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQY 358
             G+   R +VGDRY++E +   G+ +GGE SGHI+  D  +TGDG+++ALQVL  ++  
Sbjct: 298 EQGVDFCRAKVGDRYVLEQLNQRGWLIGGEASGHILCMDKHNTGDGIISALQVLAALQIL 357

Query: 359 DKPVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTES 418
           ++ ++T+C  ++ YPQ + +V ++       +S    +A+ E EL G  R+++RASGTE 
Sbjct: 358 NQDLATVCADWQPYPQTMINVRIQKGQKWQEAS-KDVLAEVEKELEGKGRVVLRASGTEP 416

Query: 419 LIRIMAEGDDLSRIKRIVDDLAKVI 443
           ++R+M E       +   + +A  I
Sbjct: 417 VVRVMVEARQADWARDGAERIAAAI 441


>gi|59801691|ref|YP_208403.1| MrsA [Neisseria gonorrhoeae FA 1090]
 gi|194099107|ref|YP_002002192.1| phosphoglucosamine mutase [Neisseria gonorrhoeae NCCP11945]
 gi|293398671|ref|ZP_06642849.1| phosphoglucosamine mutase [Neisseria gonorrhoeae F62]
 gi|75355730|sp|Q5F746|GLMM_NEIG1 RecName: Full=Phosphoglucosamine mutase
 gi|59718586|gb|AAW89991.1| putative phosphoglucomutase protein [Neisseria gonorrhoeae FA 1090]
 gi|193934397|gb|ACF30221.1| MrsA [Neisseria gonorrhoeae NCCP11945]
 gi|291611142|gb|EFF40239.1| phosphoglucosamine mutase [Neisseria gonorrhoeae F62]
          Length = 445

 Score =  262 bits (668), Expect = 1e-67,   Method: Composition-based stats.
 Identities = 194/445 (43%), Positives = 291/445 (65%), Gaps = 6/445 (1%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKK--KHRRVVIGKDTRLSGYML 58
           M +++FGTDG+RG+   FPITP+F++++G A G +       +   V+IGKDTR+SGYML
Sbjct: 2   MAKKYFGTDGVRGEVGQFPITPDFVLKLGYAAGQVLVQHDTDQKPTVLIGKDTRISGYML 61

Query: 59  ENSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDG 118
           E +LVAGFTAAG++    GP+P+P VA LTR+LR   GVMISASHN Y DNGIK F   G
Sbjct: 62  EAALVAGFTAAGVNVVQTGPLPTPGVAYLTRALRLSAGVMISASHNTYSDNGIKFFAEGG 121

Query: 119 YKVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLR 178
            K+S ++E  IE  +++++ +       +G A+R+ G  DRYIE  K T P    L+GL+
Sbjct: 122 VKLSDEVELEIEAKIDEEMKTQP--SARLGRARRISGADDRYIEFCKSTFPGHSDLRGLK 179

Query: 179 IVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADI 238
           +V+D ANGA Y VAP+VF ELGA VV IG++PNG NIN  CG+T+  +LQ  V +  AD 
Sbjct: 180 LVIDTANGAGYGVAPKVFHELGAQVVSIGNEPNGYNINEKCGATHTKTLQAAVLQNEADY 239

Query: 239 GIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIA 298
           GIALDGDGDR+++VD+   + +GD ++ +IA+   +   +   G+V TVM+N+ +E  + 
Sbjct: 240 GIALDGDGDRLMMVDKNRQVYDGDSLIYVIAK-ARAREGINIGGVVGTVMTNMAMEIALK 298

Query: 299 GLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQY 358
             G+   R +VGDRY++E +   G+ +GGE SGHI+  D  +TGDG+++ALQVL  ++  
Sbjct: 299 EQGVDFCRAKVGDRYVLEQLNQRGWLIGGEASGHILCMDKHNTGDGIISALQVLAALQIL 358

Query: 359 DKPVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTES 418
           ++ ++T+C  ++ YPQ + +V ++       +S    +A+ E EL G  R+++RASGTE 
Sbjct: 359 NQDLATVCADWQPYPQTMINVRIQKGQKWQEAS-KDVLAEVEKELEGKGRVVLRASGTEP 417

Query: 419 LIRIMAEGDDLSRIKRIVDDLAKVI 443
           ++R+M E       +   + +A  I
Sbjct: 418 VVRVMVEARQADWARDGAERIAAAI 442


>gi|152987269|ref|YP_001350791.1| phosphoglucosamine mutase [Pseudomonas aeruginosa PA7]
 gi|166990420|sp|A6VCK6|GLMM_PSEA7 RecName: Full=Phosphoglucosamine mutase
 gi|150962427|gb|ABR84452.1| phosphoglucosamine mutase [Pseudomonas aeruginosa PA7]
          Length = 445

 Score =  262 bits (668), Expect = 1e-67,   Method: Composition-based stats.
 Identities = 200/447 (44%), Positives = 291/447 (65%), Gaps = 5/447 (1%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M R++FGTDGIRG+   FPITP+F++++G AVG  FR +  + RV+IGKDTR SGYM E+
Sbjct: 1   MSRKYFGTDGIRGRVGEFPITPDFVLKLGWAVGMAFRRQG-NCRVLIGKDTRSSGYMFES 59

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +  AG +A+G D  +LGP+P+P +A LTR+  A+ GV+ISASHNP+ DNGIK F   G K
Sbjct: 60  AFEAGLSASGADTLLLGPMPTPGIAYLTRTFHAEAGVVISASHNPHDDNGIKFFSGQGTK 119

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +  D+E  IE LL+  +T  +     +G   R++    RYIE  K ++P      GL++V
Sbjct: 120 LPDDVELMIEELLDAPMT--VVESARLGKVSRINDAAGRYIEFCKSSVPTSTDFNGLKVV 177

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           +DCANGA+YK+AP VF ELGA+V V+   PNG+NIN  CGST++  LQ  V E  AD+GI
Sbjct: 178 LDCANGATYKIAPNVFRELGAEVTVLAASPNGLNINDKCGSTHLDGLQAAVIEHHADLGI 237

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           A DGDGDRV++VD  GAIV+GD+++ LIAR+      L+G  + T  MSN+GLE  +  L
Sbjct: 238 AFDGDGDRVMMVDHTGAIVDGDELLFLIARDMQESGRLQGGVVGTL-MSNLGLELALQDL 296

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
            +   R +VGDRY+M  +    + +GGE SGHI+     +TGD ++AALQVL  +K+  +
Sbjct: 297 HIPFVRAKVGDRYVMAELLARNWMLGGENSGHIVCCQNTTTGDAIIAALQVLMALKRRGQ 356

Query: 361 PVSTICHCFEEYPQFLRSVSVK-DTSILNSSSIVQAIADAESELRGIDRLIVRASGTESL 419
            ++       + PQ L +V  K ++  L   S+ +A A    ++ G  R+++R SGTE L
Sbjct: 357 TLAEARQGIRKCPQVLINVRFKGESDPLEHPSVKEASARVTEQMGGRGRVLLRKSGTEPL 416

Query: 420 IRIMAEGDDLSRIKRIVDDLAKVIPMI 446
           +R+M EGD+ + ++   + LAK++  +
Sbjct: 417 VRVMVEGDEEATVRAHAEQLAKIVSEV 443


>gi|39996904|ref|NP_952855.1| phosphoglucosamine mutase [Geobacter sulfurreducens PCA]
 gi|81702219|sp|Q74C70|GLMM_GEOSL RecName: Full=Phosphoglucosamine mutase
 gi|39983792|gb|AAR35182.1| phosphoglucosamine mutase [Geobacter sulfurreducens PCA]
          Length = 451

 Score =  262 bits (668), Expect = 1e-67,   Method: Composition-based stats.
 Identities = 209/445 (46%), Positives = 291/445 (65%), Gaps = 2/445 (0%)

Query: 3   RRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSL 62
           ++ FGTDG+RG +N +P+T    M+IG A  YLF+   +  R+VIGKDTRLSGYMLEN+L
Sbjct: 2   KKLFGTDGVRGVANVYPMTTEMAMQIGRAAAYLFKDGNRRHRIVIGKDTRLSGYMLENAL 61

Query: 63  VAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVS 122
           VAG  + G+D  ++GP+P+P +A +T S+RAD GV+ISASHNP+QDNGIK F  DG+K+ 
Sbjct: 62  VAGICSMGVDVLVVGPLPTPGIANITSSMRADAGVVISASHNPFQDNGIKFFSRDGFKLP 121

Query: 123 TDIEDRIETLL-EDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVV 181
            ++E +IE L+    + S       +G A R+D    RY+  +K + P+D+ L G++IV+
Sbjct: 122 DEMELKIEDLIFSGKIDSLRPVATEVGKAYRIDDAVGRYVVFLKNSFPKDLDLAGMKIVL 181

Query: 182 DCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIA 241
           DCANGA+YKVAP V  ELGA+V+  G KPNG NIN  CGS     +   V E RAD+GIA
Sbjct: 182 DCANGAAYKVAPAVLEELGAEVIPYGVKPNGTNINAGCGSLYPQVISEAVKEHRADLGIA 241

Query: 242 LDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLG 301
           LDGD DRVI VDE G  V+GD IMA+ A + +    LR N +V TVMSN+GL+  +   G
Sbjct: 242 LDGDADRVIFVDEFGNEVDGDHIMAICATQMLKQKKLRKNTLVATVMSNMGLDIAVKRAG 301

Query: 302 LSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKP 361
             + +T VGDRY++E M   G+N+GGEQSGH+I  D  +TGDG+++ALQVL  +++ DK 
Sbjct: 302 GKVVKTAVGDRYVVEEMIKGGYNLGGEQSGHMIFLDPNTTGDGVLSALQVLATMRRADKS 361

Query: 362 VSTICHCFEEYPQFLRSVSVKDTSIL-NSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
           +S +       PQ L +V VK+   +     +   I D E +L    R+++R SGTE L+
Sbjct: 362 LSELAEVMIPLPQVLVNVRVKEKKDITTIPEVALLIGDIEKKLGDEGRILIRYSGTEPLL 421

Query: 421 RIMAEGDDLSRIKRIVDDLAKVIPM 445
           RIM EG D  +I     ++A ++  
Sbjct: 422 RIMLEGQDKYQITGWAKEIADLVEK 446


>gi|293557148|ref|ZP_06675702.1| phosphoglucosamine mutase [Enterococcus faecium E1039]
 gi|294616484|ref|ZP_06696265.1| phosphoglucosamine mutase [Enterococcus faecium E1636]
 gi|291590632|gb|EFF22360.1| phosphoglucosamine mutase [Enterococcus faecium E1636]
 gi|291600717|gb|EFF31015.1| phosphoglucosamine mutase [Enterococcus faecium E1039]
          Length = 451

 Score =  262 bits (668), Expect = 1e-67,   Method: Composition-based stats.
 Identities = 185/447 (41%), Positives = 274/447 (61%), Gaps = 8/447 (1%)

Query: 4   RFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLF---RGKKKHRRVVIGKDTRLSGYMLEN 60
           ++FGTDG+RG++N   +TP    ++G   GY+      + K  RV++G+DTR+SG MLE 
Sbjct: 3   KYFGTDGVRGEANK-ELTPELAFKLGRCGGYVLSQHEEEGKRPRVLVGRDTRISGQMLEE 61

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +L++G  + G++ F LG I +P VA LTR  +A  GVMISASHNP QDNGIK FG DG+K
Sbjct: 62  ALISGLLSVGIEVFQLGVISTPGVAYLTRLQKASAGVMISASHNPAQDNGIKFFGADGFK 121

Query: 121 VSTDIEDRIETLLEDDLTS-YLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRI 179
           +  D E  IE LL+ ++        D +G  +       +Y + + +T+     L GL I
Sbjct: 122 LVDDQELEIEALLDAEVDELPRPSADGLGTVEEFPEGLLKYSQFLVQTING--DLSGLTI 179

Query: 180 VVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIG 239
            VD ANGA+      +F +L  +   +G  P+G+NIN   GST+   L   V E  AD G
Sbjct: 180 CVDAANGATSTSVNRLFADLETEFYTMGTNPDGLNINDGVGSTHPERLAEMVVEKGADAG 239

Query: 240 IALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAG 299
           +A DGDGDR+I VDE G IV+GD+IM + A+     + L+ + IVTTVMSN+G  + + G
Sbjct: 240 LAFDGDGDRIIAVDELGNIVDGDKIMFICAKYLAEKNRLKKDTIVTTVMSNLGFHKAVEG 299

Query: 300 LGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYD 359
           +GL    T+VGDRY++E M+ N +N GGEQSGH+I  D+ +TGDG+++ +Q+L  +KQ  
Sbjct: 300 IGLKDVVTQVGDRYVVEEMRKNDYNFGGEQSGHMIFLDFNTTGDGMLSGIQLLNIMKQTG 359

Query: 360 KPVSTICHCFEEYPQFLRSVSVKDTS-ILNSSSIVQAIADAESELRGIDRLIVRASGTES 418
           K +S +      YPQ L ++ V D +  ++  +I + I +AE+E+    R++VR SGTE 
Sbjct: 360 KKLSELAAEVTIYPQKLVNIRVSDKNGAMDVPAIKKVIEEAEAEMGSEGRILVRPSGTEP 419

Query: 419 LIRIMAEGDDLSRIKRIVDDLAKVIPM 445
           L+R+MAE     ++   VD +A V+  
Sbjct: 420 LLRVMAEAPTDEKVNYYVDKIAAVVKE 446


>gi|328956680|ref|YP_004374066.1| phosphoglucosamine mutase [Carnobacterium sp. 17-4]
 gi|328673004|gb|AEB29050.1| phosphoglucosamine mutase [Carnobacterium sp. 17-4]
          Length = 452

 Score =  262 bits (668), Expect = 1e-67,   Method: Composition-based stats.
 Identities = 180/447 (40%), Positives = 273/447 (61%), Gaps = 8/447 (1%)

Query: 4   RFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLF---RGKKKHRRVVIGKDTRLSGYMLEN 60
           ++FGTDG+RG +N   +TP    ++G   GY+       ++H RV++G+DTR+SG MLE+
Sbjct: 3   KYFGTDGVRGVAN-SELTPELAFKLGRCGGYVLTQHAEGEEHPRVLVGRDTRISGEMLES 61

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +L+AG  + G++   LG I +P VA LTR   A  GVMISASHNP  DNGIK FG DG+K
Sbjct: 62  ALIAGLLSVGIEVMKLGVISTPGVAYLTRVQGAAAGVMISASHNPAPDNGIKFFGSDGFK 121

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYD-SIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRI 179
           +  D E  IE LL+++  +        +G          +Y + +++T+P    L GL++
Sbjct: 122 LFDDTELEIEALLDEEKDNLPRPSAIGLGTVDEYPEGALKYTQFLQQTIPN--DLAGLQV 179

Query: 180 VVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIG 239
            +D ANGA+  +   +F +L  +  V+   PNG+NIN   GST+   L + V E  AD G
Sbjct: 180 CLDGANGATSPLLNRLFADLETEFDVMASTPNGLNINDGVGSTHPEGLAKFVVEKGADAG 239

Query: 240 IALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAG 299
           +A DGDGDRVI VDE G I++GD+IM +  +       L+ + IV+TVMSN+G  + I  
Sbjct: 240 LAFDGDGDRVIAVDELGNIIDGDKIMFICGKYLQEKGRLKKDTIVSTVMSNLGFHKAIEA 299

Query: 300 LGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYD 359
             +   +T+VGDRY++E M+ NG+N GGEQSGH++  DY +TGDG+++ +Q+L  +K+  
Sbjct: 300 NNMIALQTKVGDRYVVEEMRKNGYNFGGEQSGHMVFLDYNTTGDGILSGIQLLNVMKETG 359

Query: 360 KPVSTICHCFEEYPQFLRSVSVKDTS-ILNSSSIVQAIADAESELRGIDRLIVRASGTES 418
           K +S +    + YPQ L ++ V D +  ++  +I   I + ESE+ G  R++VR SGTE 
Sbjct: 360 KKLSELAEEVQTYPQKLVNIRVSDKNGAMDVPAIKAIIEEVESEMNGNGRILVRPSGTEP 419

Query: 419 LIRIMAEGDDLSRIKRIVDDLAKVIPM 445
           L+R+MAE     ++   VD +A V+  
Sbjct: 420 LLRVMAEAPTQEKVNLYVDRIASVVKQ 446


>gi|304316001|ref|YP_003851146.1| phosphoglucosamine mutase [Thermoanaerobacterium
           thermosaccharolyticum DSM 571]
 gi|302777503|gb|ADL68062.1| phosphoglucosamine mutase [Thermoanaerobacterium
           thermosaccharolyticum DSM 571]
          Length = 447

 Score =  262 bits (668), Expect = 1e-67,   Method: Composition-based stats.
 Identities = 193/448 (43%), Positives = 274/448 (61%), Gaps = 7/448 (1%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M R  FGTDG+RG +N   +TP     +G A  Y+     +  +++IG+D+R+SG ML++
Sbjct: 1   MAR-LFGTDGVRGIANK-DLTPQLAFELGRAGAYVLTECSRRPKILIGRDSRVSGDMLQS 58

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +L AG T+ G +    G IP+PAVA LTR  + D GV+ISASHNP + NGIK F  DGYK
Sbjct: 59  ALTAGLTSVGAEVIDAGIIPTPAVAYLTRLYKLDAGVVISASHNPVEYNGIKFFNKDGYK 118

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +  ++ED+IE ++ ++          +G+          YIE +K T+  +  L+GL+IV
Sbjct: 119 LPDEVEDKIEKIINENSDLPTPTGLDVGNVIESKSAQRDYIEFLKSTI--NCDLKGLKIV 176

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           +DCA GAS  VAP +F ELGADV++ G  PNG  IN+ CGSTN   LQ  V    AD+G 
Sbjct: 177 LDCAYGASSTVAPILFHELGADVILYGSHPNGEKINVKCGSTNPKVLQEIVAGTGADVGF 236

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           A DGD DR+I VDEKG IV+GD IMA+      S   L  N +V TVMSNIGL+  +   
Sbjct: 237 AFDGDADRLIAVDEKGNIVDGDHIMAMCGIHLKSRGKLNKNTVVVTVMSNIGLDIALKQN 296

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           G+ + +T+VGDRY++E M  NG+++GGEQSGHII  D+ +TGDG + AL+V   +    K
Sbjct: 297 GIDVVKTKVGDRYVLEEMVRNGYSIGGEQSGHIIFLDHNTTGDGEITALKVAELLVSSGK 356

Query: 361 PVSTICHCFEEYPQFLRSVSVKDT---SILNSSSIVQAIADAESELRGIDRLIVRASGTE 417
            +S +      YPQ L +  VK+      ++   I + I   E E++G  R+++R SGTE
Sbjct: 357 KLSELSGVMVSYPQVLINAKVKNELKHKYMDDEDIAREINKLEKEMQGEGRVLIRPSGTE 416

Query: 418 SLIRIMAEGDDLSRIKRIVDDLAKVIPM 445
            L+R+M EG D  +I+ +  +LA +I  
Sbjct: 417 PLVRVMVEGKDQEKIESMAKELASLIEK 444


>gi|284097491|ref|ZP_06385580.1| Phosphoglucosamine mutase [Candidatus Poribacteria sp. WGA-A3]
 gi|283830999|gb|EFC35020.1| Phosphoglucosamine mutase [Candidatus Poribacteria sp. WGA-A3]
          Length = 449

 Score =  262 bits (668), Expect = 1e-67,   Method: Composition-based stats.
 Identities = 222/445 (49%), Positives = 301/445 (67%), Gaps = 2/445 (0%)

Query: 3   RRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSL 62
           R+ FGTDG+RG +N  P+    ++++G AV Y+F+G+  H ++VIGKDTRLSGYMLE++L
Sbjct: 2   RKLFGTDGVRGIANLEPMNSEMVLKLGRAVAYVFKGRAGHHQIVIGKDTRLSGYMLESAL 61

Query: 63  VAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVS 122
           ++G  + G+D  ++GP+PSP VA LTRSLRAD GVMISASHNPYQDNGIK F  DG+K+ 
Sbjct: 62  ISGICSMGVDVLLVGPMPSPGVAFLTRSLRADAGVMISASHNPYQDNGIKFFSHDGFKLP 121

Query: 123 TDIEDRIETLL-EDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVV 181
            D+E RIE L+  +++       + IG A R+     RYIE VKR+LPR++  QG+++V+
Sbjct: 122 DDLELRIEELILSNEIEHLRPTANEIGKAFRIPDAEGRYIEFVKRSLPREMDYQGMKVVI 181

Query: 182 DCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIA 241
           DCA+GA+Y V P+V  ELGADV VIGD+P+G NIN   G+     LQ  V   R DIGIA
Sbjct: 182 DCAHGAAYSVFPKVIRELGADVSVIGDEPDGTNINAGYGALYPERLQEAVRAHRGDIGIA 241

Query: 242 LDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLG 301
           LDGD DR + V E+G +VNGDQ +A  A +      L  + +V TVMSN GLE  +   G
Sbjct: 242 LDGDADRAVFVTEEGDVVNGDQALAAFALDLQQRGGLNRHTVVGTVMSNFGLESAMQKNG 301

Query: 302 LSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKP 361
           ++L RT VGDR I+E M  +G+N+GGEQSGH+I  DY +TGDGL++ LQ+L+ +K+    
Sbjct: 302 INLVRTPVGDRSILERMLADGYNLGGEQSGHVIFLDYNTTGDGLISGLQMLKLVKRSGSA 361

Query: 362 VSTICHCFEEYPQFLRSVSVKDTSILNS-SSIVQAIADAESELRGIDRLIVRASGTESLI 420
           VS + HC E  PQ L  V+V     L S   + +AI   E  L G  R++VR SGTE L+
Sbjct: 362 VSELTHCIETVPQVLLGVTVNRKPDLGSLPELREAIRSGEERLNGTGRILVRYSGTEPLV 421

Query: 421 RIMAEGDDLSRIKRIVDDLAKVIPM 445
           R+M EG D S+I+ + D+LA V+  
Sbjct: 422 RVMVEGQDYSQIREVADELAGVVKA 446


>gi|331268463|ref|YP_004394955.1| phosphoglucosamine mutase [Clostridium botulinum BKT015925]
 gi|329125013|gb|AEB74958.1| phosphoglucosamine mutase [Clostridium botulinum BKT015925]
          Length = 449

 Score =  261 bits (667), Expect = 1e-67,   Method: Composition-based stats.
 Identities = 187/449 (41%), Positives = 276/449 (61%), Gaps = 8/449 (1%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M R  FGTDG+RG +NT  +T +   ++G A  ++        ++++G DTR+SG MLE 
Sbjct: 1   MSR-LFGTDGVRGIANT-ELTADLAFKLGRAGAFVLTEGTHKPKILVGMDTRISGDMLEA 58

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +LV+G  + G +A  +G +P+PA+A LTR  +AD GV+ISASHNP + NGIK F  +GYK
Sbjct: 59  ALVSGILSVGAEAICVGIVPTPAIAYLTRKYKADAGVVISASHNPVEYNGIKFFNKNGYK 118

Query: 121 VSTDIEDRIETLLEDDLTSYL-SCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRI 179
           +  ++EDRI++++E++         + +G     +   + YIE  K T+   V L+GL+I
Sbjct: 119 LKDELEDRIQSIIENNFQGVPSPTGEHLGKKVVCESAEEDYIEFAKSTI--AVDLKGLKI 176

Query: 180 VVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIG 239
            +DCANGASYK + E F ELGA+VVVI + P+G+NIN +CGST+   L   V +   D+G
Sbjct: 177 ALDCANGASYKTSVETFRELGAEVVVINNDPDGVNINKNCGSTHPEELMDYVVKQNCDLG 236

Query: 240 IALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAG 299
           +A DGD DR + VDEKG +++GD IMA+  +       L  N +V TVMSN+GL      
Sbjct: 237 LAFDGDADRCLAVDEKGNLIDGDFIMAICGKHLKEKGQLVDNMVVVTVMSNLGLSIAFDE 296

Query: 300 LGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYD 359
             +S  +T+VGDRY++E M  +G+ +GGEQSGHII  D+ +TGDGLV  LQV   +K+  
Sbjct: 297 ENISTIKTKVGDRYVLEEMVKDGYKLGGEQSGHIIFLDFNTTGDGLVTGLQVAAIVKETG 356

Query: 360 KPVSTICHCFEEYPQFLRSVSVKDTSI---LNSSSIVQAIADAESELRGIDRLIVRASGT 416
           K +S +     + PQ L +  V +         + I + I   E +L G  R+++R SGT
Sbjct: 357 KKLSELASIMTKLPQVLVNAKVPNNMKDIHEKDAEIAEEIRKIEEKLNGSGRVLIRPSGT 416

Query: 417 ESLIRIMAEGDDLSRIKRIVDDLAKVIPM 445
           E L+R+M EG D + + +I   LAK+I  
Sbjct: 417 EPLVRVMLEGKDQAELDKIAHTLAKMIEK 445


>gi|254516622|ref|ZP_05128681.1| phosphoglucosamine mutase [gamma proteobacterium NOR5-3]
 gi|219675045|gb|EED31412.1| phosphoglucosamine mutase [gamma proteobacterium NOR5-3]
          Length = 451

 Score =  261 bits (667), Expect = 1e-67,   Method: Composition-based stats.
 Identities = 203/450 (45%), Positives = 288/450 (64%), Gaps = 7/450 (1%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFR---GKKKHRRVVIGKDTRLSGYM 57
           MK+RFFGTDGIRG     PITP+F++++G A G +F     ++    V+IGKDTR+SGYM
Sbjct: 1   MKKRFFGTDGIRGLVGESPITPDFVLKLGWACGRVFTRLMAEQGRCSVIIGKDTRVSGYM 60

Query: 58  LENSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPD 117
            E++L AG  AAG+D  +LGP+P+PAVA++TR+  AD G++ISASHNPY DNGIK F   
Sbjct: 61  FESALEAGLVAAGVDVKLLGPMPTPAVALMTRTQNADAGIVISASHNPYFDNGIKFFSAT 120

Query: 118 GYKVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGL 177
           G K+  +IE  IE  L  DL         IG  +R+     RYIE  K T+P   +L+GL
Sbjct: 121 GSKLPDEIELAIEAEL--DLPLSCVESHDIGKVQRLVDAAGRYIEFCKATVPEGFSLRGL 178

Query: 178 RIVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRAD 237
           RI +DCA+GA+Y +AP V  ELGA+V+ IG  P+G NIN   GST++ +L   V E + D
Sbjct: 179 RIAMDCAHGATYHIAPSVLSELGAEVISIGVSPDGFNINEGVGSTHMDTLAATVRERQCD 238

Query: 238 IGIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFI 297
           +GIA DGDGDRV+ VD++G  V+GDQ++ LIA   +        G+V T+MSN+GLE  +
Sbjct: 239 LGIAYDGDGDRVLFVDDQGTTVDGDQLLYLIAMHRLRE-GNSDAGVVGTLMSNLGLEMAL 297

Query: 298 AGLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQ 357
              GL   R +VGDRY+ E M+   +++GGE SGHII SD  +TGDG+V++LQVLR ++ 
Sbjct: 298 REQGLQFVRAKVGDRYVREMMEAQSWHLGGESSGHIICSDVTTTGDGIVSSLQVLRALRV 357

Query: 358 YDKPVSTICHCFEEYPQFLRSVSV-KDTSILNSSSIVQAIADAESELRGIDRLIVRASGT 416
               +  +      +PQ + +V V    +++   ++V A+A  E EL    R+++R SGT
Sbjct: 358 AGGSLREVLAGVPLFPQTMINVRVTPGVNVVAEPAMVAAVAKVEQELGDAGRVLLRPSGT 417

Query: 417 ESLIRIMAEGDDLSRIKRIVDDLAKVIPMI 446
           E +IR+M EG D  ++ R+   LA  +  +
Sbjct: 418 EPVIRVMVEGRDEEQVDRLCRSLASTVEEL 447


>gi|84516917|ref|ZP_01004275.1| Phosphoglucomutase/phosphomannomutase [Loktanella vestfoldensis
           SKA53]
 gi|84509385|gb|EAQ05844.1| Phosphoglucomutase/phosphomannomutase [Loktanella vestfoldensis
           SKA53]
          Length = 447

 Score =  261 bits (667), Expect = 1e-67,   Method: Composition-based stats.
 Identities = 232/447 (51%), Positives = 309/447 (69%), Gaps = 4/447 (0%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKK-KHRRVVIGKDTRLSGYMLE 59
           M R+FFGTDG+RG +N +P+T +  +RIG A G  FR       RVVIGKDTRLSGYM E
Sbjct: 1   MTRKFFGTDGVRGTANIYPMTADMALRIGAAAGRYFRNDGSNGHRVVIGKDTRLSGYMFE 60

Query: 60  NSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGY 119
           N+L AG T+ GM+  +LGP+P+PAV +LT S+RADVG+MISASHNP+ DNGIK FGPDG+
Sbjct: 61  NALTAGLTSTGMNVLLLGPVPTPAVGLLTTSMRADVGIMISASHNPHHDNGIKFFGPDGF 120

Query: 120 KVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRI 179
           K+S   E++IE L+  D+        +IG AKR+D    RY E +K T P  + L GL++
Sbjct: 121 KLSDAAEEQIEALIASDVEPAK--AANIGRAKRIDDGRFRYAERLKATFPAGMRLDGLKV 178

Query: 180 VVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIG 239
           VVDCANGA+YKVAPEV WELGA V+ +G  P+G NIN  CGST+     + + +  AD+G
Sbjct: 179 VVDCANGAAYKVAPEVLWELGATVIKVGVDPDGFNINDGCGSTHPERAAQVIRDTGADVG 238

Query: 240 IALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAG 299
           I LDGD DRV+I+DE GA+ +GDQIMAL+A  W +   L+G+ +V TVMSN+GLERF+  
Sbjct: 239 ICLDGDADRVMILDETGAVADGDQIMALMAARWAAVGRLQGDTLVATVMSNLGLERFLDA 298

Query: 300 LGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYD 359
            GL LKRT VGDRY++E M+  GFN+GGEQSGHI+++DY +TGDGL+A LQ L  +    
Sbjct: 299 KGLHLKRTAVGDRYVVEAMRAGGFNLGGEQSGHIVMTDYATTGDGLLAGLQFLAAMIDTG 358

Query: 360 KPVSTICHCFEEYPQFLRSVSVK-DTSILNSSSIVQAIADAESELRGIDRLIVRASGTES 418
              S +   F+  PQ L++V     T  L +  +  +IADAE +L G  RL++R SGTE 
Sbjct: 359 HKASVLARNFDTVPQMLKNVRFTAGTDPLATKRVAASIADAEIKLNGKGRLLIRKSGTEP 418

Query: 419 LIRIMAEGDDLSRIKRIVDDLAKVIPM 445
           LIR+MAE +D + + ++VD +   +  
Sbjct: 419 LIRVMAECEDDTLLAQVVDQIIAEVAA 445


>gi|297545268|ref|YP_003677570.1| phosphoglucosamine mutase [Thermoanaerobacter mathranii subsp.
           mathranii str. A3]
 gi|296843043|gb|ADH61559.1| phosphoglucosamine mutase [Thermoanaerobacter mathranii subsp.
           mathranii str. A3]
          Length = 447

 Score =  261 bits (667), Expect = 1e-67,   Method: Composition-based stats.
 Identities = 199/447 (44%), Positives = 282/447 (63%), Gaps = 7/447 (1%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M R  FGTDG+RG +N + +TP     +G A  Y+        +VV+GKD+R+SG MLE 
Sbjct: 1   MAR-LFGTDGVRGIAN-YDLTPQLAFELGRAGAYVLTQGTHRPKVVVGKDSRISGDMLEC 58

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +L AG T+ G +   +G IP+PAVA LTR  +AD GVMISASHNP + NGIK F  DGYK
Sbjct: 59  ALTAGLTSVGAEVISVGIIPTPAVAYLTRLYQADAGVMISASHNPVEYNGIKFFDKDGYK 118

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +  ++EDRIE ++++           IG  K     H  YIE +K T+     L+G++IV
Sbjct: 119 LPDEVEDRIENIIKEKNELPSPIGTGIGTRKEYTNSHRDYIEFLKSTIDG--DLKGMKIV 176

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           +DCA GAS  VAP +F ELGA+V++ G +P G  IN++CGST+   LQ+ V +  ADIG+
Sbjct: 177 IDCAYGASSTVAPILFKELGAEVILYGAEPIGDKINVNCGSTHPEKLQQLVIKNGADIGL 236

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           A DGD DR+I VDEKG +++GD IMA+ A +      L+ N +V TVMSNIG E  +   
Sbjct: 237 AFDGDADRLIAVDEKGNVIDGDHIMAICAIDLKKKGRLKNNTVVATVMSNIGFEIALKEQ 296

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           G++L RT+VGDRY++E M    +++GGEQSGHII  D  +TGDG + AL++   +K+  K
Sbjct: 297 GINLIRTKVGDRYVLEEMIKGRYSIGGEQSGHIIFLDDNTTGDGEITALKLCSILKESGK 356

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTSI---LNSSSIVQAIADAESELRGIDRLIVRASGTE 417
            +S +  C   YPQ L +  VK+      L    I + I + E E++G  R+++R SGTE
Sbjct: 357 KLSELAACMVTYPQVLINAKVKNELKNAYLEDEEIKREIKNLEREMKGDGRVLIRPSGTE 416

Query: 418 SLIRIMAEGDDLSRIKRIVDDLAKVIP 444
            L+R+M EG D ++I ++   LA++I 
Sbjct: 417 PLVRVMVEGKDYNKISQMAKKLAELIE 443


>gi|69245969|ref|ZP_00603741.1| Phosphoglucosamine mutase [Enterococcus faecium DO]
 gi|257878476|ref|ZP_05658129.1| phosphoglucosamine mutase [Enterococcus faecium 1,230,933]
 gi|257882898|ref|ZP_05662551.1| phosphoglucosamine mutase [Enterococcus faecium 1,231,502]
 gi|257889324|ref|ZP_05668977.1| phosphoglucosamine mutase [Enterococcus faecium 1,231,410]
 gi|258615999|ref|ZP_05713769.1| phosphoglucosamine mutase [Enterococcus faecium DO]
 gi|260560065|ref|ZP_05832243.1| phosphoglucosamine mutase [Enterococcus faecium C68]
 gi|261207446|ref|ZP_05922132.1| phosphoglucosamine mutase [Enterococcus faecium TC 6]
 gi|289565857|ref|ZP_06446298.1| phosphoglucosamine mutase [Enterococcus faecium D344SRF]
 gi|293559808|ref|ZP_06676326.1| phosphoglucosamine mutase [Enterococcus faecium E1162]
 gi|293568089|ref|ZP_06679426.1| phosphoglucosamine mutase [Enterococcus faecium E1071]
 gi|294617414|ref|ZP_06697048.1| phosphoglucosamine mutase [Enterococcus faecium E1679]
 gi|294623413|ref|ZP_06702269.1| phosphoglucosamine mutase [Enterococcus faecium U0317]
 gi|314939694|ref|ZP_07846918.1| phosphoglucosamine mutase [Enterococcus faecium TX0133a04]
 gi|314942223|ref|ZP_07849075.1| phosphoglucosamine mutase [Enterococcus faecium TX0133C]
 gi|314948856|ref|ZP_07852226.1| phosphoglucosamine mutase [Enterococcus faecium TX0082]
 gi|314950798|ref|ZP_07853870.1| phosphoglucosamine mutase [Enterococcus faecium TX0133A]
 gi|314992222|ref|ZP_07857662.1| phosphoglucosamine mutase [Enterococcus faecium TX0133B]
 gi|314995220|ref|ZP_07860333.1| phosphoglucosamine mutase [Enterococcus faecium TX0133a01]
 gi|68195499|gb|EAN09943.1| Phosphoglucosamine mutase [Enterococcus faecium DO]
 gi|257812704|gb|EEV41462.1| phosphoglucosamine mutase [Enterococcus faecium 1,230,933]
 gi|257818556|gb|EEV45884.1| phosphoglucosamine mutase [Enterococcus faecium 1,231,502]
 gi|257825684|gb|EEV52310.1| phosphoglucosamine mutase [Enterococcus faecium 1,231,410]
 gi|260073900|gb|EEW62224.1| phosphoglucosamine mutase [Enterococcus faecium C68]
 gi|260078337|gb|EEW66042.1| phosphoglucosamine mutase [Enterococcus faecium TC 6]
 gi|289162317|gb|EFD10176.1| phosphoglucosamine mutase [Enterococcus faecium D344SRF]
 gi|291589171|gb|EFF20982.1| phosphoglucosamine mutase [Enterococcus faecium E1071]
 gi|291596320|gb|EFF27579.1| phosphoglucosamine mutase [Enterococcus faecium E1679]
 gi|291597179|gb|EFF28374.1| phosphoglucosamine mutase [Enterococcus faecium U0317]
 gi|291606227|gb|EFF35643.1| phosphoglucosamine mutase [Enterococcus faecium E1162]
 gi|313590550|gb|EFR69395.1| phosphoglucosamine mutase [Enterococcus faecium TX0133a01]
 gi|313593222|gb|EFR72067.1| phosphoglucosamine mutase [Enterococcus faecium TX0133B]
 gi|313597013|gb|EFR75858.1| phosphoglucosamine mutase [Enterococcus faecium TX0133A]
 gi|313598995|gb|EFR77840.1| phosphoglucosamine mutase [Enterococcus faecium TX0133C]
 gi|313641029|gb|EFS05609.1| phosphoglucosamine mutase [Enterococcus faecium TX0133a04]
 gi|313644729|gb|EFS09309.1| phosphoglucosamine mutase [Enterococcus faecium TX0082]
          Length = 451

 Score =  261 bits (667), Expect = 1e-67,   Method: Composition-based stats.
 Identities = 185/447 (41%), Positives = 274/447 (61%), Gaps = 8/447 (1%)

Query: 4   RFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLF---RGKKKHRRVVIGKDTRLSGYMLEN 60
           ++FGTDG+RG++N   +TP    ++G   GY+      + K  RV++G+DTR+SG MLE 
Sbjct: 3   KYFGTDGVRGEANK-ELTPELAFKLGRCGGYVLSQHEEEGKRPRVLVGRDTRISGQMLEE 61

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +L++G  + G++ F LG I +P VA LTR  +A  GVMISASHNP QDNGIK FG DG+K
Sbjct: 62  ALISGLLSVGIEVFQLGVISTPGVAYLTRLQKASAGVMISASHNPAQDNGIKFFGADGFK 121

Query: 121 VSTDIEDRIETLLEDDLTS-YLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRI 179
           +  D E  IE LL+ ++        + +G  +       +Y + + +T+     L GL I
Sbjct: 122 LVDDQELEIEALLDAEVDELPRPSAEGLGTVEEFPEGLLKYSQFLVQTING--DLSGLTI 179

Query: 180 VVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIG 239
            VD ANGA+      +F +L  D   +G  P+G+NIN   GST+   L   V E  AD G
Sbjct: 180 CVDAANGATSTSVNRLFADLETDFYTMGTNPDGLNINDGVGSTHPERLAEMVVEKGADAG 239

Query: 240 IALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAG 299
           +A DGDGDR+I VDE G IV+GD+IM + A+     + L+ + IVTTVMSN+G  + + G
Sbjct: 240 LAFDGDGDRIIAVDELGNIVDGDKIMFICAKYLAEKNRLKKDTIVTTVMSNLGFHKAVEG 299

Query: 300 LGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYD 359
           +GL    T+VGDRY++E M+ N +N GGEQSGH+I  D+ +TGDG+++ +Q+L  +KQ  
Sbjct: 300 IGLKDVVTQVGDRYVVEEMRKNDYNFGGEQSGHMIFLDFNTTGDGMLSGIQLLNIMKQTG 359

Query: 360 KPVSTICHCFEEYPQFLRSVSVKDTS-ILNSSSIVQAIADAESELRGIDRLIVRASGTES 418
           K +S +      YPQ L ++ V D +  ++  +I + I +AE+E+    R++VR SGTE 
Sbjct: 360 KKLSELAAEVTIYPQKLVNIRVSDKNGAMDVPAIKKVIEEAEAEMGSEGRILVRPSGTEP 419

Query: 419 LIRIMAEGDDLSRIKRIVDDLAKVIPM 445
           L+R+MAE     ++   VD +A V+  
Sbjct: 420 LLRVMAEAPTDEKVNYYVDKIAAVVKE 446


>gi|228474923|ref|ZP_04059652.1| phosphoglucosamine mutase [Staphylococcus hominis SK119]
 gi|314935899|ref|ZP_07843249.1| phosphoglucosamine mutase [Staphylococcus hominis subsp. hominis
           C80]
 gi|228271155|gb|EEK12535.1| phosphoglucosamine mutase [Staphylococcus hominis SK119]
 gi|313655905|gb|EFS19647.1| phosphoglucosamine mutase [Staphylococcus hominis subsp. hominis
           C80]
          Length = 450

 Score =  261 bits (667), Expect = 1e-67,   Method: Composition-based stats.
 Identities = 184/446 (41%), Positives = 273/446 (61%), Gaps = 7/446 (1%)

Query: 4   RFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFR--GKKKHRRVVIGKDTRLSGYMLENS 61
           ++FGTDG+RG +N   +TP    ++G   GY+      +KH RV++G+DTR+SG MLE++
Sbjct: 3   KYFGTDGVRGVANK-ELTPELAFKLGRYGGYVLAHNEGEKHPRVLVGRDTRVSGEMLESA 61

Query: 62  LVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKV 121
           L+AG  + G +   LG I +P VA LTR + A +G+MISASHNP  DNGIK FG DG+K+
Sbjct: 62  LIAGLASIGAEVMRLGVISTPGVAYLTREMGAQLGIMISASHNPVADNGIKFFGADGFKL 121

Query: 122 STDIEDRIETLLEDDLTSYLSCYDS-IGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           S   E+ IE LL+ +           I H         +Y+ ++K T+   + L GL+I 
Sbjct: 122 SDKQEEEIEQLLDQEQPDLPRPAGKDILHFSDYYEGAQKYLSYLKSTID--INLDGLKIT 179

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           +D ANG++  +AP +F +L A  V IG  P+G NIN +CGST+   L  KV E  +D G+
Sbjct: 180 LDGANGSTSSLAPFLFGDLEATTVTIGCNPDGYNINDECGSTHPEHLAEKVVETESDFGL 239

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           A DGDGDR+I VDEKG I++GDQIM +I ++   +  L  N IV+TVMSN+G  + +   
Sbjct: 240 AFDGDGDRLIAVDEKGNIIDGDQIMFIIGQDMHKNHELNNNMIVSTVMSNLGFYKALETE 299

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           G+   +T+VGDRY++E M+   +N+GGEQSGHI++ DY +TGDGL+  +Q+   IK   K
Sbjct: 300 GIQSNKTKVGDRYVVEEMRRGHYNLGGEQSGHIVMMDYNTTGDGLLTGVQLAAIIKSSGK 359

Query: 361 PVSTICHCFEEYPQFLRSVSVKDT-SILNSSSIVQAIADAESELRGIDRLIVRASGTESL 419
            +S +    ++YPQ L +V V D   +  +  +   + + E+E+ G  R++VR SGTE L
Sbjct: 360 TLSELAAQMKKYPQSLINVKVTDKHHVSENEDVKAVMDEVENEMNGEGRILVRPSGTEPL 419

Query: 420 IRIMAEGDDLSRIKRIVDDLAKVIPM 445
           +R+M E       +R    +A  +  
Sbjct: 420 VRVMVEAATNEDAERYAQTIANKVKE 445


>gi|52784031|ref|YP_089860.1| YbbT [Bacillus licheniformis ATCC 14580]
 gi|319649054|ref|ZP_08003263.1| phosphoglucosamine mutase [Bacillus sp. BT1B_CT2]
 gi|52346533|gb|AAU39167.1| YbbT [Bacillus licheniformis ATCC 14580]
 gi|317389048|gb|EFV69866.1| phosphoglucosamine mutase [Bacillus sp. BT1B_CT2]
          Length = 456

 Score =  261 bits (667), Expect = 1e-67,   Method: Composition-based stats.
 Identities = 187/444 (42%), Positives = 275/444 (61%), Gaps = 5/444 (1%)

Query: 4   RFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSLV 63
           ++FGTDG+RG +N   +TP    ++G   GY+    K+  +V+IG+DTR+SG+MLE +LV
Sbjct: 11  KYFGTDGVRGVAN-SELTPELAFKVGRFGGYVLTKDKERPKVLIGRDTRISGHMLEGALV 69

Query: 64  AGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVST 123
           AG  + G +   LG I +P VA LT+++ A+ GVMISASHNP QDNGIK FG DG+K+S 
Sbjct: 70  AGLLSIGAEVMRLGVISTPGVAYLTKAMDAEAGVMISASHNPVQDNGIKFFGGDGFKLSD 129

Query: 124 DIEDRIETLLEDDLTSYLSCYD-SIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVVD 182
           + E  IE L++             +G          +Y++ +K++   D T  G+ + +D
Sbjct: 130 EQELEIERLMDQPEDHLPRPVGADLGMVNDYFEGGQKYLQFLKQSADEDFT--GIHVALD 187

Query: 183 CANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIAL 242
           CA+GA+  +A  +F +L ADV  +G  PNG+NIN   GST+  +L   V E  AD+G+A 
Sbjct: 188 CAHGATSSLATHLFADLDADVSTMGTSPNGLNINDGVGSTHPEALAEFVKEKGADVGMAF 247

Query: 243 DGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLGL 302
           DGDGDR+I VDEKG IV+GDQIM + A+   S   L  N +V+TVMSN+G  + +   G+
Sbjct: 248 DGDGDRLIAVDEKGNIVDGDQIMYICAKYLKSEGRLTDNTVVSTVMSNLGFYKALEAEGI 307

Query: 303 SLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKPV 362
              +T VGDRY++E MK  GF +GGEQSGH+I  DY +TGDGL++A+ ++  IK   KP+
Sbjct: 308 KSVQTAVGDRYVVEAMKKGGFTLGGEQSGHLIFLDYNTTGDGLLSAIMLMNTIKMTGKPL 367

Query: 363 STICHCFEEYPQFLRSVSVKDT-SILNSSSIVQAIADAESELRGIDRLIVRASGTESLIR 421
           S +    +++PQ L +V V D   +  +  +   I + E E+ G  R++VR SGTE L+R
Sbjct: 368 SELAAEMQKFPQLLLNVKVTDKHKVTENEKVKAVIEEVEKEMNGDGRILVRPSGTEPLVR 427

Query: 422 IMAEGDDLSRIKRIVDDLAKVIPM 445
           +MAE       ++ V  +A V+  
Sbjct: 428 VMAEAKTKELCEKYVGRIADVVKA 451


>gi|52078669|ref|YP_077460.1| phosphoglucosamine mutase [Bacillus licheniformis ATCC 14580]
 gi|84029235|sp|Q65P47|GLMM_BACLD RecName: Full=Phosphoglucosamine mutase
 gi|52001880|gb|AAU21822.1| putative Phosphoglucosamine mutase GlmM [Bacillus licheniformis
           ATCC 14580]
          Length = 448

 Score =  261 bits (667), Expect = 1e-67,   Method: Composition-based stats.
 Identities = 187/444 (42%), Positives = 275/444 (61%), Gaps = 5/444 (1%)

Query: 4   RFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSLV 63
           ++FGTDG+RG +N   +TP    ++G   GY+    K+  +V+IG+DTR+SG+MLE +LV
Sbjct: 3   KYFGTDGVRGVAN-SELTPELAFKVGRFGGYVLTKDKERPKVLIGRDTRISGHMLEGALV 61

Query: 64  AGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVST 123
           AG  + G +   LG I +P VA LT+++ A+ GVMISASHNP QDNGIK FG DG+K+S 
Sbjct: 62  AGLLSIGAEVMRLGVISTPGVAYLTKAMDAEAGVMISASHNPVQDNGIKFFGGDGFKLSD 121

Query: 124 DIEDRIETLLEDDLTSYLSCYD-SIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVVD 182
           + E  IE L++             +G          +Y++ +K++   D T  G+ + +D
Sbjct: 122 EQELEIERLMDQPEDHLPRPVGADLGMVNDYFEGGQKYLQFLKQSADEDFT--GIHVALD 179

Query: 183 CANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIAL 242
           CA+GA+  +A  +F +L ADV  +G  PNG+NIN   GST+  +L   V E  AD+G+A 
Sbjct: 180 CAHGATSSLATHLFADLDADVSTMGTSPNGLNINDGVGSTHPEALAEFVKEKGADVGMAF 239

Query: 243 DGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLGL 302
           DGDGDR+I VDEKG IV+GDQIM + A+   S   L  N +V+TVMSN+G  + +   G+
Sbjct: 240 DGDGDRLIAVDEKGNIVDGDQIMYICAKYLKSEGRLTDNTVVSTVMSNLGFYKALEAEGI 299

Query: 303 SLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKPV 362
              +T VGDRY++E MK  GF +GGEQSGH+I  DY +TGDGL++A+ ++  IK   KP+
Sbjct: 300 KSVQTAVGDRYVVEAMKKGGFTLGGEQSGHLIFLDYNTTGDGLLSAIMLMNTIKMTGKPL 359

Query: 363 STICHCFEEYPQFLRSVSVKDT-SILNSSSIVQAIADAESELRGIDRLIVRASGTESLIR 421
           S +    +++PQ L +V V D   +  +  +   I + E E+ G  R++VR SGTE L+R
Sbjct: 360 SELAAEMQKFPQLLLNVKVTDKHKVTENEKVKAVIEEVEKEMNGDGRILVRPSGTEPLVR 419

Query: 422 IMAEGDDLSRIKRIVDDLAKVIPM 445
           +MAE       ++ V  +A V+  
Sbjct: 420 VMAEAKTKELCEKYVGRIADVVKA 443


>gi|82751758|ref|YP_417499.1| phosphoglucosamine mutase [Staphylococcus aureus RF122]
 gi|123549268|sp|Q2YYE6|GLMM_STAAB RecName: Full=Phosphoglucosamine mutase
 gi|82657289|emb|CAI81730.1| phosphoglucosamine-mutase [Staphylococcus aureus RF122]
          Length = 451

 Score =  261 bits (667), Expect = 1e-67,   Method: Composition-based stats.
 Identities = 188/445 (42%), Positives = 275/445 (61%), Gaps = 7/445 (1%)

Query: 4   RFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKK--KHRRVVIGKDTRLSGYMLENS 61
           ++FGTDG+RG +N   +TP    ++G   GY+    K  KH RV++G+DTR+SG MLE++
Sbjct: 3   KYFGTDGVRGVANQ-ELTPELAFKLGRYGGYVLAHNKGEKHPRVLVGRDTRVSGEMLESA 61

Query: 62  LVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKV 121
           L+AG  + G +   LG I +P VA LTR + A++GVMISASHNP  DNGIK FG DG+K+
Sbjct: 62  LIAGLISIGAEVMRLGIISTPGVAYLTRDMGAELGVMISASHNPVADNGIKFFGSDGFKL 121

Query: 122 STDIEDRIETLLEDDLTSYLSCYDS-IGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           S + E+ IE LL+ +         + I H         +Y+ ++K T+   V  +GL+IV
Sbjct: 122 SDEQENEIEALLDQENPELPRPVGNDIVHYSDYFEGAQKYLSYLKSTVD--VNFEGLKIV 179

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           +D ANG++  +AP +F +L AD   IG  P+G NIN  CGST+   L  KV E  +D G+
Sbjct: 180 LDGANGSTSSLAPFLFGDLEADTETIGCSPDGYNINEKCGSTHPEKLAEKVVETESDFGL 239

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           A DGDGDR+I VDE G IV+GDQIM +I +E   +  L  + IV+TVMSN+G  + +   
Sbjct: 240 AFDGDGDRIIAVDENGQIVDGDQIMFIIGQEMHKNQELNNDMIVSTVMSNLGFYKALEQE 299

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           G+   +T+VGDRY++E M+   +N+GGEQSGHI++ DY +TGDGL+  +Q+   IK   K
Sbjct: 300 GIKSNKTKVGDRYVVEEMRRGNYNLGGEQSGHIVMMDYNTTGDGLLTGIQLASVIKMTGK 359

Query: 361 PVSTICHCFEEYPQFLRSVSVKDT-SILNSSSIVQAIADAESELRGIDRLIVRASGTESL 419
            +S +    ++YPQ L +V V D   +  +  + + +   E E+ G  R++VR SGTE L
Sbjct: 360 SLSELAGQMKKYPQSLINVRVTDKYRVEENVDVKEVMTKVEVEMNGEGRILVRPSGTEPL 419

Query: 420 IRIMAEGDDLSRIKRIVDDLAKVIP 444
           +R+M E       +R    +A V+ 
Sbjct: 420 VRVMVEAATDEDAERYAQQIADVVQ 444


>gi|149181961|ref|ZP_01860448.1| YbbT [Bacillus sp. SG-1]
 gi|148850306|gb|EDL64469.1| YbbT [Bacillus sp. SG-1]
          Length = 448

 Score =  261 bits (667), Expect = 1e-67,   Method: Composition-based stats.
 Identities = 184/444 (41%), Positives = 280/444 (63%), Gaps = 5/444 (1%)

Query: 4   RFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSLV 63
           ++FGTDG+RG +NT  +TP    ++G   GY+        +++IG+DTR+SG+MLE +LV
Sbjct: 3   KYFGTDGVRGIANT-ELTPELAFKLGRFGGYVLTKDADRPKILIGRDTRISGHMLEGALV 61

Query: 64  AGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVST 123
           AG  + G +   LG I +P VA LT++L A  GVMISASHNP  DNGIK FG DG+K+S 
Sbjct: 62  AGLLSIGAEVMRLGVISTPGVAYLTKALDAQAGVMISASHNPVGDNGIKFFGSDGFKLSD 121

Query: 124 DIEDRIETLLED-DLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVVD 182
           D E  IE LL+  + T        +G          +Y++++K+++       GL I +D
Sbjct: 122 DQEKEIEDLLDQVEDTLPRPIGADLGQVSDYFEGGQKYLQYLKQSVDE--EFDGLTIALD 179

Query: 183 CANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIAL 242
           CA+GA+  +AP +F +L AD++ +G  PNG+NIN   GST+  SL   V E  AD+G+A 
Sbjct: 180 CAHGATSSLAPHLFADLDADLITMGASPNGLNINDGVGSTHPESLAELVKEKGADVGLAF 239

Query: 243 DGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLGL 302
           DGDGDR+I +DE G IV+GDQIM + A+   S + L+ + +V+TVMSN+G  + +    +
Sbjct: 240 DGDGDRLIAIDENGEIVDGDQIMFICAKHLKSEARLKQSTVVSTVMSNLGFHKGMESNDI 299

Query: 303 SLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKPV 362
              +T VGDRY++E M+ N + +GGEQSGHII  DY +TGDGL+  +Q++  +K   K +
Sbjct: 300 KSIQTAVGDRYVVEEMRKNNYTLGGEQSGHIIFLDYNTTGDGLLTGIQLVNIMKLTGKSL 359

Query: 363 STICHCFEEYPQFLRSVSVKDT-SILNSSSIVQAIADAESELRGIDRLIVRASGTESLIR 421
           S +    +++PQ L ++ V D   + +++ + + I   E+E+ G  R++VR SGTE L+R
Sbjct: 360 SELAGEMKKFPQKLVNIKVTDKYHVTDNAKVKEIIEKVEAEMNGNGRILVRPSGTEPLVR 419

Query: 422 IMAEGDDLSRIKRIVDDLAKVIPM 445
           +MAE       ++ VDD+A+V+  
Sbjct: 420 VMAEAPTEELCEKYVDDIAQVVQE 443


>gi|121998547|ref|YP_001003334.1| phosphoglucosamine mutase [Halorhodospira halophila SL1]
 gi|158705797|sp|A1WXX0|GLMM_HALHL RecName: Full=Phosphoglucosamine mutase
 gi|121589952|gb|ABM62532.1| phosphoglucosamine mutase [Halorhodospira halophila SL1]
          Length = 455

 Score =  261 bits (667), Expect = 1e-67,   Method: Composition-based stats.
 Identities = 211/440 (47%), Positives = 302/440 (68%), Gaps = 4/440 (0%)

Query: 2   KRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENS 61
           +R +FGTDGIRG+    PITP+F++R+G A G +  G+ + R+VVIGKDTRLSGYM E++
Sbjct: 4   ERSYFGTDGIRGRVGEAPITPDFVLRLGWAAGRVLAGEGQ-RKVVIGKDTRLSGYMFESA 62

Query: 62  LVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKV 121
           L AGF AAG+ + +LGP+P+PA+A LTR+L A  GV+ISASHNP+ DNGIK FGPDGYK+
Sbjct: 63  LEAGFAAAGVHSLMLGPMPTPAIAYLTRTLHARAGVVISASHNPHHDNGIKFFGPDGYKL 122

Query: 122 STDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVV 181
               E+ IE LL+D     + C + +G A R++    RYIE  K ++ R + L+GLR+VV
Sbjct: 123 DDATEEAIERLLQDGPPQMVRC-EELGRATRINDAVGRYIEFCKGSVQRQIDLRGLRVVV 181

Query: 182 DCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIA 241
           DCA+GA+Y+ AP V  ELGADVVVIG++P+G+NIN+D GS +   L ++V E  AD+G+A
Sbjct: 182 DCAHGATYQAAPAVLAELGADVVVIGNEPDGLNINVDHGSQHPERLCQRVVEASADVGVA 241

Query: 242 LDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLG 301
            DGDGDRVI+VD  G +++GD ++ +IA   ++        +V T M+N+GLE  +  LG
Sbjct: 242 FDGDGDRVIMVDRYGRVIDGDGLLYIIATARVAR-GQVRGAVVGTQMTNLGLEVALQELG 300

Query: 302 LSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKP 361
           L L+RT VGDRY++E +   G  +GGE SGHII  D  +TGDGL++ALQVL  +    +P
Sbjct: 301 LVLERTRVGDRYVLERLLQVGGTLGGESSGHIICLDRTTTGDGLISALQVLEAMVTTGRP 360

Query: 362 VSTICHCFEEYPQFLRSVSV-KDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
           +  +      YPQ L +V V +   ++   ++ +A+ +AE +L    R+++R SGTE L+
Sbjct: 361 LDELVAGMHYYPQRLVNVPVSRGPDVIRLPAVTEAVEEAEHQLGDHGRVLLRPSGTEPLL 420

Query: 421 RIMAEGDDLSRIKRIVDDLA 440
           R+M EG D  ++ R+ D LA
Sbjct: 421 RVMVEGADEGQVNRLADWLA 440


>gi|163789873|ref|ZP_02184309.1| phosphoglucosamine mutase [Carnobacterium sp. AT7]
 gi|159874813|gb|EDP68881.1| phosphoglucosamine mutase [Carnobacterium sp. AT7]
          Length = 452

 Score =  261 bits (667), Expect = 1e-67,   Method: Composition-based stats.
 Identities = 180/447 (40%), Positives = 275/447 (61%), Gaps = 8/447 (1%)

Query: 4   RFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLF---RGKKKHRRVVIGKDTRLSGYMLEN 60
           ++FGTDG+RG +N   +TP    ++G   G++       +KH RV++G+DTR+SG MLE+
Sbjct: 3   KYFGTDGVRGVAN-SELTPELAFKLGRYGGFVLTQHAEGEKHPRVLVGRDTRISGEMLES 61

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +L+AG  + G++   LG I +P VA LTR   A  GVMISASHNP  DNGIK FG DG+K
Sbjct: 62  ALIAGLLSVGIEVMKLGIISTPGVAYLTRVQGAAAGVMISASHNPAPDNGIKFFGSDGFK 121

Query: 121 VSTDIEDRIETLLEDDLTS-YLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRI 179
           +S + E  IE LL++D  +        +G          +Y + +++T+P    L GL++
Sbjct: 122 LSDETELEIEALLDEDNDNLPRPIAQGLGTVDEYPEGALKYTQFLQQTIPN--DLAGLQV 179

Query: 180 VVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIG 239
            +D ANG++  +   +F +L  +  V+   PNG+NIN   GST+  +L + V E  AD G
Sbjct: 180 CLDGANGSTSPLINRLFADLETEFDVMAATPNGLNINDGVGSTHPENLAKFVVEKGADAG 239

Query: 240 IALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAG 299
           +A DGDGDRVI VDE G I++GD+IM +  +       L+ + IV+TVMSN+G  + I  
Sbjct: 240 LAFDGDGDRVIAVDELGNIIDGDKIMFICGKYLQEKGRLKKDTIVSTVMSNLGFHKAIEA 299

Query: 300 LGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYD 359
             +   +T+VGDRY++E M+ NG+N GGEQSGH++  DY +TGDG+++ +Q+L  +K+  
Sbjct: 300 NNMIALQTKVGDRYVVEEMRKNGYNFGGEQSGHMVFLDYNTTGDGMLSGIQLLNVMKETG 359

Query: 360 KPVSTICHCFEEYPQFLRSVSVKDTS-ILNSSSIVQAIADAESELRGIDRLIVRASGTES 418
           K +S +    + YPQ L ++ V D +  ++  +I   I + ESE+ G  R++VR SGTE 
Sbjct: 360 KKLSELAAEVQTYPQKLVNIRVSDKNGAMDVPAIKAIIDEVESEMNGDGRILVRPSGTEP 419

Query: 419 LIRIMAEGDDLSRIKRIVDDLAKVIPM 445
           L+R+MAE     ++   VD +A V+  
Sbjct: 420 LLRVMAEAPSQEKVNLYVDRIASVVKE 446


>gi|167036895|ref|YP_001664473.1| phosphoglucosamine mutase [Thermoanaerobacter pseudethanolicus ATCC
           33223]
 gi|320115314|ref|YP_004185473.1| phosphoglucosamine mutase [Thermoanaerobacter brockii subsp. finnii
           Ako-1]
 gi|226723930|sp|B0KD39|GLMM_THEP3 RecName: Full=Phosphoglucosamine mutase
 gi|166855729|gb|ABY94137.1| phosphoglucosamine mutase [Thermoanaerobacter pseudethanolicus ATCC
           33223]
 gi|319928405|gb|ADV79090.1| phosphoglucosamine mutase [Thermoanaerobacter brockii subsp. finnii
           Ako-1]
          Length = 447

 Score =  261 bits (667), Expect = 1e-67,   Method: Composition-based stats.
 Identities = 201/447 (44%), Positives = 282/447 (63%), Gaps = 7/447 (1%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M R  FGTDG+RG +N + +TP     +G A  Y+        +VV+GKD+R+SG MLE 
Sbjct: 1   MAR-LFGTDGVRGIAN-YDLTPQLAFELGRAGAYVLTHGTHRPKVVVGKDSRISGDMLEC 58

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +L AG T+ G +   +G IP+PAVA LTR  +AD GVMISASHNP + NGIK F  DGYK
Sbjct: 59  ALTAGLTSVGAEVISVGIIPTPAVAYLTRLYQADAGVMISASHNPVEYNGIKFFDKDGYK 118

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +  ++EDRIE ++++ +         IG  K     H  YIE +K T+     L+ ++IV
Sbjct: 119 LPDEVEDRIENIIKEKIELPSPIGTGIGTRKEYTNSHRDYIEFLKSTIDG--DLKEMKIV 176

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           +DCA GAS  +AP +F ELGA+V++ G +P G  IN++CGST+   LQ+ V E  ADIG+
Sbjct: 177 IDCAYGASSTIAPILFKELGAEVILHGAEPIGEKINVNCGSTHPEKLQQLVIENGADIGL 236

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           A DGD DR+I VDEKG +V+GD IMA+ A +      L+ N +V TVMSNIG E  +   
Sbjct: 237 AFDGDADRLIAVDEKGNVVDGDHIMAICAIDLKKKGRLKNNTVVATVMSNIGFEIALKEQ 296

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           G++L RT+VGDRY++E M   G+++GGEQSGHII  D  +TGDG + AL++    K+  K
Sbjct: 297 GINLIRTKVGDRYVLEEMTKGGYSIGGEQSGHIIFLDDNTTGDGEITALKLCSISKESGK 356

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTSI---LNSSSIVQAIADAESELRGIDRLIVRASGTE 417
            +S +  C   YPQ L +  VK+      L    I + I + E E+RG  R+++R SGTE
Sbjct: 357 KLSELAACMITYPQVLINAKVKNELKNAYLEDEEIKREIENLEREMRGEGRVLIRPSGTE 416

Query: 418 SLIRIMAEGDDLSRIKRIVDDLAKVIP 444
            L+R+M EG D  +I ++  +LA++I 
Sbjct: 417 PLVRVMVEGKDYDKISQMAKELAELIE 443


>gi|240128617|ref|ZP_04741278.1| MrsA [Neisseria gonorrhoeae SK-93-1035]
 gi|268687005|ref|ZP_06153867.1| phosphoglucosamine mutase [Neisseria gonorrhoeae SK-93-1035]
 gi|268627289|gb|EEZ59689.1| phosphoglucosamine mutase [Neisseria gonorrhoeae SK-93-1035]
          Length = 444

 Score =  261 bits (667), Expect = 1e-67,   Method: Composition-based stats.
 Identities = 194/445 (43%), Positives = 291/445 (65%), Gaps = 6/445 (1%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKK--KHRRVVIGKDTRLSGYML 58
           M +++FGTDG+RG+   FPITP+F++++G A G +       +   V+IGKDTR+SGYML
Sbjct: 1   MAKKYFGTDGVRGEVGQFPITPDFVLKLGYAAGQVLVQHDTDQKPTVLIGKDTRISGYML 60

Query: 59  ENSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDG 118
           E +LVAGFTAAG++    GP+P+P VA LTR+LR   GVMISASHN Y DNGIK F   G
Sbjct: 61  EAALVAGFTAAGVNVVQTGPLPTPGVAYLTRALRLSAGVMISASHNTYSDNGIKFFAEGG 120

Query: 119 YKVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLR 178
            K+S ++E  IE  +++++ +       +G A+R+ G  DRYIE  K T P    L+GL+
Sbjct: 121 VKLSDEVELEIEAKIDEEMKTQP--SARLGRARRISGADDRYIEFCKSTFPGHSDLRGLK 178

Query: 179 IVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADI 238
           +V+D ANGA Y VAP+VF ELGA VV IG++PNG NIN  CG+T+  +LQ  V +  AD 
Sbjct: 179 LVIDTANGAGYGVAPKVFHELGAQVVSIGNEPNGYNINEKCGATHTKTLQAAVLQNEADY 238

Query: 239 GIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIA 298
           GIALDGDGDR+++VD+   + +GD ++ +IA+   +   +   G+V TVM+N+ +E  + 
Sbjct: 239 GIALDGDGDRLMMVDKNRQVYDGDSLIYVIAK-ARAREGINIGGVVGTVMTNMAIEIALK 297

Query: 299 GLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQY 358
             G+   R +VGDRY++E +   G+ +GGE SGHI+  D  +TGDG+++ALQVL  ++  
Sbjct: 298 EQGVDFCRAKVGDRYVLEQLNQRGWLIGGEASGHILCMDKHNTGDGIISALQVLAALQIL 357

Query: 359 DKPVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTES 418
           ++ ++T+C  ++ YPQ + +V ++       +S    +A+ E EL G  R+++RASGTE 
Sbjct: 358 NQDLATVCADWQPYPQTMINVRIQKGQKWQEAS-KDVLAEVEKELEGKGRVVLRASGTEP 416

Query: 419 LIRIMAEGDDLSRIKRIVDDLAKVI 443
           ++R+M E       +   + +A  I
Sbjct: 417 VVRVMVEARQADWARDGAERIAAAI 441


>gi|329121883|ref|ZP_08250498.1| phosphoglucosamine mutase [Dialister micraerophilus DSM 19965]
 gi|327467821|gb|EGF13313.1| phosphoglucosamine mutase [Dialister micraerophilus DSM 19965]
          Length = 449

 Score =  261 bits (667), Expect = 1e-67,   Method: Composition-based stats.
 Identities = 186/443 (41%), Positives = 278/443 (62%), Gaps = 4/443 (0%)

Query: 4   RFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSLV 63
           + FGTDG+RG  N+  + P    ++G A G  F  ++   + +IG DTR+SG ML  SL 
Sbjct: 3   KLFGTDGVRGVVNSSLM-PELAYQLGRAAGAYFCKREGRHKFLIGMDTRISGTMLMASLA 61

Query: 64  AGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVST 123
           +G  ++G+D  I G IP+PA+A LTR    D GV+ISASHNP++DNGIK F  +GYK+  
Sbjct: 62  SGLCSSGVDVDIAGVIPTPAIAYLTRVEGYDAGVVISASHNPFRDNGIKFFDKNGYKLPD 121

Query: 124 DIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVVDC 183
            +E+ IE +L  +          +G  ++   + ++Y ++V  T      L+G++IV D 
Sbjct: 122 SMENEIEDILRHNELIPRPLGADVGVIRQRTELAEKYRKYVASTA--FQDLKGMKIVTDS 179

Query: 184 ANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIALD 243
           ANGA+ K  PE+   LG DVV +  +P+G+NIN +CGST++ +LQ++V E  A  GIA D
Sbjct: 180 ANGAASKFMPEILRVLGVDVVALSCEPDGVNINENCGSTHIEALQKRVVEEGAICGIAND 239

Query: 244 GDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLGLS 303
           GD DR ++VDE+G +++GD IM + A      + L+ N +V TVMSN+G  + +   G  
Sbjct: 240 GDADRCLLVDEEGNVLDGDHIMLINALHMKEKNQLKDNMVVGTVMSNLGFGKALKEHGCK 299

Query: 304 LKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKPVS 363
              T VGDRY++E M+ + +++GGEQSGHII   + +TGDGL+ A+Q +  +K+  K +S
Sbjct: 300 TVSTRVGDRYVLEEMRKHDYSLGGEQSGHIIFPQFNTTGDGLITAVQTMCVLKESGKKLS 359

Query: 364 TICHCFEEYPQFLRSVSVKDTS-ILNSSSIVQAIADAESELRGIDRLIVRASGTESLIRI 422
            +      YPQ L++V V   +   N+  I  +IA AE EL G  R++VRASGTE LIR+
Sbjct: 360 DLRKLMTTYPQVLKNVEVYSKNGWENNELIQNSIASAEEELNGEGRILVRASGTEPLIRV 419

Query: 423 MAEGDDLSRIKRIVDDLAKVIPM 445
           M EG DL +++RI+DD+A V+  
Sbjct: 420 MGEGKDLDQLQRIIDDIASVVEQ 442


>gi|260752546|ref|YP_003225439.1| phosphoglucosamine mutase [Zymomonas mobilis subsp. mobilis NCIMB
           11163]
 gi|258551909|gb|ACV74855.1| phosphoglucosamine mutase [Zymomonas mobilis subsp. mobilis NCIMB
           11163]
          Length = 445

 Score =  261 bits (667), Expect = 2e-67,   Method: Composition-based stats.
 Identities = 245/444 (55%), Positives = 324/444 (72%), Gaps = 2/444 (0%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M R++FGTDGIRG +N  P+T +  MR+G A G  F+      RV+IGKDTRLSGYM+E+
Sbjct: 1   MSRQYFGTDGIRGCTNKDPMTADVAMRVGQAAGAYFKRGLHRHRVLIGKDTRLSGYMVES 60

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +L+AGFT+ GMD  ++GP+P+P VA+LTRS+RAD+GVMISASHNP+ DNGIKLFGP+GYK
Sbjct: 61  ALMAGFTSVGMDVVLVGPLPTPGVALLTRSMRADLGVMISASHNPFSDNGIKLFGPNGYK 120

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +S + E  IE  ++      L+    IG A+R+D    RYI  VK + P  + L  LR+V
Sbjct: 121 LSEEEEKAIEEAIDQ--PPLLAAPADIGRARRIDDAQGRYIHAVKSSFPESLRLDKLRLV 178

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           +DCANGA+Y+VAP V WELGA+V+ +G  PNG+NIN  CGST+  +LQ+KV E RAD+GI
Sbjct: 179 LDCANGAAYQVAPTVLWELGAEVITLGVAPNGLNINDHCGSTDPSALQKKVLETRADLGI 238

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           ALDGD DRVIIVDEKG IV+GDQIMALIA      +LL+GN  V TVMSN+GLER+++ L
Sbjct: 239 ALDGDADRVIIVDEKGEIVDGDQIMALIATSAQKRNLLKGNTTVATVMSNLGLERYLSKL 298

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           G+ L RT+VGDR+++E M+  G+ VGGEQSGHIILS + +TGDGLVAALQVL  + Q DK
Sbjct: 299 GIQLLRTQVGDRHVVEAMRAGGYTVGGEQSGHIILSYHTTTGDGLVAALQVLADLVQSDK 358

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
             S + H F+ +PQ L++V       L   S+ +AI++AE  L+G  RL++R SGTE LI
Sbjct: 359 KASELLHVFDPFPQLLKNVRYSSGQPLEDESVCEAISEAEESLKGKGRLLIRKSGTEPLI 418

Query: 421 RIMAEGDDLSRIKRIVDDLAKVIP 444
           R+MAE +D   + +IVD + + + 
Sbjct: 419 RVMAEAEDPDLVHQIVDHICETVR 442


>gi|298695429|gb|ADI98651.1| phosphoglucosamine-mutase [Staphylococcus aureus subsp. aureus
           ED133]
          Length = 451

 Score =  261 bits (667), Expect = 2e-67,   Method: Composition-based stats.
 Identities = 188/445 (42%), Positives = 274/445 (61%), Gaps = 7/445 (1%)

Query: 4   RFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKK--KHRRVVIGKDTRLSGYMLENS 61
           ++FGTDG+RG +N   +TP    ++G   GY+    K  KH RV++G+DTR+SG MLE++
Sbjct: 3   KYFGTDGVRGVANQ-ELTPELAFKLGRYGGYVLAHNKGEKHPRVLVGRDTRVSGEMLESA 61

Query: 62  LVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKV 121
           L+AG  + G +   LG I +P VA LTR + A++GVMISASHNP  DNGIK FG DG+K+
Sbjct: 62  LIAGLISIGAEVMRLGIISTPGVAYLTRDMGAELGVMISASHNPVADNGIKFFGSDGFKL 121

Query: 122 STDIEDRIETLLEDDLTSYLSCYDS-IGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           S + E+ IE LL+ +         + I H         +Y+ ++K T+   V  +GL+IV
Sbjct: 122 SDEQENEIEALLDQENPELPRPVGNDIVHYSDYFEGAQKYLSYLKSTVD--VNFEGLKIV 179

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           +D ANG++  +AP +F +L AD   IG  P+G NIN  CGST+   L  KV E  +D G+
Sbjct: 180 LDGANGSTSSLAPFLFGDLEADTETIGCSPDGYNINEKCGSTHPEKLAEKVVETESDFGL 239

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           A DGDGDR+I VDE G IV+GDQIM +I +E   +  L  + IV+TVMSN+G  + +   
Sbjct: 240 AFDGDGDRIIAVDENGQIVDGDQIMFIIGQEMHKNQELNNDMIVSTVMSNLGFYKALEQE 299

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           G+   +T+VGDRY++E M    +N+GGEQSGHI++ DY +TGDGL+  +Q+   IK   K
Sbjct: 300 GIKSNKTKVGDRYVVEEMCRGNYNLGGEQSGHIVMMDYNTTGDGLLTGIQLASVIKMTGK 359

Query: 361 PVSTICHCFEEYPQFLRSVSVKDT-SILNSSSIVQAIADAESELRGIDRLIVRASGTESL 419
            +S +    ++YPQ L +V V D   +  +  + + +   E E+ G  R++VR SGTE L
Sbjct: 360 SLSELAGQMKKYPQSLINVRVTDKYRVEENVDVKEVMTKVEVEMNGEGRILVRPSGTEPL 419

Query: 420 IRIMAEGDDLSRIKRIVDDLAKVIP 444
           +R+M E       +R    +A V+ 
Sbjct: 420 VRVMVEAATDEDAERFAQQIADVVQ 444


>gi|282892167|ref|ZP_06300641.1| hypothetical protein pah_c209o043 [Parachlamydia acanthamoebae str.
           Hall's coccus]
 gi|281497968|gb|EFB40313.1| hypothetical protein pah_c209o043 [Parachlamydia acanthamoebae str.
           Hall's coccus]
          Length = 459

 Score =  261 bits (666), Expect = 2e-67,   Method: Composition-based stats.
 Identities = 196/446 (43%), Positives = 289/446 (64%), Gaps = 2/446 (0%)

Query: 2   KRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENS 61
             + FGTDG+RGK+N  P+T    + +G A G +FR  +   RVVIGKDTRLS YM EN+
Sbjct: 7   SEKIFGTDGVRGKANRSPMTVETALALGRAAGKIFRSHEGKHRVVIGKDTRLSCYMFENA 66

Query: 62  LVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKV 121
           L++G  + G+D  ++GP+P+P VA +TR+ RAD G++ISASHNPY DNGIK F  DG+K+
Sbjct: 67  LISGLCSMGVDTLMVGPLPTPGVAFITRAYRADAGIVISASHNPYYDNGIKFFSSDGFKL 126

Query: 122 STDIEDRIETLLEDDLTSYLSCYDS-IGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
               E ++E L+  +        D  IG   +V     RYIE  K T PR ++L+ L I 
Sbjct: 127 PDTWEKQMEELVSTNNFDDSLPADHDIGKNFKVTDADGRYIEFAKATFPRRLSLKNLTIA 186

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           +DCANGA YKVAP +F EL A V V G+ P+G+NINL CGS    ++Q+ V E RAD+GI
Sbjct: 187 LDCANGAGYKVAPLIFRELDAKVFVYGNNPDGLNINLQCGSLYPETIQKAVIEHRADVGI 246

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           ALDGD DRVI+VDE   I++GD I+A+ A++     +L+GN +V+T+MSN G  + +  L
Sbjct: 247 ALDGDADRVIMVDENAQIIDGDTILAICAKDMQRRGILKGNKVVSTIMSNFGFVKAMEEL 306

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           G+ + +++VGDRY+++ M  +  N+GGEQSGH+I  D+ +TGDGLV ALQV+R + + D 
Sbjct: 307 GIEVIKSQVGDRYVIQDMLEHDANLGGEQSGHLIFLDHNTTGDGLVCALQVMRIMIETDS 366

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTSILNS-SSIVQAIADAESELRGIDRLIVRASGTESL 419
            +S +    ++YPQ   +V V       +   + Q +A+ E  L    R+++R SGTE++
Sbjct: 367 KLSDLAALVKKYPQVCVNVKVSSKPTFEALPGVNQKVAEVEEILGDSGRVLLRYSGTENI 426

Query: 420 IRIMAEGDDLSRIKRIVDDLAKVIPM 445
            R+M EG  L +++++ + +A  +  
Sbjct: 427 CRVMVEGPKLQQVQQLANQIADEVRK 452


>gi|103486450|ref|YP_616011.1| phosphoglucosamine mutase [Sphingopyxis alaskensis RB2256]
 gi|122985138|sp|Q1GUJ4|GLMM_SPHAL RecName: Full=Phosphoglucosamine mutase
 gi|98976527|gb|ABF52678.1| phosphoglucosamine mutase [Sphingopyxis alaskensis RB2256]
          Length = 444

 Score =  261 bits (666), Expect = 2e-67,   Method: Composition-based stats.
 Identities = 258/443 (58%), Positives = 319/443 (72%), Gaps = 2/443 (0%)

Query: 3   RRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSL 62
           RRFFGTDGIRG +N  P+T    MR+G+A G  F       RVVIGKDTRLSGYMLEN+L
Sbjct: 2   RRFFGTDGIRGLTNKVPMTAEVAMRVGMAAGAHFLRGDHKHRVVIGKDTRLSGYMLENAL 61

Query: 63  VAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVS 122
           VAGFT+ GMD   +GP+P+PA+AMLTRS+RAD+GVMISASHNPYQDNGIKLFGPDGYK+S
Sbjct: 62  VAGFTSVGMDVVQVGPMPTPAIAMLTRSMRADLGVMISASHNPYQDNGIKLFGPDGYKLS 121

Query: 123 TDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVVD 182
              E  IE LL ++    L+    IG AKR+D    RYI  VK++LP+ V L GLRIV+D
Sbjct: 122 DADEAAIERLLVEE--PRLADATHIGRAKRIDDARGRYIHAVKQSLPQMVRLDGLRIVLD 179

Query: 183 CANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIAL 242
           CANGA+Y  AP VFWELGADVV IG +PNG NIN  CGST    LQ  V    ADIGIAL
Sbjct: 180 CANGAAYNSAPTVFWELGADVVAIGVEPNGTNINDKCGSTAPALLQETVVASGADIGIAL 239

Query: 243 DGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLGL 302
           DGD DR+I+VDEKG+I++GDQIM LI   W     L+G G+V TVMSN+GLERF+ G GL
Sbjct: 240 DGDADRLIVVDEKGSIIDGDQIMGLIGASWARQGRLKGGGVVATVMSNLGLERFLEGQGL 299

Query: 303 SLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKPV 362
            L+RT+VGDR+++E MK  GFNVGGEQSGH+ILSD+ +TGDG +AALQ+L  +   ++P 
Sbjct: 300 RLERTKVGDRHVLERMKEGGFNVGGEQSGHMILSDHATTGDGTLAALQLLAELVAAERPA 359

Query: 363 STICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLIRI 422
           S + H F+  PQ L++V       L    ++ AIA+ E+ L G  RL++R SGTE LIR+
Sbjct: 360 SELLHQFDPVPQLLKNVRFAGGKPLEDKQVLAAIAEGEAALNGRGRLVIRPSGTEPLIRV 419

Query: 423 MAEGDDLSRIKRIVDDLAKVIPM 445
           MAEGDD   ++R+VD +   +  
Sbjct: 420 MAEGDDAGEVERVVDMICDAVRA 442


>gi|242371648|ref|ZP_04817222.1| phosphoglucosamine-mutase [Staphylococcus epidermidis M23864:W1]
 gi|242350654|gb|EES42255.1| phosphoglucosamine-mutase [Staphylococcus epidermidis M23864:W1]
          Length = 451

 Score =  261 bits (666), Expect = 2e-67,   Method: Composition-based stats.
 Identities = 189/446 (42%), Positives = 276/446 (61%), Gaps = 7/446 (1%)

Query: 4   RFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKK--KHRRVVIGKDTRLSGYMLENS 61
           ++FGTDG+RG +N   +TP    ++G   GY+    K  KH +V++G+DTR+SG MLE++
Sbjct: 3   KYFGTDGVRGIANQ-ELTPELAFKLGRYGGYVLAHNKGEKHPKVLVGRDTRVSGEMLESA 61

Query: 62  LVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKV 121
           L+AG  + G +   LG I +P VA LT+ + A +GVMISASHNP  DNGIK FG DG+K+
Sbjct: 62  LIAGLISIGAEVMRLGIISTPGVAYLTKEMEAALGVMISASHNPVADNGIKFFGSDGFKL 121

Query: 122 STDIEDRIETLLEDDLTSYLSCY-DSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           S D E+ IETLL+ D         + I H         +Y+ ++K T+   V  +GL+I 
Sbjct: 122 SDDQENEIETLLDQDNPELPRPVGEDIVHYSDYFEGAQKYLSYLKSTVD--VNFEGLKIA 179

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           +D ANG++  +AP +F +L AD   IG  P+G NIN  CGST+   L  KV E  +D G+
Sbjct: 180 LDGANGSTSSLAPFLFGDLEADTETIGCSPDGYNINEQCGSTHPEKLAEKVLETESDFGL 239

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           A DGDGDR+I VDEKG IV+GDQIM +I +E   +  L  + IV+TVMSN+G  + +   
Sbjct: 240 AFDGDGDRIIAVDEKGQIVDGDQIMFIIGQEMHKNHELNNDMIVSTVMSNLGFYKALENE 299

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           G+   +T+VGDRY++E M+   +N+GGEQSGHI+L DY +TGDGL+  +Q+   IK   K
Sbjct: 300 GIQSNKTKVGDRYVVEEMRRGNYNLGGEQSGHIVLMDYNTTGDGLLTGVQLASVIKMSGK 359

Query: 361 PVSTICHCFEEYPQFLRSVSVKDT-SILNSSSIVQAIADAESELRGIDRLIVRASGTESL 419
            +S +    ++YPQ L +V V D   +  +  + + +   E+ + G  R++VR SGTE L
Sbjct: 360 SLSELAAQMKKYPQSLINVRVTDKYRVEENIHVQEVMTKVETAMNGEGRILVRPSGTEPL 419

Query: 420 IRIMAEGDDLSRIKRIVDDLAKVIPM 445
           +R+M E       +R   ++A V+  
Sbjct: 420 VRVMVEAATDEDAQRYAQEIADVVKE 445


>gi|73662033|ref|YP_300814.1| phosphoglucosamine mutase [Staphylococcus saprophyticus subsp.
           saprophyticus ATCC 15305]
 gi|84029257|sp|Q49ZA7|GLMM_STAS1 RecName: Full=Phosphoglucosamine mutase
 gi|72494548|dbj|BAE17869.1| phosphoglucosamine-mutase [Staphylococcus saprophyticus subsp.
           saprophyticus ATCC 15305]
          Length = 451

 Score =  261 bits (666), Expect = 2e-67,   Method: Composition-based stats.
 Identities = 191/448 (42%), Positives = 277/448 (61%), Gaps = 8/448 (1%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFR--GKKKHRRVVIGKDTRLSGYML 58
           M + +FGTDG+RG +N   +TP    ++G   GY+      +KH +V++G+DTR+SG ML
Sbjct: 1   MAK-YFGTDGVRGVANK-ELTPELAFKLGRYGGYVLAHNEGEKHPKVLVGRDTRVSGEML 58

Query: 59  ENSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDG 118
           E++L+AG  + G +   LG I +P VA LTR + AD+GVMISASHNP  DNGIK FG DG
Sbjct: 59  ESALIAGLISIGAEVMRLGVISTPGVAYLTREMEADLGVMISASHNPVPDNGIKFFGSDG 118

Query: 119 YKVSTDIEDRIETLLEDDLTSYLSCY-DSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGL 177
           +K+S D E  IE LL+ D         + I H         +YI ++K T+   V L G+
Sbjct: 119 FKLSDDQEQEIEHLLDQDNPDLPRPVGEDIVHYSDYFEGAQKYISYLKSTVD--VDLAGM 176

Query: 178 RIVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRAD 237
           +I +D A+G++  +AP +F +L AD V IG  PNG NIN + GST+  SL + V E   D
Sbjct: 177 KIALDGAHGSTSSLAPFLFGDLEADTVTIGCNPNGYNINQEVGSTHPESLAKVVVESECD 236

Query: 238 IGIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFI 297
            G+A DGDGDR+I +DEKG IV+GDQIM +I +    +  L  N IV+TVMSN+G  + +
Sbjct: 237 FGLAFDGDGDRLIAIDEKGNIVDGDQIMFIIGQAMSKNQELNNNMIVSTVMSNLGFYKAL 296

Query: 298 AGLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQ 357
              G+   +T+VGDRY++E M+   +N+GGEQSGHI+L DY +TGDGL+  +Q+   IK 
Sbjct: 297 ENEGIQSNKTKVGDRYVVEEMRRGNYNLGGEQSGHIVLMDYNTTGDGLLTGVQLASIIKM 356

Query: 358 YDKPVSTICHCFEEYPQFLRSVSVKDT-SILNSSSIVQAIADAESELRGIDRLIVRASGT 416
             K +S +    ++YPQ L +V V D   +  +  + + +   E E+ G  R++VR SGT
Sbjct: 357 TGKSLSQLTSQMKKYPQSLVNVRVTDKYRVEENIDVQEIMTKVEVEMNGEGRILVRPSGT 416

Query: 417 ESLIRIMAEGDDLSRIKRIVDDLAKVIP 444
           E L+R+M E       +R  + +A+V+ 
Sbjct: 417 EPLVRVMVEAATDEDAQRYANTIAEVVQ 444


>gi|323706401|ref|ZP_08117964.1| phosphoglucosamine mutase [Thermoanaerobacterium xylanolyticum
           LX-11]
 gi|323534237|gb|EGB24025.1| phosphoglucosamine mutase [Thermoanaerobacterium xylanolyticum
           LX-11]
          Length = 447

 Score =  261 bits (666), Expect = 2e-67,   Method: Composition-based stats.
 Identities = 190/448 (42%), Positives = 274/448 (61%), Gaps = 7/448 (1%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M R  FGTDG+RG +N   +TP     +G A  Y+     +  +++IG+D+R+SG ML++
Sbjct: 1   MAR-LFGTDGVRGIANK-DLTPQLAFELGRAGAYVLTECSRRPKILIGRDSRVSGDMLKS 58

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +L AG T+ G +    G IP+PAVA LTR  + D GV+ISASHNP + NGIK F  DGYK
Sbjct: 59  ALTAGLTSVGAEVIDAGIIPTPAVAYLTRHYKLDAGVVISASHNPVEYNGIKFFNKDGYK 118

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +  ++ED+IE ++ +           +G+A   +     YIE +K T+     L+GLR+V
Sbjct: 119 LPDEVEDKIEKIINEKSQLPTPTGLDVGNAVESESAQRDYIEFLKSTID--CDLKGLRVV 176

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           +DCA GAS  VAP +F ELGADV++ G  PNG  IN+ CGSTN   LQ  V    AD+G 
Sbjct: 177 LDCAYGASSTVAPILFHELGADVILYGSHPNGEKINVKCGSTNPKVLQEIVAGTGADVGF 236

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           A DGD DR+I VDE G +V+GD IM +      +   L  N +V TVMSNIGL+  +   
Sbjct: 237 AFDGDADRLIAVDENGDVVDGDHIMVMCGIHLKNTGKLNKNTVVVTVMSNIGLDIALKRN 296

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           G+ + +T+VGDRY++E M  NG+++GGEQSGHII  D+ +TGDG + AL+V   + +  K
Sbjct: 297 GIDVVKTKVGDRYVLEEMVKNGYSIGGEQSGHIIFLDHNTTGDGEITALKVAELLVKSGK 356

Query: 361 PVSTICHCFEEYPQFLRSVSVKDT---SILNSSSIVQAIADAESELRGIDRLIVRASGTE 417
            +S + +    YPQ L +  VK+      ++   I + I   E E++G  R+++R SGTE
Sbjct: 357 KMSQLANVMVSYPQVLINAKVKNELKYKYMDDEDIAREIEKLEEEMKGEGRVLIRPSGTE 416

Query: 418 SLIRIMAEGDDLSRIKRIVDDLAKVIPM 445
            L+R+M EG D  +I+ +  +LA +I  
Sbjct: 417 PLVRVMVEGKDQEKIESMARELANLIEK 444


>gi|170719902|ref|YP_001747590.1| phosphoglucosamine mutase [Pseudomonas putida W619]
 gi|226723906|sp|B1J265|GLMM_PSEPW RecName: Full=Phosphoglucosamine mutase
 gi|169757905|gb|ACA71221.1| phosphoglucosamine mutase [Pseudomonas putida W619]
          Length = 446

 Score =  261 bits (666), Expect = 2e-67,   Method: Composition-based stats.
 Identities = 198/448 (44%), Positives = 297/448 (66%), Gaps = 6/448 (1%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M R++FGTDGIRG+   +PITP+FM+++G A G  FR +  + RV++GKDTR+SGYM E+
Sbjct: 1   MSRKYFGTDGIRGRVGEYPITPDFMLKLGWAAGMAFRKQG-NCRVLVGKDTRISGYMFES 59

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +L AG +AAG D  +LGP+P+PA+A LTR+  A+ G++ISASHNP+ DNGIK F   G K
Sbjct: 60  ALEAGLSAAGADVLLLGPMPTPAIAYLTRTFHAEAGIVISASHNPHDDNGIKFFSGQGTK 119

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +  +IE  IE LL+  +T  +     +G   R++    RYIE  K ++P     +GL++V
Sbjct: 120 LPDEIELMIEELLDQPMT--VVDSSKLGKVSRINDAAGRYIEFCKSSVPTSTGFEGLKLV 177

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           VDCA+GA+YKVAP VF ELGA+V V+  +P+G+NIN +CGST++ SLQ  V    AD+GI
Sbjct: 178 VDCAHGATYKVAPSVFRELGAEVTVLHAQPDGLNINENCGSTHIESLQAAVLVGHADLGI 237

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           A DGDGDRV++VD  GAIV+GD+++ +IAR+      L+G  + T  MSN+GLE  +  L
Sbjct: 238 AFDGDGDRVLMVDHTGAIVDGDELLFIIARDLHERGKLQGGVVGTL-MSNLGLELALKDL 296

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
            +   R +VGDRY+M  +   G+ VGGE SGH++  ++ +TGD ++AALQVL  +++  +
Sbjct: 297 DIPFVRAKVGDRYVMAELLERGWLVGGENSGHVVCCNHTTTGDAIIAALQVLLALRRRGE 356

Query: 361 PVSTICHCFEEYPQFLRSVSV--KDTSILNSSSIVQAIADAESELRGIDRLIVRASGTES 418
            ++       + PQ L +V         L   ++ +A A    ++ G  R+++R SGTE 
Sbjct: 357 TLAQARQALRKCPQVLINVRFGASKVDPLEHPAVKEASARVTEDMAGRGRVLLRKSGTEP 416

Query: 419 LIRIMAEGDDLSRIKRIVDDLAKVIPMI 446
           L+R+M EGDD ++++   + LAK++  +
Sbjct: 417 LVRVMVEGDDENQVRTHAEALAKLVAEV 444


>gi|294789567|ref|ZP_06754802.1| phosphoglucosamine mutase [Simonsiella muelleri ATCC 29453]
 gi|294482504|gb|EFG30196.1| phosphoglucosamine mutase [Simonsiella muelleri ATCC 29453]
          Length = 444

 Score =  261 bits (666), Expect = 2e-67,   Method: Composition-based stats.
 Identities = 199/447 (44%), Positives = 295/447 (65%), Gaps = 7/447 (1%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLF--RGKKKHRRVVIGKDTRLSGYML 58
           M R++FGTDGIRG++  FPITP+F++++G A G       + K  +V+IGKDTR+SGYML
Sbjct: 1   MARKYFGTDGIRGEAGQFPITPDFVLKLGCAYGRALIKHEQGKRPQVIIGKDTRISGYML 60

Query: 59  ENSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDG 118
           E +LVAGFTAAG+D    GP+P+PA+A LTR+LR   GVMISASHN + DNGIK F   G
Sbjct: 61  ETALVAGFTAAGVDVIQTGPLPTPAIAYLTRALRLSGGVMISASHNEFSDNGIKFFAEGG 120

Query: 119 YKVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLR 178
            K+S D+E  IE  L+ ++ +       +G  +R++G  DRYIE  K T P  + L+GL+
Sbjct: 121 VKLSDDMEIAIEAELDKEMVTRS--SRDLGRNRRINGADDRYIEFCKSTFPSHLDLRGLK 178

Query: 179 IVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADI 238
           +V+D ANGA Y   P+VF ELGA+++ IG +PNG NIN   G+T++ +LQ  V +  AD 
Sbjct: 179 LVIDTANGAGYHTTPKVFHELGAEIIQIGHEPNGFNINDKVGATHIKTLQATVLQNEADY 238

Query: 239 GIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIA 298
           GIALDGDGDR+++VD  GA+ +GD+++ +IA+  M    +   G+V TVMSN+G+E+ + 
Sbjct: 239 GIALDGDGDRLMMVDRHGAVFDGDKLIYIIAKAHMQQ-GIPFGGVVGTVMSNLGMEKALN 297

Query: 299 GLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQY 358
             G+   R +VGDRY++E +K  G+ +GGE SGHI+  D  +TGDG ++ALQVL  +K  
Sbjct: 298 ERGILFARAKVGDRYVLEMLKQRGWLLGGESSGHILCMDKHNTGDGTISALQVLAALKTL 357

Query: 359 DKPVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTES 418
           ++ ++T    ++ YPQ + +V ++      ++S  QA+A  E EL    R+++R SGTE 
Sbjct: 358 EQDLNTAVD-WQPYPQTMINVRIRKGQDWQTAS-KQALAAVEKELGDRGRVVLRPSGTEP 415

Query: 419 LIRIMAEGDDLSRIKRIVDDLAKVIPM 445
           ++R+M E +     ++    +A  I  
Sbjct: 416 VVRVMVEAEQAILAEKSARLIADAIEA 442


>gi|255658120|ref|ZP_05403529.1| phosphoglucosamine mutase [Mitsuokella multacida DSM 20544]
 gi|260849427|gb|EEX69434.1| phosphoglucosamine mutase [Mitsuokella multacida DSM 20544]
          Length = 449

 Score =  261 bits (666), Expect = 2e-67,   Method: Composition-based stats.
 Identities = 198/450 (44%), Positives = 279/450 (62%), Gaps = 9/450 (2%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLF-RGKKKHRRVVIGKDTRLSGYMLE 59
           M R  FGTDG+RG++N   + P    R+G A    F +  ++   ++IG+DTR+SG M E
Sbjct: 1   MAR-LFGTDGVRGEANVTLL-PEMAYRLGRAATIYFGKESEEQPLIIIGRDTRISGEMFE 58

Query: 60  NSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGY 119
           ++L AG  +AG  A + G IP+PA+A L R  +A  G++ISASHNP+ DNGIK FG DGY
Sbjct: 59  SALTAGICSAGGRAMLAGIIPTPAIAYLARKHKAKAGIVISASHNPFHDNGIKFFGGDGY 118

Query: 120 KVSTDIEDRIETL---LEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQG 176
           K+   +ED +E +   LE D        + IGH +    + ++Y+E V  T        G
Sbjct: 119 KLPDAVEDELEAIVHQLETDDNYPRPTAEHIGHIEYRTDLLNQYMEFVLSTCKE--RFDG 176

Query: 177 LRIVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRA 236
           +++V+DCANGA+Y+  P++   LGA+V VI   PNG NIN  CGST++ SLQ+ V E  A
Sbjct: 177 VKVVLDCANGAAYEAMPKILRRLGANVKVIHALPNGTNINDGCGSTHLESLQKAVLENGA 236

Query: 237 DIGIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERF 296
           D GIA DGD DR + VDEKG +++GD I+ + A + M    L  N +VTTVM+NIG  + 
Sbjct: 237 DFGIAHDGDADRCLCVDEKGQVIDGDHILVMCAMDMMKEGKLPYNTVVTTVMANIGFHQA 296

Query: 297 IAGLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIK 356
           I   G   + T+VGDRY++E M  NG+ +GGEQSGHII +DY +TGDGL+ ALQVL  +K
Sbjct: 297 IKKAGGRAEITKVGDRYVLENMLKNGYKIGGEQSGHIIFTDYSTTGDGLITALQVLSSLK 356

Query: 357 QYDKPVSTICHCFEEYPQFLRSVSVKDTS-ILNSSSIVQAIADAESELRGIDRLIVRASG 415
           +  +  S +      YPQ L +V V        + +I +AIA+ + EL    R++VR SG
Sbjct: 357 RSGRKASDLTALMTTYPQLLVNVKVATKEGWETNEAIKKAIAEGDKELGENGRILVRPSG 416

Query: 416 TESLIRIMAEGDDLSRIKRIVDDLAKVIPM 445
           TE LIR+MAEG D +++ RI   +A V+  
Sbjct: 417 TEPLIRVMAEGPDQAQLDRICHAIADVVKK 446


>gi|56551898|ref|YP_162737.1| phosphoglucosamine mutase [Zymomonas mobilis subsp. mobilis ZM4]
 gi|241761785|ref|ZP_04759871.1| phosphoglucosamine mutase [Zymomonas mobilis subsp. mobilis ATCC
           10988]
 gi|81355087|sp|Q5NNT4|GLMM_ZYMMO RecName: Full=Phosphoglucosamine mutase
 gi|56543472|gb|AAV89626.1| phosphoglucosamine mutase [Zymomonas mobilis subsp. mobilis ZM4]
 gi|241373699|gb|EER63259.1| phosphoglucosamine mutase [Zymomonas mobilis subsp. mobilis ATCC
           10988]
          Length = 445

 Score =  261 bits (666), Expect = 2e-67,   Method: Composition-based stats.
 Identities = 245/444 (55%), Positives = 324/444 (72%), Gaps = 2/444 (0%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M R++FGTDGIRG +N  P+T +  MR+G A G  F+      RV+IGKDTRLSGYM+E+
Sbjct: 1   MSRQYFGTDGIRGCTNKDPMTADVAMRVGQAAGAYFKRGLHRHRVLIGKDTRLSGYMVES 60

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +L+AGFT+ GMD  ++GP+P+P VA+LTRS+RAD+GVMISASHNP+ DNGIKLFGP+GYK
Sbjct: 61  ALMAGFTSVGMDVVLVGPLPTPGVALLTRSMRADLGVMISASHNPFSDNGIKLFGPNGYK 120

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +S + E  IE  ++      L+    IG A+R+D    RYI  VK + P  + L  LR+V
Sbjct: 121 LSEEEEKAIEEAIDQ--PPLLAAPADIGRARRIDDAQGRYIHAVKSSFPESLRLDKLRLV 178

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           +DCANGA+Y+VAP V WELGA+V+ +G  PNG+NIN  CGST+  +LQ+KV E RAD+GI
Sbjct: 179 LDCANGAAYQVAPAVLWELGAEVITLGVAPNGLNINDHCGSTDPSALQKKVLETRADLGI 238

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           ALDGD DRVIIVDEKG IV+GDQIMALIA      +LL+GN  V TVMSN+GLER+++ L
Sbjct: 239 ALDGDADRVIIVDEKGEIVDGDQIMALIATSAQKRNLLKGNTTVATVMSNLGLERYLSKL 298

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           G+ L RT+VGDR+++E M+  G+ VGGEQSGHIILS + +TGDGLVAALQVL  + Q DK
Sbjct: 299 GIQLLRTQVGDRHVVEAMRAGGYTVGGEQSGHIILSYHTTTGDGLVAALQVLADLVQSDK 358

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
             S + H F+ +PQ L++V       L   S+ +AI++AE  L+G  RL++R SGTE LI
Sbjct: 359 KASELLHVFDPFPQLLKNVRYSSGQPLEDESVCEAISEAEESLKGKGRLLIRKSGTEPLI 418

Query: 421 RIMAEGDDLSRIKRIVDDLAKVIP 444
           R+MAE +D   + +IVD + + + 
Sbjct: 419 RVMAEAEDPDLVHQIVDHICETVR 442


>gi|91978377|ref|YP_571036.1| phosphoglucosamine mutase [Rhodopseudomonas palustris BisB5]
 gi|123748797|sp|Q131V4|GLMM_RHOPS RecName: Full=Phosphoglucosamine mutase
 gi|91684833|gb|ABE41135.1| phosphoglucosamine mutase [Rhodopseudomonas palustris BisB5]
          Length = 450

 Score =  261 bits (666), Expect = 2e-67,   Method: Composition-based stats.
 Identities = 254/429 (59%), Positives = 330/429 (76%), Gaps = 1/429 (0%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M RR+FGTDGIRG++N   ITP   +++G A G +F+      RVVIGKDTRLSGYM+EN
Sbjct: 1   MSRRYFGTDGIRGRAN-GLITPELALKVGQAAGLVFQRGDHRHRVVIGKDTRLSGYMIEN 59

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           ++VAGFT+ GMD  ++GP+P+PAVAMLT+S+RAD+GVMISASHN ++DNGIKLFGP G+K
Sbjct: 60  AMVAGFTSVGMDVLLVGPMPTPAVAMLTKSMRADLGVMISASHNMFEDNGIKLFGPLGFK 119

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +S D+E +IE LL++ L   L+   S+G A+R+DGVHDRYIE  KRTLPRD++L GLR+V
Sbjct: 120 LSDDVEKQIELLLDESLDKKLAASASLGRARRIDGVHDRYIEFAKRTLPRDLSLDGLRVV 179

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           VDCANGA+YKV PE  WELGADV+ IG +P+G NIN +CGST   +L RKV E+RADIGI
Sbjct: 180 VDCANGAAYKVVPEALWELGADVISIGVEPDGFNINKECGSTAPEALCRKVREMRADIGI 239

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           ALDGD DRVI+VDE+G +V+GDQ++A+IA+ W     L   G+V TVMSN+GLERF+A  
Sbjct: 240 ALDGDADRVIMVDERGHVVDGDQLLAVIAQSWKEDGRLAKPGVVATVMSNLGLERFLAAE 299

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           G+ L RT VGDRY++E M   G+NVGGE SGHIILSDY +TGDG VAALQVL  +++  +
Sbjct: 300 GIDLVRTSVGDRYVLEQMMKGGYNVGGEASGHIILSDYNTTGDGFVAALQVLAVVQKLRR 359

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
           PVS +CH F+  PQ L++V  ++   L+ + +  AI   E+ L G  RL++RASGTE +I
Sbjct: 360 PVSEVCHRFDPLPQILKNVRYRNGRPLDDAGVQSAIHAGETRLNGHGRLLIRASGTEPVI 419

Query: 421 RIMAEGDDL 429
           R+M EG+D 
Sbjct: 420 RVMGEGEDR 428


>gi|291043367|ref|ZP_06569090.1| phosphoglucosamine mutase [Neisseria gonorrhoeae DGI2]
 gi|291012973|gb|EFE04956.1| phosphoglucosamine mutase [Neisseria gonorrhoeae DGI2]
 gi|317164661|gb|ADV08202.1| phosphoglucosamine mutase [Neisseria gonorrhoeae TCDC-NG08107]
          Length = 445

 Score =  261 bits (666), Expect = 2e-67,   Method: Composition-based stats.
 Identities = 193/445 (43%), Positives = 289/445 (64%), Gaps = 6/445 (1%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKK--KHRRVVIGKDTRLSGYML 58
           M +++FGTDG+RG+   FPITP+F++++G A G +       +   V+IGKDTR+SGYML
Sbjct: 2   MAKKYFGTDGVRGEVGQFPITPDFVLKLGYAAGQVLVQHDTDQKPTVLIGKDTRISGYML 61

Query: 59  ENSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDG 118
           E +LVAGFTAAG++    GP+P+P VA LTR+LR   GVMISASHN Y DNGIK F   G
Sbjct: 62  EAALVAGFTAAGVNVVQTGPLPTPGVAYLTRALRLSAGVMISASHNTYSDNGIKFFAEGG 121

Query: 119 YKVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLR 178
            K+S ++E  IE  +++++ +       +G A+R+ G  DRYIE  K T P    L+GL+
Sbjct: 122 VKLSDEVELEIEAKIDEEMKTQP--SARLGRARRISGADDRYIEFCKSTFPGHSDLRGLK 179

Query: 179 IVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADI 238
           +V+D ANGA Y VAP+VF ELGA VV IG++PNG NIN  CG+T+  +LQ  V +  AD 
Sbjct: 180 LVIDTANGAGYGVAPKVFHELGAQVVSIGNEPNGYNINEKCGATHTKTLQAAVLQNEADY 239

Query: 239 GIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIA 298
           GIALDGDGDR+++VD+   + +GD ++ +IA+       +   G+V TVM+N+ +E  + 
Sbjct: 240 GIALDGDGDRLMMVDKNRQVYDGDSLIYVIAKARTRE-GINIGGVVGTVMTNMAMEIALK 298

Query: 299 GLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQY 358
             G+   R +VGDRY++E +   G+ +GGE SGHI+  D  +TGDG+++ALQVL  ++  
Sbjct: 299 EQGVDFCRAKVGDRYVLEQLNQRGWLIGGEASGHILCMDKHNTGDGIISALQVLAALQIL 358

Query: 359 DKPVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTES 418
           ++ ++ +C  ++ YPQ + +V ++       +S    +A+ E EL G  R+++RASGTE 
Sbjct: 359 NQDLAAVCADWQPYPQTMINVRIQKGQKWQEAS-KDVLAEVEKELEGKGRVVLRASGTEP 417

Query: 419 LIRIMAEGDDLSRIKRIVDDLAKVI 443
           ++R+M E       +   + +A  I
Sbjct: 418 VVRVMVEARQADWARDGAERIAAAI 442


>gi|239999412|ref|ZP_04719336.1| MrsA [Neisseria gonorrhoeae 35/02]
 gi|240081330|ref|ZP_04725873.1| MrsA [Neisseria gonorrhoeae FA19]
 gi|240116111|ref|ZP_04730173.1| MrsA [Neisseria gonorrhoeae PID18]
 gi|240123940|ref|ZP_04736896.1| MrsA [Neisseria gonorrhoeae PID332]
 gi|260440079|ref|ZP_05793895.1| phosphoglucosamine mutase [Neisseria gonorrhoeae DGI2]
 gi|268595232|ref|ZP_06129399.1| phosphoglucosamine mutase [Neisseria gonorrhoeae 35/02]
 gi|268597432|ref|ZP_06131599.1| phosphoglucosamine mutase [Neisseria gonorrhoeae FA19]
 gi|268601777|ref|ZP_06135944.1| phosphoglucosamine mutase [Neisseria gonorrhoeae PID18]
 gi|268682565|ref|ZP_06149427.1| phosphoglucosamine mutase [Neisseria gonorrhoeae PID332]
 gi|268548621|gb|EEZ44039.1| phosphoglucosamine mutase [Neisseria gonorrhoeae 35/02]
 gi|268551220|gb|EEZ46239.1| phosphoglucosamine mutase [Neisseria gonorrhoeae FA19]
 gi|268585908|gb|EEZ50584.1| phosphoglucosamine mutase [Neisseria gonorrhoeae PID18]
 gi|268622849|gb|EEZ55249.1| phosphoglucosamine mutase [Neisseria gonorrhoeae PID332]
          Length = 444

 Score =  261 bits (666), Expect = 2e-67,   Method: Composition-based stats.
 Identities = 193/445 (43%), Positives = 289/445 (64%), Gaps = 6/445 (1%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKK--KHRRVVIGKDTRLSGYML 58
           M +++FGTDG+RG+   FPITP+F++++G A G +       +   V+IGKDTR+SGYML
Sbjct: 1   MAKKYFGTDGVRGEVGQFPITPDFVLKLGYAAGQVLVQHDTDQKPTVLIGKDTRISGYML 60

Query: 59  ENSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDG 118
           E +LVAGFTAAG++    GP+P+P VA LTR+LR   GVMISASHN Y DNGIK F   G
Sbjct: 61  EAALVAGFTAAGVNVVQTGPLPTPGVAYLTRALRLSAGVMISASHNTYSDNGIKFFAEGG 120

Query: 119 YKVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLR 178
            K+S ++E  IE  +++++ +       +G A+R+ G  DRYIE  K T P    L+GL+
Sbjct: 121 VKLSDEVELEIEAKIDEEMKTQP--SARLGRARRISGADDRYIEFCKSTFPGHSDLRGLK 178

Query: 179 IVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADI 238
           +V+D ANGA Y VAP+VF ELGA VV IG++PNG NIN  CG+T+  +LQ  V +  AD 
Sbjct: 179 LVIDTANGAGYGVAPKVFHELGAQVVSIGNEPNGYNINEKCGATHTKTLQAAVLQNEADY 238

Query: 239 GIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIA 298
           GIALDGDGDR+++VD+   + +GD ++ +IA+       +   G+V TVM+N+ +E  + 
Sbjct: 239 GIALDGDGDRLMMVDKNRQVYDGDSLIYVIAKARTRE-GINIGGVVGTVMTNMAMEIALK 297

Query: 299 GLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQY 358
             G+   R +VGDRY++E +   G+ +GGE SGHI+  D  +TGDG+++ALQVL  ++  
Sbjct: 298 EQGVDFCRAKVGDRYVLEQLNQRGWLIGGEASGHILCMDKHNTGDGIISALQVLAALQIL 357

Query: 359 DKPVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTES 418
           ++ ++ +C  ++ YPQ + +V ++       +S    +A+ E EL G  R+++RASGTE 
Sbjct: 358 NQDLAAVCADWQPYPQTMINVRIQKGQKWQEAS-KDVLAEVEKELEGKGRVVLRASGTEP 416

Query: 419 LIRIMAEGDDLSRIKRIVDDLAKVI 443
           ++R+M E       +   + +A  I
Sbjct: 417 VVRVMVEARQADWARDGAERIAAAI 441


>gi|219815982|gb|ACL37100.1| phosphoglucosamine mutase [uncultured bacterium fCS1]
          Length = 443

 Score =  261 bits (666), Expect = 2e-67,   Method: Composition-based stats.
 Identities = 182/446 (40%), Positives = 281/446 (63%), Gaps = 4/446 (0%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M R++FGTDGIRG     PITP+F++R+  AVG + +  +    V+IGKDTR+SGYMLE+
Sbjct: 1   MTRKYFGTDGIRGTVGQAPITPDFVLRLAHAVGRVLKRTESRPTVLIGKDTRISGYMLES 60

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +L +GF +AG+D  +LGP+P+P VA LTR+ RA +GV+ISASHNP+ DNGIK F   G K
Sbjct: 61  ALESGFNSAGVDVVLLGPLPTPGVAYLTRAQRASLGVVISASHNPFADNGIKFFSAQGTK 120

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +    E  +E +LE+          S+G  +R++    RYIE  K T   D+TL+G++IV
Sbjct: 121 LPDAWEIDVEAVLEE--APVWVDSPSLGKTRRLEDAAGRYIEFCKSTFANDLTLKGMKIV 178

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           VD A+GA+Y +AP+VF ELGA+V+ IG  P+G+NIN + G+T+  +L   V   +AD G+
Sbjct: 179 VDAAHGAAYHIAPKVFHELGAEVIAIGCAPDGLNINHEVGATHPQALVAAVKANQADFGV 238

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           ALDGD DR+ +VD  G + NGD+++ L+A + +         + T  M+N+ +E  +   
Sbjct: 239 ALDGDADRLQLVDADGRLYNGDELLYLMADDRLGRDEHVPGVVGTL-MTNLAVEVALKAR 297

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           G+   R +VGDRY++E ++ + + +GGE SGH++  D  +TGDGL++ALQVL+ +++  +
Sbjct: 298 GVQFVRAKVGDRYVLEELEKHKWILGGEGSGHLLALDKHTTGDGLISALQVLQALQRSGQ 357

Query: 361 PVSTICHCFEEYPQFLRSVSVKD-TSILNSSSIVQAIADAESELRGIDRLIVRASGTESL 419
            ++ +      +PQ L +V +K       S  + +     E EL    R+++RASGTE L
Sbjct: 358 TMAQLLAKVTLFPQTLINVRLKPGQDWKASPGLARETLAVEVELGETGRVLIRASGTEPL 417

Query: 420 IRIMAEGDDLSRIKRIVDDLAKVIPM 445
           +R+M E  D ++ K     +A  +  
Sbjct: 418 VRVMVEARDAAQAKACAQRIADTLAA 443


>gi|240017034|ref|ZP_04723574.1| MrsA [Neisseria gonorrhoeae FA6140]
 gi|240113539|ref|ZP_04728029.1| MrsA [Neisseria gonorrhoeae MS11]
 gi|240118395|ref|ZP_04732457.1| MrsA [Neisseria gonorrhoeae PID1]
 gi|240126140|ref|ZP_04739026.1| MrsA [Neisseria gonorrhoeae SK-92-679]
 gi|254494131|ref|ZP_05107302.1| phosphoglucosamine mutase [Neisseria gonorrhoeae 1291]
 gi|268599604|ref|ZP_06133771.1| phosphoglucosamine mutase [Neisseria gonorrhoeae MS11]
 gi|268604107|ref|ZP_06138274.1| phosphoglucosamine mutase [Neisseria gonorrhoeae PID1]
 gi|268684726|ref|ZP_06151588.1| phosphoglucosamine mutase [Neisseria gonorrhoeae SK-92-679]
 gi|226513171|gb|EEH62516.1| phosphoglucosamine mutase [Neisseria gonorrhoeae 1291]
 gi|268583735|gb|EEZ48411.1| phosphoglucosamine mutase [Neisseria gonorrhoeae MS11]
 gi|268588238|gb|EEZ52914.1| phosphoglucosamine mutase [Neisseria gonorrhoeae PID1]
 gi|268625010|gb|EEZ57410.1| phosphoglucosamine mutase [Neisseria gonorrhoeae SK-92-679]
          Length = 444

 Score =  261 bits (666), Expect = 2e-67,   Method: Composition-based stats.
 Identities = 193/445 (43%), Positives = 290/445 (65%), Gaps = 6/445 (1%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKK--KHRRVVIGKDTRLSGYML 58
           M +++FGTDG+RG+   FPITP+F++++G A G +       +   V+IGKDTR+SGYML
Sbjct: 1   MAKKYFGTDGVRGEVGQFPITPDFVLKLGYAAGQVLVQHDTDQKPTVLIGKDTRISGYML 60

Query: 59  ENSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDG 118
           E +LVAGFTAAG++    GP+P+P VA LTR+LR   GVMISASHN Y DNGIK F   G
Sbjct: 61  EAALVAGFTAAGVNVVQTGPLPTPGVAYLTRALRLSAGVMISASHNTYSDNGIKFFAEGG 120

Query: 119 YKVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLR 178
            K+S ++E  IE  +++++ +       +G A+R+ G  DRYIE  K T P    L+GL+
Sbjct: 121 VKLSDEVELEIEAKIDEEMKTQP--SARLGRARRISGADDRYIEFCKSTFPGHSDLRGLK 178

Query: 179 IVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADI 238
           +V+D ANGA Y VAP+VF ELGA VV IG++PNG NIN  CG+T+  +LQ  V +  AD 
Sbjct: 179 LVIDTANGAGYGVAPKVFHELGAQVVSIGNEPNGYNINEKCGATHTKTLQAAVLQNEADY 238

Query: 239 GIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIA 298
           GIALDGDGDR+++VD+   + +GD ++ +IA+   +   +   G+V TVM+N+ +E  + 
Sbjct: 239 GIALDGDGDRLMMVDKNRQVYDGDSLIYVIAK-ARAREGINIGGVVGTVMTNMAMEIALK 297

Query: 299 GLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQY 358
             G+   R +VGDRY++E +   G+ +GGE SGHI+  D  +TGDG+++ALQVL  ++  
Sbjct: 298 EQGVDFCRAKVGDRYVLEQLNQRGWLIGGEASGHILCMDKHNTGDGIISALQVLAALQIL 357

Query: 359 DKPVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTES 418
           ++ ++ +C  ++ YPQ + +V ++       +S    +A+ E EL G  R+++RASGTE 
Sbjct: 358 NQDLAAVCADWQPYPQTMINVRIQKGQKWQEAS-KDVLAEVEKELEGKGRVVLRASGTEP 416

Query: 419 LIRIMAEGDDLSRIKRIVDDLAKVI 443
           ++R+M E       +   + +A  I
Sbjct: 417 VVRVMVEARQADWARDGAERIAAAI 441


>gi|254787190|ref|YP_003074619.1| phosphoglucosamine mutase [Teredinibacter turnerae T7901]
 gi|259647728|sp|C5BQ00|GLMM_TERTT RecName: Full=Phosphoglucosamine mutase
 gi|237685614|gb|ACR12878.1| phosphoglucosamine mutase [Teredinibacter turnerae T7901]
          Length = 446

 Score =  261 bits (665), Expect = 2e-67,   Method: Composition-based stats.
 Identities = 204/446 (45%), Positives = 292/446 (65%), Gaps = 8/446 (1%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRR--VVIGKDTRLSGYML 58
           M R++FGTDGIRG+     ITP F M++G AVG +   +       V+IGKDTR+SGYM 
Sbjct: 1   MTRKYFGTDGIRGQVGQGVITPQFFMQLGWAVGKVLAERHADGGGLVLIGKDTRISGYMF 60

Query: 59  ENSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDG 118
           E++L AG  AAG+D  +LGP+P+PA+A LTR+ +A  G++ISASHNP++DNGIKLF   G
Sbjct: 61  ESALEAGLIAAGVDVGLLGPMPTPAIAYLTRTFQASAGIVISASHNPFRDNGIKLFNTQG 120

Query: 119 YKVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLR 178
            K++ D    +E  +E  +   +   + +G A+RV     RYIE  K TLP   +L GL 
Sbjct: 121 VKLADD----VEAAIEHQVDRPMVTAERLGKARRVPDAEGRYIEFCKGTLPWGFSLAGLT 176

Query: 179 IVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADI 238
           +VVDCANGA+Y VAP+VF ELGA+V+ I   P+G NINL+CGST + +LQ++V E  ADI
Sbjct: 177 VVVDCANGATYNVAPKVFSELGAEVIAISTHPDGENINLNCGSTKLNNLQKQVLESHADI 236

Query: 239 GIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIA 298
           GIA DGDGDRV  VDE+G +V+GDQ++ +IA     H       +  T MSN G E  + 
Sbjct: 237 GIAFDGDGDRVQFVDERGEVVDGDQLLFIIAAHKQRHGGGCSGVVG-TQMSNFGFELALE 295

Query: 299 GLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQY 358
            L +  +R +VGDRY++E M NNG+ +GGE SGHI+ +D  +TGDG++AALQVLR +   
Sbjct: 296 ALKIPFERAKVGDRYVIEAMNNNGWKLGGESSGHIVCADVTTTGDGIIAALQVLRALNAE 355

Query: 359 DKPVSTICHCFEEYPQFLRSVSVKDT-SILNSSSIVQAIADAESELRGIDRLIVRASGTE 417
            + +  +    ++ PQ + +V VK   ++  +  +  AIA+AE  + G  R+++R SGTE
Sbjct: 356 AQTLYELKQRMQKMPQVMVNVPVKRKLNLEENDMVQTAIAEAEQRMEGQGRVLLRPSGTE 415

Query: 418 SLIRIMAEGDDLSRIKRIVDDLAKVI 443
            +IR+M EG     + ++  +LA+V+
Sbjct: 416 PVIRVMVEGQQHGMVSQLAHELAEVV 441


>gi|237798558|ref|ZP_04587019.1| phosphoglucosamine mutase [Pseudomonas syringae pv. oryzae str.
           1_6]
 gi|331021411|gb|EGI01468.1| phosphoglucosamine mutase [Pseudomonas syringae pv. oryzae str.
           1_6]
          Length = 447

 Score =  261 bits (665), Expect = 2e-67,   Method: Composition-based stats.
 Identities = 194/449 (43%), Positives = 295/449 (65%), Gaps = 7/449 (1%)

Query: 1   MK-RRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLE 59
           M  R++FGTDGIRG+   FPITP FM+++G A G  FR K    R+++GKDTR+SGYM E
Sbjct: 1   MSTRKYFGTDGIRGRVGQFPITPEFMLKLGWAAGMAFR-KMGTCRILVGKDTRISGYMFE 59

Query: 60  NSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGY 119
           ++L AG +AAG D  +LGP+P+PA+A LTR+  A+ G++ISASHNP+ DNGIK F   G 
Sbjct: 60  SALEAGLSAAGADVLLLGPMPTPAIAYLTRTFHAEAGIVISASHNPHYDNGIKFFSGQGT 119

Query: 120 KVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRI 179
           K+  +IE  IE LL+  +T  ++  +++G   R++    RYIE  K ++P      GL+I
Sbjct: 120 KLPDEIEMMIEELLDAPMT--VAESENLGKVSRINDAAGRYIEFCKSSVPTSTDFAGLKI 177

Query: 180 VVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIG 239
           V+DCA+GA+YKVAP VF ELGA VVV+  +P+G+NIN DCGST++ +LQ  V    AD+G
Sbjct: 178 VIDCAHGATYKVAPNVFRELGAQVVVLSAQPDGLNINKDCGSTHMEALQAAVVAEHADMG 237

Query: 240 IALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAG 299
           I  DGDGDRV++VD  G IV+GD+++ +IAR+      L+G  + T  MSN+GLE  +A 
Sbjct: 238 IGFDGDGDRVLMVDHTGTIVDGDELLYIIARDLHERGRLQGGVVGTL-MSNLGLELALAE 296

Query: 300 LGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYD 359
             +   R  VGDRY++  +    + +GGE SGHI+   + +TGD ++A+LQV+  +++  
Sbjct: 297 QNIPFVRANVGDRYVIAELLERNWQIGGENSGHIVCFQHATTGDAIIASLQVILALRRSG 356

Query: 360 KPVSTICHCFEEYPQFLRSVSVKDTSIL--NSSSIVQAIADAESELRGIDRLIVRASGTE 417
             ++       + PQ L +V  + +S+      S+ +A A    ++ G  R+++R SGTE
Sbjct: 357 ISLAEARLKLRKCPQILINVRFEGSSVDPVTHPSVQEACARVTEQMAGRGRVLLRKSGTE 416

Query: 418 SLIRIMAEGDDLSRIKRIVDDLAKVIPMI 446
            L+R+M EG+D ++++   ++LAK++  +
Sbjct: 417 PLVRVMVEGEDEAQVRAYAEELAKLVAEV 445


>gi|323439385|gb|EGA97108.1| phosphoglucosamine mutase [Staphylococcus aureus O11]
          Length = 451

 Score =  261 bits (665), Expect = 2e-67,   Method: Composition-based stats.
 Identities = 188/445 (42%), Positives = 275/445 (61%), Gaps = 7/445 (1%)

Query: 4   RFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKK--KHRRVVIGKDTRLSGYMLENS 61
           ++FGTDG+RG +N   +TP    ++G   GY+    K  KH RV++G+DTR+SG MLE++
Sbjct: 3   KYFGTDGVRGVANQ-ELTPELAFKLGRYGGYVLAHNKGEKHPRVLVGRDTRVSGEMLESA 61

Query: 62  LVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKV 121
           L+AG  + G +   LG I +P VA LTR + A++GVMISASHNP  DNGIK FG DG+K+
Sbjct: 62  LIAGLISIGAEVMRLGIISTPGVAYLTRDMGAELGVMISASHNPVADNGIKFFGSDGFKL 121

Query: 122 STDIEDRIETLLEDDLTSYLSCYDS-IGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           S + E+ IE LL+ +         + I H         +Y+ ++K T+   V  +GL+IV
Sbjct: 122 SDEQENEIEALLDQENPELPRPVGNDIVHYSDYFEGAQKYLSYLKSTVD--VNFEGLKIV 179

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           +D ANG++  +AP +F +L AD   IG  P+G NIN  CGST+   L  KV E  +D G+
Sbjct: 180 LDGANGSTSSLAPFLFGDLEADTETIGCSPDGYNINEKCGSTHPEKLAEKVFETESDFGL 239

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           A DGDGDR+I VDE G IV+GDQIM +I +E   +  L  + IV+TVMSN+G  + +   
Sbjct: 240 AFDGDGDRIIAVDENGQIVDGDQIMFIIGQEMHKNQELNNDMIVSTVMSNLGFYKALEQE 299

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           G+   +T+VGDRY++E M+   +N+GGEQSGHI++ DY +TGDGL+  +Q+   IK   K
Sbjct: 300 GIKSNKTKVGDRYVVEEMRRGNYNLGGEQSGHIVMMDYNTTGDGLLTGIQLASVIKMTGK 359

Query: 361 PVSTICHCFEEYPQFLRSVSVKDT-SILNSSSIVQAIADAESELRGIDRLIVRASGTESL 419
            +S +    ++YPQ L +V V D   +  +  + + +   E E+ G  R++VR SGTE L
Sbjct: 360 SLSELAGQMKKYPQSLINVRVTDKYRVEENVDVKEVMTKVEVEMNGEGRILVRPSGTEPL 419

Query: 420 IRIMAEGDDLSRIKRIVDDLAKVIP 444
           +R+M E       +R    +A V+ 
Sbjct: 420 VRVMVEAATDEDAERFAQQIADVVQ 444


>gi|237745686|ref|ZP_04576166.1| phosphoglucosamine mutase [Oxalobacter formigenes HOxBLS]
 gi|229377037|gb|EEO27128.1| phosphoglucosamine mutase [Oxalobacter formigenes HOxBLS]
          Length = 448

 Score =  261 bits (665), Expect = 2e-67,   Method: Composition-based stats.
 Identities = 208/444 (46%), Positives = 294/444 (66%), Gaps = 8/444 (1%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKK---KHRRVVIGKDTRLSGYM 57
           MKRR+FGTDG+RG+    PITP+F+M++G A G +            V+IGKDTR+SGYM
Sbjct: 1   MKRRYFGTDGVRGRVGKTPITPDFVMKLGYAAGKVLTRTSMSSGSPTVLIGKDTRISGYM 60

Query: 58  LENSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPD 117
           LE SL AG +AAG+D  + GP+P+PAVA LTR+LR   G++ISASHNPYQDNGIK F   
Sbjct: 61  LEASLQAGLSAAGVDVMLSGPMPTPAVAYLTRALRLSAGIVISASHNPYQDNGIKFFSAS 120

Query: 118 GYKVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGL 177
           G K+  D+E  IE+L+E  +    +  + +G  +R+D    RYIE  K T P D  L+GL
Sbjct: 121 GNKLPDDMEFEIESLIEKPMD--CASPEFLGKVRRLDDAQGRYIEFCKSTFPNDFDLRGL 178

Query: 178 RIVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRAD 237
           +IVVDCANGA+Y +AP VF ELGADVV IG +P+G+NIN +CG+T+V SL   V E RAD
Sbjct: 179 KIVVDCANGAAYHIAPCVFHELGADVVSIGVQPDGLNINENCGATSVDSLVSAVVENRAD 238

Query: 238 IGIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFI 297
           +GIALDGD DR+++VD +G + NGDQ++ LIA++ +++S     G+V T+M+N+GLE   
Sbjct: 239 LGIALDGDADRLVMVDAEGQVYNGDQLLYLIAKDRLAYSD--VKGVVGTLMTNMGLEVAF 296

Query: 298 AGLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQ 357
               +   R  VGDRY++E +   G+ +GGE SGH+I  D  +TGDG+++ALQVL  +K+
Sbjct: 297 REKQVGFARANVGDRYVLETLLEKGWLLGGEGSGHLICLDKHTTGDGIISALQVLAALKR 356

Query: 358 YDKPVSTICHCFEEYPQFLRSVSVKD-TSILNSSSIVQAIADAESELRGIDRLIVRASGT 416
           +   +         +PQ L +V +    +   ++S+       E EL    R+++RASGT
Sbjct: 357 HKTTLPAFLSELTLFPQTLVNVRIDPGFNWKENTSMQAEKQKVEKELGNRGRVLIRASGT 416

Query: 417 ESLIRIMAEGDDLSRIKRIVDDLA 440
           E LIR+M E +D S+ K + + +A
Sbjct: 417 EPLIRVMVEAEDASQAKEMAERIA 440


>gi|70725880|ref|YP_252794.1| phosphoglucosamine mutase [Staphylococcus haemolyticus JCSC1435]
 gi|84029256|sp|Q4L837|GLMM_STAHJ RecName: Full=Phosphoglucosamine mutase
 gi|68446604|dbj|BAE04188.1| phosphoglucosamine-mutase [Staphylococcus haemolyticus JCSC1435]
          Length = 450

 Score =  261 bits (665), Expect = 2e-67,   Method: Composition-based stats.
 Identities = 185/445 (41%), Positives = 277/445 (62%), Gaps = 7/445 (1%)

Query: 4   RFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKK--HRRVVIGKDTRLSGYMLENS 61
           ++FGTDG+RG +N   +TP    ++G   GY+    +     +V++G+DTR+SG MLE++
Sbjct: 3   KYFGTDGVRGIANK-ELTPELAFKLGRYGGYVLAHNEGADRPKVLVGRDTRVSGEMLESA 61

Query: 62  LVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKV 121
           L++G  + G +   LG I +P VA LTR + A++GVMISASHNP  DNGIK FG DG+K+
Sbjct: 62  LISGLASIGAEVMRLGVISTPGVAYLTREMGAELGVMISASHNPVADNGIKFFGADGFKL 121

Query: 122 STDIEDRIETLLEDDLTSYLSCYD-SIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           S   E+ IETLL+ D           I H         +Y+ ++K T+   V L+GL+I 
Sbjct: 122 SDAQEEEIETLLDQDNPDLPRPVGTDIVHFSDYFEGAQKYLSYLKSTID--VNLEGLKIT 179

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           +D ANG++  +AP +F +L AD   IG  P+G NIN +CGST+   L  KV E  +D G+
Sbjct: 180 LDGANGSTSALAPFLFGDLEADTETIGCSPDGYNINDNCGSTHPELLAEKVLETESDFGL 239

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           A DGDGDR+I VDEKG I++GDQIM +I +E   +  L  + IV+TVMSN+G  + +   
Sbjct: 240 AFDGDGDRLIAVDEKGNIIDGDQIMFVIGQEMHKNQELNNDMIVSTVMSNLGFYKALENE 299

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           G+   +T+VGDRY++E M+   +N+GGEQSGHI++ DY +TGDGL+  +Q+   IK   K
Sbjct: 300 GIKSNKTKVGDRYVVEEMRKGNYNLGGEQSGHIVMMDYNTTGDGLLTGVQLAAVIKMSGK 359

Query: 361 PVSTICHCFEEYPQFLRSVSVKDT-SILNSSSIVQAIADAESELRGIDRLIVRASGTESL 419
           P+S +    ++YPQ L +V V D   + ++  + + + + E+E+ G  R++VR SGTE L
Sbjct: 360 PLSELAAQMKKYPQSLINVKVTDKHHVEDNEDVKKVMDEVETEMNGEGRILVRPSGTEPL 419

Query: 420 IRIMAEGDDLSRIKRIVDDLAKVIP 444
           +R+M E       +R    +A  + 
Sbjct: 420 VRVMVEASTDEDAQRFAQRIADEVQ 444


>gi|304386830|ref|ZP_07369094.1| phosphoglucosamine mutase [Neisseria meningitidis ATCC 13091]
 gi|304339084|gb|EFM05174.1| phosphoglucosamine mutase [Neisseria meningitidis ATCC 13091]
          Length = 444

 Score =  261 bits (665), Expect = 2e-67,   Method: Composition-based stats.
 Identities = 197/445 (44%), Positives = 292/445 (65%), Gaps = 6/445 (1%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKK--KHRRVVIGKDTRLSGYML 58
           M +++FGTDG+RG+   FPITP+F++++G A G +       +   V+IGKDTR+SGYML
Sbjct: 1   MAKKYFGTDGVRGEVGQFPITPDFVLKLGYAAGQVLVQHDTDQKPTVLIGKDTRISGYML 60

Query: 59  ENSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDG 118
           E +LVAGFTAAG++    GP+P+P VA LTR+LR   GVMISASHN Y DNGIK F   G
Sbjct: 61  EAALVAGFTAAGVNVVQTGPLPTPGVAYLTRALRLSAGVMISASHNAYSDNGIKFFAEGG 120

Query: 119 YKVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLR 178
            K+S ++E  IE  ++ ++ +       +G A+R++G  DRYIE  K T P    L+GL+
Sbjct: 121 VKLSDEVELEIEAKIDGEMKTQP--SARLGRARRINGADDRYIEFCKSTFPTHSDLRGLK 178

Query: 179 IVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADI 238
           +VVD ANGA+Y VAP+VF ELGA VV IGD+PNG NIN  CG+T   +LQ  V +  AD 
Sbjct: 179 LVVDAANGAAYSVAPKVFHELGAQVVSIGDEPNGYNINEKCGATYTKTLQAAVLQHEADY 238

Query: 239 GIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIA 298
           GIALDGDGDR+++VD+ G + +GD ++ +IA+   +   +   G+V TVM+N+ +E  + 
Sbjct: 239 GIALDGDGDRLMMVDKNGKVYDGDSLIYVIAK-ARAREGINIGGVVGTVMTNMAMEIALK 297

Query: 299 GLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQY 358
             G+   R +VGDRY++E +   G+ +GGE SGHI+  D  +TGDG+++ALQVL  ++  
Sbjct: 298 EQGVDFCRAKVGDRYVLEQLNQRGWLIGGEASGHILCMDKHNTGDGIISALQVLAALQTL 357

Query: 359 DKPVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTES 418
           ++ ++T+C  ++ YPQ + +V ++       +S    +A+ E EL G  R+++RASGTE 
Sbjct: 358 NQDLATVCADWQPYPQTMINVRIQKGQKWQEAS-KDVLAEVEKELEGKGRVVLRASGTEP 416

Query: 419 LIRIMAEGDDLSRIKRIVDDLAKVI 443
           ++R+M E       +   + +A  I
Sbjct: 417 VVRVMVEARQADWARDGAERIASAI 441


>gi|307546732|ref|YP_003899211.1| phosphoglucosamine mutase [Halomonas elongata DSM 2581]
 gi|307218756|emb|CBV44026.1| phosphoglucosamine mutase [Halomonas elongata DSM 2581]
          Length = 449

 Score =  261 bits (665), Expect = 2e-67,   Method: Composition-based stats.
 Identities = 207/452 (45%), Positives = 297/452 (65%), Gaps = 11/452 (2%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M RR+FGTDGIRG     PIT +FM+++G A G +   +    +V+IGKDTR+SGYM E+
Sbjct: 1   MTRRYFGTDGIRGTVGEAPITADFMLKLGWATGRVLARESGQAKVLIGKDTRISGYMFES 60

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +L AG +AAG+D  +LGP+P+P +A LTR+ RAD G++ISASHN + DNGIK F  +G K
Sbjct: 61  ALEAGLSAAGVDVILLGPMPTPGIAYLTRTFRADAGIVISASHNAFADNGIKFFSAEGVK 120

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +   +E+RIE +L++ LT+       +G A+RVD    RYIE  K T+P  V L GLR+V
Sbjct: 121 LPDAVEERIEAMLDEPLTTVAPH--ELGKARRVDDAAGRYIEFCKSTIPDRVNLHGLRMV 178

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           VDCA+GA+Y +AP VF ELGADV +IG  P+G+NIN + GST   +L+  V    AD+G+
Sbjct: 179 VDCAHGATYHIAPSVFRELGADVSLIGASPDGLNINHEVGSTQPAALRAAVIREGADLGV 238

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           A DGDGDRV++VD  G  V+GD I+ +IAR+  +     G G+V T MSN GL   +  L
Sbjct: 239 AFDGDGDRVLLVDVDGREVDGDDILYIIARDRHAR-GELGGGVVGTQMSNFGLAAALEAL 297

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           G+  +R +VGDRY+ME +  NG+ +GGE SGHI+     +TGDG+V+ALQVL  + +  +
Sbjct: 298 GIPFERAKVGDRYVMERLAANGWQLGGESSGHIVCGHVQTTGDGIVSALQVLSVMAREGR 357

Query: 361 PVSTICHCFEEYPQFLRSVSVKD----TSILNSSSIVQAIADAESELRGIDRLIVRASGT 416
            +S +    E+ PQ L +V +       S++  +++ +A+A  E EL+   R+++R SGT
Sbjct: 358 ALSELMVGLEKAPQALINVRLTPGTDARSLMKDAALREAVAALEGELKDEGRVLLRPSGT 417

Query: 417 ESLIRIMAEG----DDLSRIKRIVDDLAKVIP 444
           E LIR+M EG    D  S  +R+ DD+  ++ 
Sbjct: 418 EPLIRVMVEGRPHLDVQSLARRLADDVESMLS 449


>gi|260433237|ref|ZP_05787208.1| phosphoglucosamine mutase [Silicibacter lacuscaerulensis ITI-1157]
 gi|260417065|gb|EEX10324.1| phosphoglucosamine mutase [Silicibacter lacuscaerulensis ITI-1157]
          Length = 448

 Score =  261 bits (665), Expect = 2e-67,   Method: Composition-based stats.
 Identities = 235/446 (52%), Positives = 311/446 (69%), Gaps = 4/446 (0%)

Query: 3   RRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKH-RRVVIGKDTRLSGYMLENS 61
           R+ FGTDG+RG +NT+P+T    +RIG AVG  FR  +    RVVIGKDTRLSGYMLE++
Sbjct: 2   RKLFGTDGVRGTANTYPMTAEMALRIGAAVGRYFRRDRTGVHRVVIGKDTRLSGYMLESA 61

Query: 62  LVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKV 121
           L AG T+ GM+  +LGP+P+PAV ++TRS+RAD+GVMISASHNP +DNGIK FGPDG+K+
Sbjct: 62  LTAGLTSTGMNVLLLGPVPTPAVGLMTRSMRADLGVMISASHNPAEDNGIKFFGPDGFKL 121

Query: 122 STDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVV 181
           S   E  IETL+E  +        +IG A+RVD    RY E VK +LPRD+ L GL++V+
Sbjct: 122 SDQAELEIETLIEAGVQPA--QAQNIGRARRVDDARFRYGERVKSSLPRDLRLDGLKVVI 179

Query: 182 DCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIA 241
           DCANGA+++ APEV WELGA+V+ +G  PNG NINL CGST        V    AD+GI 
Sbjct: 180 DCANGAAHRTAPEVLWELGAEVIPVGTAPNGKNINLGCGSTQPRVAAEAVVAHGADVGIC 239

Query: 242 LDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLG 301
           LDGD DRV+IVDE G + +GDQ+MAL+A  W S   L+G  +V TVMSN+GLERF+   G
Sbjct: 240 LDGDADRVVIVDETGQVADGDQLMALLATAWASSERLKGGALVATVMSNLGLERFLGARG 299

Query: 302 LSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKP 361
           L L+RT VGDRY++E M+  GFN+GGEQSGHI++SDY +TGDGL+A L  L  +    + 
Sbjct: 300 LRLERTAVGDRYVVERMREGGFNLGGEQSGHIVMSDYATTGDGLMAGLHFLAEMVNSGRK 359

Query: 362 VSTICHCFEEYPQFLRSVSV-KDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
            S +   FE  PQ L++V   +  + L + ++  AIADAE+ L G  RL++R SGTE LI
Sbjct: 360 ASDLAQQFETVPQLLKNVRYGEGQAPLEADTVKAAIADAEARLNGRGRLLIRKSGTEPLI 419

Query: 421 RIMAEGDDLSRIKRIVDDLAKVIPMI 446
           R+MAE +D   + ++VD +   +  +
Sbjct: 420 RVMAECEDDVLLAQVVDGIVAEVEAV 445


>gi|84683649|ref|ZP_01011552.1| Phosphoglucomutase/phosphomannomutase [Maritimibacter alkaliphilus
           HTCC2654]
 gi|84668392|gb|EAQ14859.1| Phosphoglucomutase/phosphomannomutase [Rhodobacterales bacterium
           HTCC2654]
          Length = 448

 Score =  261 bits (665), Expect = 2e-67,   Method: Composition-based stats.
 Identities = 222/450 (49%), Positives = 316/450 (70%), Gaps = 4/450 (0%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKH-RRVVIGKDTRLSGYMLE 59
           M  + FGTDG+RG +N+ P+T    +++G A G  FR   K+  RVVIGKDTRLSGYMLE
Sbjct: 1   MAEKLFGTDGVRGLANSHPMTAEMALKLGAAAGRFFRSDGKNDHRVVIGKDTRLSGYMLE 60

Query: 60  NSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGY 119
           N+L AG T+ GM+  +LGP+P+PAV  LT S+RAD+G+MISASHN + DNGIK FGPDG+
Sbjct: 61  NALTAGLTSTGMNVLLLGPVPTPAVGHLTHSMRADLGIMISASHNHFTDNGIKFFGPDGF 120

Query: 120 KVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRI 179
           K+S + E  IE ++++ +   L+  ++IG A+R+D    RY+E +K T P D  L GL++
Sbjct: 121 KLSDEAEADIERMVDEGVE--LAHPENIGRARRIDEGRHRYVEFIKTTFPSDHRLDGLKV 178

Query: 180 VVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIG 239
           V+DCANGA+Y+ APE  WELGA+V+ +G KPNG NINL+CGST+  +  + V +  AD+G
Sbjct: 179 VIDCANGAAYRAAPEALWELGAEVIEVGVKPNGTNINLECGSTDTRTAVKAVLDHGADVG 238

Query: 240 IALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAG 299
           I LDGD DRV+I+DE G + +GDQIMAL+A  +     LRG  +V TVMSN+GLER++ G
Sbjct: 239 ICLDGDADRVMIIDETGRVADGDQIMALMAGRFAEKGALRGGALVATVMSNLGLERYLGG 298

Query: 300 LGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYD 359
            GL L+RT+VGDRY++E M+  GFN+GGEQSGHI+++DY +TGDGL+A LQ L  + +  
Sbjct: 299 KGLRLERTKVGDRYVVERMREGGFNLGGEQSGHIVMTDYATTGDGLLAGLQFLAAMVETG 358

Query: 360 KPVSTICHCFEEYPQFLRSVSV-KDTSILNSSSIVQAIADAESELRGIDRLIVRASGTES 418
           +  S +   F+  PQ L++V      + L+  ++ + IA +E +L G  RL++R SGTE 
Sbjct: 359 QRASDLTQVFDTVPQLLKNVRYHAGQTPLDDENVRKVIAASEQDLTGKGRLLIRKSGTEP 418

Query: 419 LIRIMAEGDDLSRIKRIVDDLAKVIPMIDS 448
           LIR+MAE +D + + ++VD +   +    +
Sbjct: 419 LIRVMAECEDETFLTQVVDRIVAEVERATA 448


>gi|323141873|ref|ZP_08076734.1| phosphoglucosamine mutase [Phascolarctobacterium sp. YIT 12067]
 gi|322413620|gb|EFY04478.1| phosphoglucosamine mutase [Phascolarctobacterium sp. YIT 12067]
          Length = 446

 Score =  261 bits (665), Expect = 2e-67,   Method: Composition-based stats.
 Identities = 190/447 (42%), Positives = 287/447 (64%), Gaps = 6/447 (1%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M R  FGTDG+RG +N   +TP    ++G A    F  +    +++IG+DTR SG MLE+
Sbjct: 1   MAR-LFGTDGVRGVANV-ELTPELAFKLGYAAAKYFGREVSCPKIIIGRDTRRSGQMLES 58

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +L AG  +AG +A +LG +P+PA++ LT  ++A+ GV+ISASHNP++DNGIK F   G+K
Sbjct: 59  ALAAGICSAGGNAHLLGVMPTPAISFLTSEVKANAGVVISASHNPFEDNGIKFFSQTGHK 118

Query: 121 VSTDIEDRIETLLEDDLT-SYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRI 179
           +   +ED I  ++   +  +      S+G       +   YI+H+  T      L GL+I
Sbjct: 119 LPDAVEDEIAAIVAAPIDYTQAVSGSSVGQIIHEKDLSALYIKHILSTA--YAKLNGLKI 176

Query: 180 VVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIG 239
           V+DC+NGA+ ++AP +   LGA+VV I ++PNGININ  CGST++ +LQ+KV EV A +G
Sbjct: 177 VMDCSNGANSEIAPVILRSLGAEVVAIFNEPNGININNGCGSTHLEALQKKVVEVGAHVG 236

Query: 240 IALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAG 299
           IA DGD DR ++VDE G  ++GDQIM + A E M  + L  N +VTTVMSN+GL + +  
Sbjct: 237 IANDGDADRCLVVDENGEAMDGDQIMLICALELMKRNKLHDNMLVTTVMSNVGLHQAMKA 296

Query: 300 LGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYD 359
            G    +T VGDRY++E M  + +++GGEQSGHII S++  TGDG++ A+Q+L  + + +
Sbjct: 297 HGGKTVKTAVGDRYVLEEMLKHNYSIGGEQSGHIIFSEFAKTGDGILTAVQLLCAMVRNN 356

Query: 360 KPVSTICHCFEEYPQFLRSVSVKDTS-ILNSSSIVQAIADAESELRGIDRLIVRASGTES 418
           KP+S +     ++PQ L +V VK+ +     ++I + I   + EL    +++VRASGTE 
Sbjct: 357 KPLSEMGAVMTKFPQILLNVRVKNKNGWEEKAAIQEVIKKYQEELGENGQILVRASGTEP 416

Query: 419 LIRIMAEGDDLSRIKRIVDDLAKVIPM 445
           LIRIMAEG    R+++I + +A V+  
Sbjct: 417 LIRIMAEGPKQERLEQIANAIADVVTK 443


>gi|157690961|ref|YP_001485423.1| phosphoglucosamine mutase [Bacillus pumilus SAFR-032]
 gi|166990399|sp|A8F9E6|GLMM_BACP2 RecName: Full=Phosphoglucosamine mutase
 gi|157679719|gb|ABV60863.1| phosphoglucosamine mutase [Bacillus pumilus SAFR-032]
          Length = 448

 Score =  261 bits (665), Expect = 2e-67,   Method: Composition-based stats.
 Identities = 186/444 (41%), Positives = 275/444 (61%), Gaps = 5/444 (1%)

Query: 4   RFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSLV 63
           ++FGTDG+RG +N   +TP    +IG   GY+    K+  +V++G+DTR+SG+MLE +LV
Sbjct: 3   KYFGTDGVRGVAN-SELTPELAFKIGRFGGYVLTKDKERPKVLVGRDTRVSGHMLEGALV 61

Query: 64  AGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVST 123
           AG  + G +   LG I +P V+ LT+++ A+ GVMISASHNP QDNGIK FG DG+K+S 
Sbjct: 62  AGLLSIGAEVMRLGVISTPGVSYLTKAMDAEAGVMISASHNPVQDNGIKFFGGDGFKLSD 121

Query: 124 DIEDRIETLLEDDLTSYLSCYD-SIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVVD 182
           + E+ IE L++  +          +G          +Y++ +K+T   D T  G+ + +D
Sbjct: 122 EQENEIEQLMDQPVDQLPRPVGADLGTVNDYFEGGQKYLQFLKQTADEDFT--GIHVALD 179

Query: 183 CANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIAL 242
           CA+GA+  +A  +F +L ADV  +G  PNG+NIN   GST+  +L   V E  ADIG+A 
Sbjct: 180 CAHGATSSLATHLFADLDADVSTMGTSPNGLNINDGVGSTHPEALSVFVKEKGADIGLAF 239

Query: 243 DGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLGL 302
           DGDGDR+I VDEKG IV+GDQIM + AR       L+ N +V+TVMSN+G  + +   G+
Sbjct: 240 DGDGDRLIAVDEKGDIVDGDQIMYICARYLKGEGRLKDNTVVSTVMSNLGFYKALEKQGI 299

Query: 303 SLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKPV 362
              +T VGDRY++E MK +G+NVGGEQSGH+I  DY +TGDG+++A+ ++  +K   K +
Sbjct: 300 KSIQTAVGDRYVVEAMKKDGYNVGGEQSGHLIFLDYNTTGDGMLSAIMLVNTLKATGKTL 359

Query: 363 STICHCFEEYPQFLRSVSVKDT-SILNSSSIVQAIADAESELRGIDRLIVRASGTESLIR 421
           S +    E++PQ L +V V D   +  +  +   I + E E+ G  R++VR SGTE L+R
Sbjct: 360 SELAAEMEKFPQLLVNVKVSDKYKVEENEKVKAVIQEVEKEMNGDGRILVRPSGTEPLVR 419

Query: 422 IMAEGDDLSRIKRIVDDLAKVIPM 445
           +MAE          V  +  V+  
Sbjct: 420 VMAEAKTKELCDEYVTRITAVVKE 443


>gi|77166025|ref|YP_344550.1| phosphoglucosamine mutase [Nitrosococcus oceani ATCC 19707]
 gi|254436368|ref|ZP_05049874.1| phosphoglucosamine mutase [Nitrosococcus oceani AFC27]
 gi|84029244|sp|Q3J826|GLMM_NITOC RecName: Full=Phosphoglucosamine mutase
 gi|76884339|gb|ABA59020.1| phosphoglucosamine mutase [Nitrosococcus oceani ATCC 19707]
 gi|207088058|gb|EDZ65331.1| phosphoglucosamine mutase [Nitrosococcus oceani AFC27]
          Length = 451

 Score =  261 bits (665), Expect = 2e-67,   Method: Composition-based stats.
 Identities = 215/445 (48%), Positives = 311/445 (69%), Gaps = 5/445 (1%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M++++FGTDGIRGK    PITP+F++ +G AVG +   + +  +V+IGKDTR+SGYM E+
Sbjct: 1   MEKKYFGTDGIRGKVGERPITPDFILHLGWAVGRVL-AQGRQSKVLIGKDTRISGYMFES 59

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +L AG +AAG+D  +LGP+P+PA+A LTR+L A  G++ISASHNPY DNGIK F   G K
Sbjct: 60  ALQAGLSAAGVDIRLLGPMPTPAIAYLTRTLHAKAGIVISASHNPYYDNGIKFFSSAGTK 119

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +  +IE  IE  LE  + +       +G A+RV     RYIE  K T P  V L  LR+V
Sbjct: 120 LPDEIEVAIEAELEKPMQTA--TSSRLGKAERVVDAAGRYIEFCKSTGPASVDLSELRLV 177

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           +DCA+GA+Y+VAPEVF E+GAD+ VIG  PNG+NIN +CGST + SLQ KV E +AD+GI
Sbjct: 178 LDCAHGATYQVAPEVFAEMGADITVIGASPNGLNINENCGSTALESLQHKVLECKADVGI 237

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           ALDGDGDRVI++D++G IV+GD I+ +IAR     S L G  + T  MSN+GLE+ +A L
Sbjct: 238 ALDGDGDRVIMIDQRGEIVDGDDILYIIARARQRTSKLTGAVVGTL-MSNLGLEKALATL 296

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           G+ L R++VGDRY++E ++ NG+++GGE SGHII  D  +TGDG+V+ALQVL  +     
Sbjct: 297 GIPLMRSQVGDRYVLEMLQCNGYSLGGESSGHIICLDRTTTGDGIVSALQVLVEMVATGH 356

Query: 361 PVSTICHCFEEYPQFLRSVSV-KDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESL 419
            +  +     +YPQ L +V V +  ++ ++++I+ A+ +AE++L    R+++R SGTE +
Sbjct: 357 SLYELKSGVVKYPQCLINVQVARSINLHDNNAIINAMQEAENQLGDEGRVLLRPSGTEPV 416

Query: 420 IRIMAEGDDLSRIKRIVDDLAKVIP 444
           +R+M EG D+S++  +   LA+ + 
Sbjct: 417 VRVMVEGRDISQVNSLAQQLAQEVA 441


>gi|261342619|ref|ZP_05970477.1| phosphoglucosamine mutase [Enterobacter cancerogenus ATCC 35316]
 gi|288315267|gb|EFC54205.1| phosphoglucosamine mutase [Enterobacter cancerogenus ATCC 35316]
          Length = 445

 Score =  261 bits (665), Expect = 3e-67,   Method: Composition-based stats.
 Identities = 200/446 (44%), Positives = 292/446 (65%), Gaps = 6/446 (1%)

Query: 2   KRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENS 61
            R++FGTDGIRG+    PITP+F++++G A G +   +   R+++IGKDTR+SGYMLE++
Sbjct: 3   NRKYFGTDGIRGRVGDAPITPDFVLKLGWAAGKVL-ARHGSRKIIIGKDTRISGYMLESA 61

Query: 62  LVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKV 121
           L AG +AAG+ A   GP+P+PAVA LTR+ RA+ G++ISASHNP+ DNGIK F  DG K+
Sbjct: 62  LEAGLSAAGLSASFTGPMPTPAVAYLTRTFRAEAGIVISASHNPFYDNGIKFFSIDGTKL 121

Query: 122 STDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVV 181
             ++E+ IE  +E ++T        +G A R+     RYIE  K T P +++L  L+IVV
Sbjct: 122 PDEVEEAIEAEMEKEIT--CVDSAELGKANRIVDAAGRYIEFCKGTFPNELSLAHLKIVV 179

Query: 182 DCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIA 241
           DCANGA+Y +AP VF ELGA V+ IG +P+G+NIN + G+T+V +LQ +V   +AD+GIA
Sbjct: 180 DCANGATYHIAPNVFRELGAKVITIGCEPDGLNINEEVGATDVRALQARVLAEKADLGIA 239

Query: 242 LDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLG 301
           LDGDGDRVI+VD +G  V+GDQI+ +IARE +        G V T+MSN+GLE  +  LG
Sbjct: 240 LDGDGDRVIMVDHEGNKVDGDQILYIIAREGLRQ-GQLRGGAVGTLMSNMGLELALKQLG 298

Query: 302 LSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKP 361
           +   R +VGDRY++E ++  G+ +G E SGH+IL D  +TGDG+VA LQV+  + +    
Sbjct: 299 IPFVRAKVGDRYVLEKLQEKGWRIGAENSGHVILLDKTTTGDGIVAGLQVVAAMARNHMS 358

Query: 362 VSTICHCFEEYPQFLRSVSVK--DTSILNSSSIVQAIADAESELRGIDRLIVRASGTESL 419
           +  +C   + +PQ L +V         L +  +   +A  E  L    R+++R SGTE L
Sbjct: 359 LHDLCSGMKLFPQILVNVRFTAGKGDPLENEQVKAVMAKVEEALGNRGRVLLRKSGTEPL 418

Query: 420 IRIMAEGDDLSRIKRIVDDLAKVIPM 445
           IR+M EG+D +++      +A  +  
Sbjct: 419 IRVMVEGEDEAQVTEFAHRIADAVKA 444


>gi|254482570|ref|ZP_05095809.1| phosphoglucosamine mutase [marine gamma proteobacterium HTCC2148]
 gi|214037261|gb|EEB77929.1| phosphoglucosamine mutase [marine gamma proteobacterium HTCC2148]
          Length = 449

 Score =  261 bits (665), Expect = 3e-67,   Method: Composition-based stats.
 Identities = 200/450 (44%), Positives = 288/450 (64%), Gaps = 7/450 (1%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYL---FRGKKKHRRVVIGKDTRLSGYM 57
           M R++FGTDGIRG      ITP+FM+++G A G +         H  V+IGKDTR+SGYM
Sbjct: 1   MTRKYFGTDGIRGAVGEGVITPDFMLKLGWACGRVFSRLADNDGHCMVIIGKDTRVSGYM 60

Query: 58  LENSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPD 117
            E++L AG  AAG+D  +LGP+P+PAVA++TR+  AD G++ISASHN +QDNGIK F   
Sbjct: 61  FESALEAGLVAAGVDVKLLGPMPTPAVALMTRTQAADAGIVISASHNAFQDNGIKFFSAS 120

Query: 118 GYKVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGL 177
           G K+  ++E  IE  L++ L +       IG   RV     RYIE  K T+P    L+G+
Sbjct: 121 GSKLPDEVELAIEAELDEQLVTV--GSKDIGKVLRVVDAAGRYIEFCKSTVPEGFNLRGM 178

Query: 178 RIVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRAD 237
           R+ VDCA+GA+Y +AP VF ELGA+V+ +G +P+G NIN   GST+  +L   V E  AD
Sbjct: 179 RVAVDCAHGATYHIAPSVFSELGAEVISLGVQPDGFNINEGVGSTHTEALAALVQEQGAD 238

Query: 238 IGIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFI 297
            GIA DGDGDRV+ VD  G +V+GD+++ +IAR  ++       G+V T+M+N+G+E  +
Sbjct: 239 FGIAFDGDGDRVLFVDADGELVDGDELIYIIARHRLAA-GSSDAGVVGTLMTNLGMEIAL 297

Query: 298 AGLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQ 357
              GL L R +VGDRY+ E M+  G+++GGE SGHII SD  +TGDG+VAALQVLR I+ 
Sbjct: 298 REEGLQLVRAQVGDRYVKERMETEGWHLGGESSGHIICSDITTTGDGIVAALQVLRAIRD 357

Query: 358 YDKPVSTICHCFEEYPQFLRSVSVKDTSILNS-SSIVQAIADAESELRGIDRLIVRASGT 416
             + +S +    ++YPQ + +V V     LN+   +   +   E +L    R+++R SGT
Sbjct: 358 SGQTLSALRSGMKKYPQTMINVRVAGKVDLNAYPDVQDRVEAVEQQLGDRGRVLLRPSGT 417

Query: 417 ESLIRIMAEGDDLSRIKRIVDDLAKVIPMI 446
           E ++R+M EG+D +++  +   LA  +  I
Sbjct: 418 EPVVRVMVEGEDDAQVSSLCATLAADVERI 447


>gi|30248545|ref|NP_840615.1| phosphoglucomutase and phosphomannomutase family protein
           [Nitrosomonas europaea ATCC 19718]
 gi|75541002|sp|Q82WX6|GLMM_NITEU RecName: Full=Phosphoglucosamine mutase
 gi|30138431|emb|CAD84441.1| Phosphoglucomutase and phosphomannomutase family [Nitrosomonas
           europaea ATCC 19718]
          Length = 458

 Score =  261 bits (665), Expect = 3e-67,   Method: Composition-based stats.
 Identities = 195/452 (43%), Positives = 277/452 (61%), Gaps = 10/452 (2%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKK------KHRRVVIGKDTRLS 54
           MK+++FGTDGIRGK   FPITP+F +R+G AVG +           K   V+IGKDTR+S
Sbjct: 1   MKKKYFGTDGIRGKVGDFPITPDFFLRLGYAVGKVLLASDRQLAADKRPTVLIGKDTRIS 60

Query: 55  GYMLENSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLF 114
           GYMLE++L AGF+AAG+D  + GP+P+PAVA L R+LR   G +ISASHNP+ DNGIK F
Sbjct: 61  GYMLESALEAGFSAAGVDVLLSGPLPTPAVAYLVRALRIQAGAVISASHNPFDDNGIKFF 120

Query: 115 GPDGYKVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTL 174
              G K+   +E +IE  L+  + +  S    +G  +R+     RYIE  K T P  + L
Sbjct: 121 SSAGSKLPDSMELQIEAELDQPMKTTPSI--KLGRVQRLRDAAGRYIEFCKSTFPNQLDL 178

Query: 175 QGLRIVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEV 234
           +GLRIVVDCANGA Y +A  V  ELGADV+     P+G NIN +CG+T++ +LQ  + + 
Sbjct: 179 RGLRIVVDCANGADYHIAGHVMHELGADVITTHASPDGFNINYECGATHIETLQGSILQH 238

Query: 235 RADIGIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLE 294
           +ADIGIA+DGDGDRV++V  +G + +GD +  +IA+           G+  T+M+N+ +E
Sbjct: 239 KADIGIAVDGDGDRVLMVSREGVLYDGDSLAYIIAKHRQQL-GELQGGVAGTLMTNLAVE 297

Query: 295 RFIAGLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRY 354
           +    LG+   R  VGDRY+ E ++ N + +G E SGHII  D  +TGDG+++ALQVL  
Sbjct: 298 QAFERLGIPFARANVGDRYVSELLQQNDWYLGAENSGHIICRDKHTTGDGIISALQVLYA 357

Query: 355 IKQYDKPVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIA-DAESELRGIDRLIVRA 413
           ++     ++        +PQ L +V V       S+  V A   +AE  L    R+++RA
Sbjct: 358 LRDTGLTLADFMRDVPFFPQRLINVKVSGNFDFRSNPAVAACKNEAEQALGNDGRILLRA 417

Query: 414 SGTESLIRIMAEGDDLSRIKRIVDDLAKVIPM 445
           SGTE LIR+M EG  L +     + +A+ I  
Sbjct: 418 SGTEPLIRVMVEGKVLQQTDYWAEKIAETIRQ 449


>gi|325142880|gb|EGC65247.1| phosphoglucosamine mutase [Neisseria meningitidis 961-5945]
          Length = 444

 Score =  261 bits (665), Expect = 3e-67,   Method: Composition-based stats.
 Identities = 197/445 (44%), Positives = 290/445 (65%), Gaps = 6/445 (1%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKK--KHRRVVIGKDTRLSGYML 58
           M +++FGTDG+RG+   FPITP+F++++G A G +       +   V+IGKDTR+SGYML
Sbjct: 1   MAKKYFGTDGVRGEVGQFPITPDFVLKLGYAAGQVLVQHDTDQKPTVLIGKDTRISGYML 60

Query: 59  ENSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDG 118
           E +LVAGFTAAG++    GP+P+P VA LTR+LR   GVMISASHN Y DNGIK F   G
Sbjct: 61  EAALVAGFTAAGVNVVQTGPLPTPGVAYLTRALRLSAGVMISASHNAYSDNGIKFFAEGG 120

Query: 119 YKVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLR 178
            K+S +IE  IE  ++ ++ +       +G A+R+ G  DRYIE  K T P    L+GL+
Sbjct: 121 VKLSDEIELEIEAKIDGEMKTQP--SARLGRARRISGADDRYIEFCKSTFPSHSDLRGLK 178

Query: 179 IVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADI 238
           +V+D ANGA Y VAP+VF ELGA VV IGD+PNG NIN  CG+T   +LQ  V +  AD 
Sbjct: 179 LVIDTANGAGYGVAPKVFHELGAQVVSIGDEPNGYNINEKCGATYTKTLQAAVLQHEADY 238

Query: 239 GIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIA 298
           GIALDGDGDR+++VD+ G + +GD ++ +IA+   +   +   G+V TVM+N+ +E  + 
Sbjct: 239 GIALDGDGDRLMMVDKNGKVYDGDSLIYVIAK-ARAREGINIGGVVGTVMTNMAMEIALK 297

Query: 299 GLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQY 358
             G+   R +VGDRY++E +   G+ +GGE SGHI+  D  +TGDG+++ALQVL  ++  
Sbjct: 298 EQGVDFCRAKVGDRYVLEQLNQRGWLIGGEASGHILCMDKHNTGDGIISALQVLAALQTL 357

Query: 359 DKPVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTES 418
           ++ ++T+C  ++ YPQ + +V ++       +S    +A+ E EL G  R+++RASGTE 
Sbjct: 358 NQDLATVCADWQPYPQTMINVRIQKGQKWQEAS-KDVLAEVEKELEGKGRVVLRASGTEP 416

Query: 419 LIRIMAEGDDLSRIKRIVDDLAKVI 443
           ++R+M E       +   + +A  I
Sbjct: 417 VVRVMVEARQADWARDGAERIASAI 441


>gi|329568377|gb|EGG50186.1| phosphoglucosamine mutase [Enterococcus faecalis TX1467]
          Length = 451

 Score =  260 bits (664), Expect = 3e-67,   Method: Composition-based stats.
 Identities = 181/447 (40%), Positives = 268/447 (59%), Gaps = 8/447 (1%)

Query: 4   RFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGK---KKHRRVVIGKDTRLSGYMLEN 60
           ++FGTDG+RG +N   +TP    ++G   GY+        +  RV++G+DTR+SG MLE 
Sbjct: 3   KYFGTDGVRGIANK-ELTPELAFKLGRYGGYVLSQHEDSSRKPRVLVGRDTRISGEMLEQ 61

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +L+AG  + G++ F LG I +P VA LTR  +A  GVMISASHNP  DNGIK FG DG+K
Sbjct: 62  ALIAGLLSVGIEVFQLGVISTPGVAYLTRLQKASAGVMISASHNPADDNGIKFFGADGFK 121

Query: 121 VSTDIEDRIETLLE-DDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRI 179
           +  D E  IE LL+ ++ T      + +G          +Y + + +++P    L  + +
Sbjct: 122 LVDDQEAEIEALLDAEEDTLPRPSAEGLGSLDEFPEGLLKYSQFLVQSIPG--DLADMTV 179

Query: 180 VVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIG 239
            +D ANGA+      VF +L  D   +G  PNG+NIN   GST+  +L   V E  AD G
Sbjct: 180 CLDAANGATATAVNRVFADLETDFYTMGTSPNGLNINDGVGSTHPEALAEMVVEKGADAG 239

Query: 240 IALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAG 299
           +A DGDGDR+I VDE G I++GD+IM + A+       L+ +  VTTVMSN+G  + +  
Sbjct: 240 LAFDGDGDRIIAVDELGRIIDGDKIMYICAKYLAEKKRLKKDTNVTTVMSNLGFHKAVEE 299

Query: 300 LGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYD 359
           +GL    T+VGDRY++E M+ N +N GGEQSGH+I  DY +TGDG+++ +Q+L  +KQ  
Sbjct: 300 IGLKDVVTQVGDRYVVEEMRKNDYNFGGEQSGHMIFLDYNTTGDGMLSGIQLLNVMKQTG 359

Query: 360 KPVSTICHCFEEYPQFLRSVSVKDTS-ILNSSSIVQAIADAESELRGIDRLIVRASGTES 418
           K +S +      YPQ L ++ V D +  +   +I   +  AE+E+ G  R++VR SGTE 
Sbjct: 360 KKLSELADEVTIYPQKLVNIRVTDKNGAMEVPAIKAVVEQAEAEMNGEGRILVRPSGTEP 419

Query: 419 LIRIMAEGDDLSRIKRIVDDLAKVIPM 445
           L+R+MAE     ++   VD +A+V+  
Sbjct: 420 LLRVMAEAPTQEKVDYYVDKIAEVVRA 446


>gi|258543910|ref|ZP_05704144.1| phosphoglucosamine mutase [Cardiobacterium hominis ATCC 15826]
 gi|258520849|gb|EEV89708.1| phosphoglucosamine mutase [Cardiobacterium hominis ATCC 15826]
          Length = 448

 Score =  260 bits (664), Expect = 3e-67,   Method: Composition-based stats.
 Identities = 204/443 (46%), Positives = 290/443 (65%), Gaps = 4/443 (0%)

Query: 3   RRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKK-KHRRVVIGKDTRLSGYMLENS 61
           R++FGTDG+RGK    P+TP+F+M +G A+G +         +V+IGKDTR+SGYMLEN+
Sbjct: 6   RKYFGTDGVRGKVGVAPMTPDFVMHLGWAIGKMLSDSGFAGDKVIIGKDTRISGYMLENA 65

Query: 62  LVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKV 121
           + AG +AAGMDA +LG +P+P +A  TR+  A  G+++SASHN Y DNGIK+F   G K+
Sbjct: 66  IAAGLSAAGMDAHLLGVMPTPGIAYFTRTFHAAAGIVVSASHNVYSDNGIKVFARGGIKL 125

Query: 122 STDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVV 181
               E  IE  LE  L   +     +G   R+     RYIE  K  +   +  + L+IVV
Sbjct: 126 PDAAEQEIERYLE--LPMKVVESAQLGKLYRIPEARGRYIEFCKNAVMLGLPFERLKIVV 183

Query: 182 DCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIA 241
           DCANGA+Y +APEVF ELGA V+V+  +PNG NIN   GST   SLQR+V + +AD GIA
Sbjct: 184 DCANGATYPIAPEVFRELGAQVIVMNAEPNGCNINAGAGSTAPESLQRRVRDEQADAGIA 243

Query: 242 LDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLG 301
            DGDGDRV++VD  G + +GD I+ +IA+   +    + N IV T M+N+GLER +  +G
Sbjct: 244 FDGDGDRVVMVDRNGRLRDGDAILYIIAKYR-AFKGEQLNNIVGTKMTNLGLERALNNMG 302

Query: 302 LSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKP 361
           + L RT+VGDRY++E M+     VGGE SGHII  D  STGDG++AALQVL  + + ++P
Sbjct: 303 IVLHRTDVGDRYVLECMQEINARVGGENSGHIICLDRNSTGDGIIAALQVLAAMLEMEQP 362

Query: 362 VSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLIR 421
           +  +    +   Q +++V V D +++N +++ QA+ +A  +L    R+++R SGTE  IR
Sbjct: 363 LHQLVADLQMAVQVMKNVEVADKTVVNKTAVQQALQEATQKLGDAGRILLRPSGTEPKIR 422

Query: 422 IMAEGDDLSRIKRIVDDLAKVIP 444
           +MAEG D +R+  IVD+LA VI 
Sbjct: 423 VMAEGHDEARLHAIVDELAAVIS 445


>gi|313891556|ref|ZP_07825166.1| phosphoglucosamine mutase [Dialister microaerophilus UPII 345-E]
 gi|313120015|gb|EFR43197.1| phosphoglucosamine mutase [Dialister microaerophilus UPII 345-E]
          Length = 449

 Score =  260 bits (664), Expect = 3e-67,   Method: Composition-based stats.
 Identities = 186/443 (41%), Positives = 277/443 (62%), Gaps = 4/443 (0%)

Query: 4   RFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSLV 63
           + FGTDG+RG  N+  + P    ++G A G  F  ++   + +IG DTR+SG ML  SL 
Sbjct: 3   KLFGTDGVRGVVNSSLM-PELAYQLGRAAGAYFCKREGRHKFLIGMDTRISGTMLMASLA 61

Query: 64  AGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVST 123
           +G  ++G+D  I G IP+PA+A LTR    D GV+ISASHNP++DNGIK F  +GYK+  
Sbjct: 62  SGLCSSGVDVDIAGVIPTPAIAYLTRVEGYDAGVVISASHNPFRDNGIKFFDKNGYKLPD 121

Query: 124 DIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVVDC 183
             E+ IE +L  +          +G  ++   + ++Y ++V  T      L+G++IV D 
Sbjct: 122 STENEIEDILRHNELIPRPLGADVGVIRQRTELAEKYRKYVASTA--FQDLKGMKIVTDS 179

Query: 184 ANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIALD 243
           ANGA+ K  PE+   LG DVV +  +P+G+NIN +CGST++ +LQ++V E  A  GIA D
Sbjct: 180 ANGAASKFMPEILRALGVDVVALSCEPDGVNINENCGSTHIEALQKRVVEEGAICGIAND 239

Query: 244 GDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLGLS 303
           GD DR ++VDE+G +++GD IM + A      + L+ N +V TVMSN+G  + +   G  
Sbjct: 240 GDADRCLLVDEEGNVLDGDHIMLINALHMKEKNQLKDNMVVGTVMSNLGFGKALKEHGCK 299

Query: 304 LKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKPVS 363
              T VGDRY++E M+ + +++GGEQSGHII   + +TGDGL+ A+Q +  +K+  K +S
Sbjct: 300 TVSTRVGDRYVLEEMRKHDYSLGGEQSGHIIFPQFNTTGDGLITAVQTMCVLKESGKKLS 359

Query: 364 TICHCFEEYPQFLRSVSVKDTS-ILNSSSIVQAIADAESELRGIDRLIVRASGTESLIRI 422
            +      YPQ L++V V   +   N+  I  +IA AE EL G  R++VRASGTE LIR+
Sbjct: 360 DLRKLMTTYPQVLKNVEVYSKNGWENNELIQNSIASAEEELNGEGRILVRASGTEPLIRV 419

Query: 423 MAEGDDLSRIKRIVDDLAKVIPM 445
           M EG DL +++RI+DD+A V+  
Sbjct: 420 MGEGKDLDQLQRIIDDIASVVEQ 442


>gi|213966652|ref|ZP_03394803.1| phosphoglucosamine mutase [Pseudomonas syringae pv. tomato T1]
 gi|301383162|ref|ZP_07231580.1| phosphoglucosamine mutase [Pseudomonas syringae pv. tomato Max13]
 gi|302063403|ref|ZP_07254944.1| phosphoglucosamine mutase [Pseudomonas syringae pv. tomato K40]
 gi|213928502|gb|EEB62046.1| phosphoglucosamine mutase [Pseudomonas syringae pv. tomato T1]
          Length = 447

 Score =  260 bits (664), Expect = 3e-67,   Method: Composition-based stats.
 Identities = 192/447 (42%), Positives = 294/447 (65%), Gaps = 6/447 (1%)

Query: 2   KRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENS 61
            R++FGTDGIRG+   FPITP FM+++G A G  FR K    R+++GKDTR+SGYM E++
Sbjct: 3   TRKYFGTDGIRGRVGQFPITPEFMLKLGWAAGMAFR-KMGACRILVGKDTRISGYMFESA 61

Query: 62  LVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKV 121
           L AG +AAG D  +LGP+P+PA+A LTR+  A+ G++ISASHNP+ DNGIK F   G K+
Sbjct: 62  LEAGLSAAGADVLLLGPMPTPAIAYLTRTFHAEAGIVISASHNPHYDNGIKFFSGQGTKL 121

Query: 122 STDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVV 181
             +IE  IE LL+  +T  ++  +++G   R++    RYIE  K ++P      GL++V+
Sbjct: 122 PDEIEMMIEELLDAPMT--VAESENLGKVSRINDAAGRYIEFCKSSVPTSTDFAGLKVVI 179

Query: 182 DCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIA 241
           DCA+GA+YKVAP VF ELGA VVV+  +P+G+NIN DCGST++ +LQ  V    AD+GI 
Sbjct: 180 DCAHGATYKVAPNVFRELGAQVVVLSAQPDGLNINKDCGSTHMEALQAAVVAEHADMGIG 239

Query: 242 LDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLG 301
            DGDGDRV++VD  G IV+GD+++ +IAR+      L+G  + T  MSN+GLE  +A   
Sbjct: 240 FDGDGDRVLMVDHTGTIVDGDELLYIIARDLHERGRLQGGVVGTL-MSNLGLELALAEQN 298

Query: 302 LSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKP 361
           +   R  VGDRY++  +    + +GGE SGHI+   + +TGD ++A+LQV+  +++    
Sbjct: 299 IPFVRANVGDRYVIAELLERNWQIGGENSGHIVCFQHATTGDAIIASLQVILALRRSGIS 358

Query: 362 VSTICHCFEEYPQFLRSVSVKDTSIL--NSSSIVQAIADAESELRGIDRLIVRASGTESL 419
           ++       + PQ L +V  + +S+      S+ +A A    ++ G  R+++R SGTE L
Sbjct: 359 LAEARLKLRKCPQILINVRFEGSSVDPVTHPSVQEACARVTEQMAGRGRVLLRKSGTEPL 418

Query: 420 IRIMAEGDDLSRIKRIVDDLAKVIPMI 446
           +R+M EG+D ++++   ++LAK++  +
Sbjct: 419 VRVMVEGEDEAQVRAYAEELAKLVAEV 445


>gi|28871629|ref|NP_794248.1| phosphoglucosamine mutase [Pseudomonas syringae pv. tomato str.
           DC3000]
 gi|81729681|sp|Q87WQ0|GLMM_PSESM RecName: Full=Phosphoglucosamine mutase
 gi|28854881|gb|AAO57943.1| phosphoglucosamine mutase [Pseudomonas syringae pv. tomato str.
           DC3000]
 gi|331016643|gb|EGH96699.1| phosphoglucosamine mutase [Pseudomonas syringae pv. lachrymans str.
           M302278PT]
          Length = 447

 Score =  260 bits (664), Expect = 3e-67,   Method: Composition-based stats.
 Identities = 192/447 (42%), Positives = 294/447 (65%), Gaps = 6/447 (1%)

Query: 2   KRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENS 61
            R++FGTDGIRG+   FPITP FM+++G A G  FR K    R+++GKDTR+SGYM E++
Sbjct: 3   TRKYFGTDGIRGRVGQFPITPEFMLKLGWAAGMAFR-KMGACRILVGKDTRISGYMFESA 61

Query: 62  LVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKV 121
           L AG +AAG D  +LGP+P+PA+A LTR+  A+ G++ISASHNP+ DNGIK F   G K+
Sbjct: 62  LEAGLSAAGADVLLLGPMPTPAIAYLTRTFHAEAGIVISASHNPHYDNGIKFFSGQGTKL 121

Query: 122 STDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVV 181
             +IE  IE LL+  +T  ++  +++G   R++    RYIE  K ++P      GL++V+
Sbjct: 122 PDEIEMMIEELLDAPMT--VAESENLGKVSRINDAAGRYIEFCKSSVPTSTDFAGLKVVI 179

Query: 182 DCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIA 241
           DCA+GA+YKVAP VF ELGA VVV+  +P+G+NIN DCGST++ +LQ  V    AD+GI 
Sbjct: 180 DCAHGATYKVAPNVFRELGAQVVVLSAQPDGLNINKDCGSTHMEALQAAVVAEHADMGIG 239

Query: 242 LDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLG 301
            DGDGDRV++VD  G IV+GD+++ +IAR+      L+G  + T  MSN+GLE  +A   
Sbjct: 240 FDGDGDRVLMVDHTGTIVDGDELLYIIARDLHERGRLQGGVVGTL-MSNLGLELALAEQN 298

Query: 302 LSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKP 361
           +   R  VGDRY++  +    + +GGE SGHI+   + +TGD ++A+LQV+  +++    
Sbjct: 299 IPFVRANVGDRYVIAELLERNWQIGGENSGHIVCFQHATTGDAIIASLQVILALRRSGIS 358

Query: 362 VSTICHCFEEYPQFLRSVSVKDTSIL--NSSSIVQAIADAESELRGIDRLIVRASGTESL 419
           ++       + PQ L +V  + +S+      S+ +A A    ++ G  R+++R SGTE L
Sbjct: 359 LAEARLKLRKCPQILINVRFEGSSVDPVTHPSVQEACARVTEQMAGRGRVLLRKSGTEPL 418

Query: 420 IRIMAEGDDLSRIKRIVDDLAKVIPMI 446
           +R+M EG+D ++++   ++LAK++  +
Sbjct: 419 VRVMVEGEDEAQVRAYAEELAKLVAEV 445


>gi|148549784|ref|YP_001269886.1| phosphoglucosamine mutase [Pseudomonas putida F1]
 gi|166990422|sp|A5W992|GLMM_PSEP1 RecName: Full=Phosphoglucosamine mutase
 gi|148513842|gb|ABQ80702.1| phosphoglucosamine mutase [Pseudomonas putida F1]
          Length = 446

 Score =  260 bits (664), Expect = 3e-67,   Method: Composition-based stats.
 Identities = 201/448 (44%), Positives = 296/448 (66%), Gaps = 6/448 (1%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M R++FGTDGIRG+   +PITP+FM+++G A G  FR +  H RV++GKDTR+SGYM E+
Sbjct: 1   MSRKYFGTDGIRGRVGEYPITPDFMLKLGWAAGMAFRKQG-HCRVLVGKDTRISGYMFES 59

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +L AG +AAG D  +LGP+P+PA+A LTR+  A+ G++ISASHNP+ DNGIK F   G K
Sbjct: 60  ALEAGLSAAGADVMLLGPMPTPAIAYLTRTFHAEAGIVISASHNPHDDNGIKFFSGQGTK 119

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +  ++E  IE LL+  +T  +     +G   R++    RYIE  K ++P   + +GL++V
Sbjct: 120 LPDEVELMIEELLDQPMT--VIESGKLGKVSRINDAAGRYIEFCKSSVPSSTSFEGLKLV 177

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           VDCA+GA+YKVAP VF ELGADV V+  +P+G+NIN  CGST++ SLQ  V    AD+GI
Sbjct: 178 VDCAHGATYKVAPSVFRELGADVTVLHAQPDGLNINEGCGSTHIESLQAAVLVGHADLGI 237

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           A DGDGDRV++VD  GAIV+GD+++ +IAR+   H  L+G  + T  MSN+GLE  +  L
Sbjct: 238 AFDGDGDRVLMVDHTGAIVDGDELLFIIARDLQEHGKLQGGVVGTL-MSNLGLELALKDL 296

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
            +   R +VGDRY+M  +    + VGGE SGH++  ++ +TGD ++AALQVL  +K+  +
Sbjct: 297 DIPFVRAKVGDRYVMAELLEREWLVGGENSGHVVCCNHTTTGDAIIAALQVLMALKRRGE 356

Query: 361 PVSTICHCFEEYPQFLRSVSV--KDTSILNSSSIVQAIADAESELRGIDRLIVRASGTES 418
            ++       + PQ L +V         L   ++ +A A     L G  R+++R SGTE 
Sbjct: 357 TLAQARQALRKCPQVLINVRFGASKVDPLEHPAVKEASAKVTDALAGRGRVLLRKSGTEP 416

Query: 419 LIRIMAEGDDLSRIKRIVDDLAKVIPMI 446
           L+R+M EG+D S+++   + LAK++  +
Sbjct: 417 LVRVMVEGEDESQVRAHAEALAKLVSEV 444


>gi|196231007|ref|ZP_03129867.1| phosphoglucosamine mutase [Chthoniobacter flavus Ellin428]
 gi|196224837|gb|EDY19347.1| phosphoglucosamine mutase [Chthoniobacter flavus Ellin428]
          Length = 474

 Score =  260 bits (664), Expect = 3e-67,   Method: Composition-based stats.
 Identities = 208/453 (45%), Positives = 293/453 (64%), Gaps = 9/453 (1%)

Query: 3   RRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRG-------KKKHRRVVIGKDTRLSG 55
           R+ FGTDG+RG +N  P+T    +++G A  ++F               +VIGKDTRLSG
Sbjct: 19  RKIFGTDGVRGTANIEPVTAETALKLGRAAAHVFAQMSVLAGRSGGRTTIVIGKDTRLSG 78

Query: 56  YMLENSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFG 115
           YMLEN+L AG  + G D  ++GP+P+P VA +TRSLRAD G+++SASHNPY+DNGIK F 
Sbjct: 79  YMLENALAAGVMSLGADVLLIGPLPTPGVAYITRSLRADAGIVLSASHNPYEDNGIKFFR 138

Query: 116 PDGYKVSTDIEDRIETLL-EDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTL 174
           PDGYK+  +IE RIE L+   ++ S       IG A R+D    RY+E  K++ PR  TL
Sbjct: 139 PDGYKLDDEIEQRIEHLVFSGEIESIRPTAGKIGRATRIDDALGRYVEFAKQSFPRGRTL 198

Query: 175 QGLRIVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEV 234
            G+R+ VD ANGA+YK  P +  ELGAD++V  + PNG NIN +CGST+   +QR V E 
Sbjct: 199 DGMRVAVDVANGAAYKSTPCILRELGADIIVAHNTPNGRNINRECGSTHPEEIQRIVKET 258

Query: 235 RADIGIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLE 294
           RA +GI+ DGD DRV++ DE G +V+GD+IMA+ A +++    L  N +V TVMSN GL+
Sbjct: 259 RAQVGISHDGDADRVLLCDEHGEVVDGDEIMAIAALDFLKRGCLAQNTLVATVMSNFGLD 318

Query: 295 RFIAGLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRY 354
             +      + RT+VGDRY++E M     NVGGEQSGH+I  D+ +TGDG+V+ALQ+LR 
Sbjct: 319 ETLQKHSGRVLRTKVGDRYVIEAMMKEELNVGGEQSGHMIFRDFSTTGDGIVSALQILRI 378

Query: 355 IKQYDKPVSTICHCFEEYPQFLRSVSVKDTSILNS-SSIVQAIADAESELRGIDRLIVRA 413
           + +  KP+S +  C  +YPQ  R++ V++   L S  ++ + + + E EL G  R+++R 
Sbjct: 379 MAETGKPLSELKACLAKYPQAQRNLKVREKKPLESLPTVTKLVEETEKELAGAGRVLLRY 438

Query: 414 SGTESLIRIMAEGDDLSRIKRIVDDLAKVIPMI 446
           SGTE  IR++ EG D  RI    D +A  I  +
Sbjct: 439 SGTEPKIRLLIEGRDGDRINLQADRIAGEIQEL 471


>gi|15925151|ref|NP_372685.1| phosphoglucosamine-mutase [Staphylococcus aureus subsp. aureus
           Mu50]
 gi|15927742|ref|NP_375275.1| phosphoglucosamine mutase [Staphylococcus aureus subsp. aureus
           N315]
 gi|21283817|ref|NP_646905.1| phosphoglucosamine mutase [Staphylococcus aureus subsp. aureus MW2]
 gi|49484383|ref|YP_041607.1| phosphoglucosamine mutase [Staphylococcus aureus subsp. aureus
           MRSA252]
 gi|49486951|ref|YP_044172.1| phosphoglucosamine mutase [Staphylococcus aureus subsp. aureus
           MSSA476]
 gi|148268607|ref|YP_001247550.1| phosphoglucosamine mutase [Staphylococcus aureus subsp. aureus JH9]
 gi|150394671|ref|YP_001317346.1| phosphoglucosamine mutase [Staphylococcus aureus subsp. aureus JH1]
 gi|156980476|ref|YP_001442735.1| phosphoglucosamine-mutase [Staphylococcus aureus subsp. aureus Mu3]
 gi|253315043|ref|ZP_04838256.1| phosphoglucosamine-mutase [Staphylococcus aureus subsp. aureus str.
           CF-Marseille]
 gi|253731002|ref|ZP_04865167.1| phosphoglucosamine-mutase [Staphylococcus aureus subsp. aureus
           USA300_TCH959]
 gi|253733007|ref|ZP_04867172.1| phosphoglucosamine-mutase [Staphylococcus aureus subsp. aureus
           TCH130]
 gi|255006945|ref|ZP_05145546.2| phosphoglucosamine-mutase [Staphylococcus aureus subsp. aureus
           Mu50-omega]
 gi|257426301|ref|ZP_05602716.1| phosphoglucosamine mutase [Staphylococcus aureus subsp. aureus
           55/2053]
 gi|257428958|ref|ZP_05605352.1| phosphoglucosamine mutase [Staphylococcus aureus subsp. aureus
           65-1322]
 gi|257431567|ref|ZP_05607940.1| phosphoglucosamine-mutase [Staphylococcus aureus subsp. aureus
           68-397]
 gi|257434275|ref|ZP_05610625.1| phosphoglucosamine-mutase [Staphylococcus aureus subsp. aureus
           E1410]
 gi|257437189|ref|ZP_05613229.1| phosphoglucosamine mutase [Staphylococcus aureus subsp. aureus
           M876]
 gi|257793452|ref|ZP_05642431.1| phosphoglucosamine mutase [Staphylococcus aureus A9781]
 gi|258407547|ref|ZP_05680684.1| phosphoglucosamine-mutase [Staphylococcus aureus A9763]
 gi|258420852|ref|ZP_05683787.1| phosphoglucosamine mutase [Staphylococcus aureus A9719]
 gi|258422843|ref|ZP_05685743.1| phosphoglucosamine mutase [Staphylococcus aureus A9635]
 gi|258438833|ref|ZP_05689970.1| phosphoglucosamine-mutase [Staphylococcus aureus A9299]
 gi|258442466|ref|ZP_05691142.1| phosphoglucosamine-mutase [Staphylococcus aureus A8115]
 gi|258445275|ref|ZP_05693467.1| phosphoglucosamine-mutase [Staphylococcus aureus A6300]
 gi|258448354|ref|ZP_05696473.1| phosphoglucosamine-mutase [Staphylococcus aureus A6224]
 gi|258453463|ref|ZP_05701445.1| phosphoglucosamine mutase [Staphylococcus aureus A5937]
 gi|269203795|ref|YP_003283064.1| phosphoglucosamine mutase GlmM [Staphylococcus aureus subsp. aureus
           ED98]
 gi|282894804|ref|ZP_06303030.1| phosphoglucosamine mutase [Staphylococcus aureus A8117]
 gi|282904830|ref|ZP_06312704.1| phosphoglucosamine mutase [Staphylococcus aureus subsp. aureus
           C160]
 gi|282906505|ref|ZP_06314356.1| phosphoglucosamine mutase [Staphylococcus aureus subsp. aureus
           Btn1260]
 gi|282909473|ref|ZP_06317288.1| phosphoglucosamine mutase [Staphylococcus aureus subsp. aureus
           WW2703/97]
 gi|282911725|ref|ZP_06319524.1| phosphoglucosamine mutase [Staphylococcus aureus subsp. aureus
           WBG10049]
 gi|282915010|ref|ZP_06322790.1| phosphoglucosamine mutase [Staphylococcus aureus subsp. aureus
           M899]
 gi|282917509|ref|ZP_06325262.1| phosphoglucosamine mutase [Staphylococcus aureus subsp. aureus
           D139]
 gi|282920340|ref|ZP_06328064.1| phosphoglucosamine mutase [Staphylococcus aureus subsp. aureus
           C427]
 gi|282925549|ref|ZP_06333203.1| phosphoglucosamine mutase [Staphylococcus aureus subsp. aureus
           C101]
 gi|282929192|ref|ZP_06336770.1| phosphoglucosamine mutase [Staphylococcus aureus A10102]
 gi|283958938|ref|ZP_06376383.1| phosphoglucosamine mutase [Staphylococcus aureus subsp. aureus
           A017934/97]
 gi|293509076|ref|ZP_06667863.1| phosphoglucosamine mutase [Staphylococcus aureus subsp. aureus
           58-424]
 gi|293510992|ref|ZP_06669691.1| phosphoglucosamine mutase [Staphylococcus aureus subsp. aureus
           M809]
 gi|293547596|ref|ZP_06672271.1| phosphoglucosamine mutase [Staphylococcus aureus subsp. aureus
           M1015]
 gi|295407093|ref|ZP_06816895.1| phosphoglucosamine mutase [Staphylococcus aureus A8819]
 gi|295428748|ref|ZP_06821374.1| phosphoglucosamine mutase [Staphylococcus aureus subsp. aureus
           EMRSA16]
 gi|296276733|ref|ZP_06859240.1| phosphoglucosamine mutase [Staphylococcus aureus subsp. aureus MR1]
 gi|297210019|ref|ZP_06926413.1| phosphoglucosamine mutase [Staphylococcus aureus subsp. aureus ATCC
           51811]
 gi|297246091|ref|ZP_06929948.1| phosphoglucosamine mutase [Staphylococcus aureus A8796]
 gi|297589771|ref|ZP_06948411.1| phosphoglucosamine mutase [Staphylococcus aureus subsp. aureus MN8]
 gi|300910382|ref|ZP_07127834.1| phosphoglucosamine mutase [Staphylococcus aureus subsp. aureus
           TCH70]
 gi|54037198|sp|P65705|GLMM_STAAW RecName: Full=Phosphoglucosamine mutase
 gi|54037199|sp|P99087|GLMM_STAAN RecName: Full=Phosphoglucosamine mutase
 gi|54041534|sp|P65704|GLMM_STAAM RecName: Full=Phosphoglucosamine mutase
 gi|81648870|sp|Q6G7F2|GLMM_STAAS RecName: Full=Phosphoglucosamine mutase
 gi|81650622|sp|Q6GER6|GLMM_STAAR RecName: Full=Phosphoglucosamine mutase
 gi|166990428|sp|A7X524|GLMM_STAA1 RecName: Full=Phosphoglucosamine mutase
 gi|189040798|sp|A6U3P1|GLMM_STAA2 RecName: Full=Phosphoglucosamine mutase
 gi|189040799|sp|A5IUV1|GLMM_STAA9 RecName: Full=Phosphoglucosamine mutase
 gi|13701962|dbj|BAB43254.1| phosphoglucosamine-mutase [Staphylococcus aureus subsp. aureus
           N315]
 gi|14247934|dbj|BAB58323.1| phosphoglucosamine-mutase [Staphylococcus aureus subsp. aureus
           Mu50]
 gi|21205259|dbj|BAB95953.1| phosphoglucosamine-mutase [Staphylococcus aureus subsp. aureus MW2]
 gi|49242512|emb|CAG41231.1| putative phosphoglucosamine mutase [Staphylococcus aureus subsp.
           aureus MRSA252]
 gi|49245394|emb|CAG43871.1| putative phosphoglucosamine mutase [Staphylococcus aureus subsp.
           aureus MSSA476]
 gi|147741676|gb|ABQ49974.1| phosphoglucosamine mutase [Staphylococcus aureus subsp. aureus JH9]
 gi|149947123|gb|ABR53059.1| phosphoglucosamine mutase [Staphylococcus aureus subsp. aureus JH1]
 gi|156722611|dbj|BAF79028.1| phosphoglucosamine-mutase [Staphylococcus aureus subsp. aureus Mu3]
 gi|253725241|gb|EES93970.1| phosphoglucosamine-mutase [Staphylococcus aureus subsp. aureus
           USA300_TCH959]
 gi|253728999|gb|EES97728.1| phosphoglucosamine-mutase [Staphylococcus aureus subsp. aureus
           TCH130]
 gi|257271006|gb|EEV03179.1| phosphoglucosamine mutase [Staphylococcus aureus subsp. aureus
           55/2053]
 gi|257274300|gb|EEV05817.1| phosphoglucosamine mutase [Staphylococcus aureus subsp. aureus
           65-1322]
 gi|257277808|gb|EEV08478.1| phosphoglucosamine-mutase [Staphylococcus aureus subsp. aureus
           68-397]
 gi|257280914|gb|EEV11059.1| phosphoglucosamine-mutase [Staphylococcus aureus subsp. aureus
           E1410]
 gi|257283582|gb|EEV13709.1| phosphoglucosamine mutase [Staphylococcus aureus subsp. aureus
           M876]
 gi|257787424|gb|EEV25764.1| phosphoglucosamine mutase [Staphylococcus aureus A9781]
 gi|257840876|gb|EEV65332.1| phosphoglucosamine-mutase [Staphylococcus aureus A9763]
 gi|257843179|gb|EEV67593.1| phosphoglucosamine mutase [Staphylococcus aureus A9719]
 gi|257846867|gb|EEV70881.1| phosphoglucosamine mutase [Staphylococcus aureus A9635]
 gi|257847985|gb|EEV71979.1| phosphoglucosamine-mutase [Staphylococcus aureus A9299]
 gi|257852038|gb|EEV75971.1| phosphoglucosamine-mutase [Staphylococcus aureus A8115]
 gi|257855936|gb|EEV78859.1| phosphoglucosamine-mutase [Staphylococcus aureus A6300]
 gi|257858399|gb|EEV81282.1| phosphoglucosamine-mutase [Staphylococcus aureus A6224]
 gi|257864444|gb|EEV87190.1| phosphoglucosamine mutase [Staphylococcus aureus A5937]
 gi|262076085|gb|ACY12058.1| phosphoglucosamine mutase GlmM [Staphylococcus aureus subsp. aureus
           ED98]
 gi|282312950|gb|EFB43351.1| phosphoglucosamine mutase [Staphylococcus aureus subsp. aureus
           C101]
 gi|282316200|gb|EFB46581.1| phosphoglucosamine mutase [Staphylococcus aureus subsp. aureus
           C427]
 gi|282318711|gb|EFB49068.1| phosphoglucosamine mutase [Staphylococcus aureus subsp. aureus
           D139]
 gi|282321213|gb|EFB51544.1| phosphoglucosamine mutase [Staphylococcus aureus subsp. aureus
           M899]
 gi|282324490|gb|EFB54803.1| phosphoglucosamine mutase [Staphylococcus aureus subsp. aureus
           WBG10049]
 gi|282326743|gb|EFB57041.1| phosphoglucosamine mutase [Staphylococcus aureus subsp. aureus
           WW2703/97]
 gi|282330455|gb|EFB59973.1| phosphoglucosamine mutase [Staphylococcus aureus subsp. aureus
           Btn1260]
 gi|282589223|gb|EFB94319.1| phosphoglucosamine mutase [Staphylococcus aureus A10102]
 gi|282594863|gb|EFB99840.1| phosphoglucosamine mutase [Staphylococcus aureus subsp. aureus
           C160]
 gi|282762892|gb|EFC03026.1| phosphoglucosamine mutase [Staphylococcus aureus A8117]
 gi|283471391|emb|CAQ50602.1| phosphoglucosamine mutase [Staphylococcus aureus subsp. aureus
           ST398]
 gi|283789656|gb|EFC28479.1| phosphoglucosamine mutase [Staphylococcus aureus subsp. aureus
           A017934/97]
 gi|285817824|gb|ADC38311.1| Phosphoglucosamine mutase / FemD, factor involved in methicillin
           resistance [Staphylococcus aureus 04-02981]
 gi|290919716|gb|EFD96789.1| phosphoglucosamine mutase [Staphylococcus aureus subsp. aureus
           M1015]
 gi|291094780|gb|EFE25052.1| phosphoglucosamine mutase [Staphylococcus aureus subsp. aureus
           58-424]
 gi|291466277|gb|EFF08804.1| phosphoglucosamine mutase [Staphylococcus aureus subsp. aureus
           M809]
 gi|294968118|gb|EFG44145.1| phosphoglucosamine mutase [Staphylococcus aureus A8819]
 gi|295127418|gb|EFG57058.1| phosphoglucosamine mutase [Staphylococcus aureus subsp. aureus
           EMRSA16]
 gi|296885323|gb|EFH24262.1| phosphoglucosamine mutase [Staphylococcus aureus subsp. aureus ATCC
           51811]
 gi|297177090|gb|EFH36345.1| phosphoglucosamine mutase [Staphylococcus aureus A8796]
 gi|297576899|gb|EFH95613.1| phosphoglucosamine mutase [Staphylococcus aureus subsp. aureus MN8]
 gi|300888224|gb|EFK83415.1| phosphoglucosamine mutase [Staphylococcus aureus subsp. aureus
           TCH70]
 gi|302333802|gb|ADL23995.1| putative phosphoglucosamine mutase [Staphylococcus aureus subsp.
           aureus JKD6159]
 gi|312437422|gb|ADQ76493.1| phosphoglucosamine mutase [Staphylococcus aureus subsp. aureus
           TCH60]
 gi|312830510|emb|CBX35352.1| phosphoglucosamine mutase [Staphylococcus aureus subsp. aureus
           ECT-R 2]
 gi|315128516|gb|EFT84522.1| phosphoglucosamine-mutase [Staphylococcus aureus subsp. aureus
           CGS03]
 gi|315193050|gb|EFU23452.1| phosphoglucosamine-mutase [Staphylococcus aureus subsp. aureus
           CGS00]
 gi|323442500|gb|EGB00129.1| phosphoglucosamine mutase [Staphylococcus aureus O46]
 gi|329726331|gb|EGG62799.1| phosphoglucosamine mutase [Staphylococcus aureus subsp. aureus
           21172]
 gi|329729323|gb|EGG65731.1| phosphoglucosamine mutase [Staphylococcus aureus subsp. aureus
           21193]
          Length = 451

 Score =  260 bits (664), Expect = 3e-67,   Method: Composition-based stats.
 Identities = 188/445 (42%), Positives = 275/445 (61%), Gaps = 7/445 (1%)

Query: 4   RFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKK--KHRRVVIGKDTRLSGYMLENS 61
           ++FGTDG+RG +N   +TP    ++G   GY+    K  KH RV++G+DTR+SG MLE++
Sbjct: 3   KYFGTDGVRGVANQ-ELTPELAFKLGRYGGYVLAHNKGEKHPRVLVGRDTRVSGEMLESA 61

Query: 62  LVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKV 121
           L+AG  + G +   LG I +P VA LTR + A++GVMISASHNP  DNGIK FG DG+K+
Sbjct: 62  LIAGLISIGAEVMRLGIISTPGVAYLTRDMGAELGVMISASHNPVADNGIKFFGSDGFKL 121

Query: 122 STDIEDRIETLLEDDLTSYLSCYDS-IGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           S + E+ IE LL+ +         + I H         +Y+ ++K T+   V  +GL+IV
Sbjct: 122 SDEQENEIEALLDQENPELPRPVGNDIVHYSDYFEGAQKYLSYLKSTVD--VNFEGLKIV 179

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           +D ANG++  +AP +F +L AD   IG  P+G NIN  CGST+   L  KV E  +D G+
Sbjct: 180 LDGANGSTSSLAPFLFGDLEADTETIGCSPDGYNINEKCGSTHPEKLAEKVVETESDFGL 239

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           A DGDGDR+I VDE G IV+GDQIM +I +E   +  L  + IV+TVMSN+G  + +   
Sbjct: 240 AFDGDGDRIIAVDENGQIVDGDQIMFIIGQEMHKNQELNNDMIVSTVMSNLGFYKALEQE 299

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           G+   +T+VGDRY++E M+   +N+GGEQSGHI++ DY +TGDGL+  +Q+   IK   K
Sbjct: 300 GIKSNKTKVGDRYVVEEMRRGNYNLGGEQSGHIVMMDYNTTGDGLLTGIQLASVIKMTGK 359

Query: 361 PVSTICHCFEEYPQFLRSVSVKDT-SILNSSSIVQAIADAESELRGIDRLIVRASGTESL 419
            +S +    ++YPQ L +V V D   +  +  + + +   E E+ G  R++VR SGTE L
Sbjct: 360 SLSELAGQMKKYPQSLINVRVTDKYRVEENVDVKEVMTKVEVEMNGEGRILVRPSGTEPL 419

Query: 420 IRIMAEGDDLSRIKRIVDDLAKVIP 444
           +R+M E       +R    +A V+ 
Sbjct: 420 VRVMVEAATDEDAERFAQQIADVVQ 444


>gi|154684699|ref|YP_001419860.1| YbbT [Bacillus amyloliquefaciens FZB42]
 gi|166990398|sp|A7Z0V3|GLMM_BACA2 RecName: Full=Phosphoglucosamine mutase
 gi|154350550|gb|ABS72629.1| YbbT [Bacillus amyloliquefaciens FZB42]
          Length = 448

 Score =  260 bits (664), Expect = 3e-67,   Method: Composition-based stats.
 Identities = 184/443 (41%), Positives = 276/443 (62%), Gaps = 5/443 (1%)

Query: 4   RFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSLV 63
           ++FGTDG+RG +N   +TP    ++G   GY+    K+  +V+IG+DTR+SG+MLE +LV
Sbjct: 3   KYFGTDGVRGVAN-SELTPELAFKVGRFGGYVLTKDKQRPKVLIGRDTRISGHMLEGALV 61

Query: 64  AGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVST 123
           AG  + G +   LG I +P V+ LT+++ A+ GVMISASHNP QDNGIK FG DG+K+S 
Sbjct: 62  AGLLSIGAEVMRLGVISTPGVSYLTKAMDAEAGVMISASHNPVQDNGIKFFGGDGFKLSD 121

Query: 124 DIEDRIETLLEDDLTSYLSCYD-SIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVVD 182
           + E  IE L+++            +G          +Y++ +K+T   D T  G+ + +D
Sbjct: 122 EQEAEIERLMDEPEDKLPRPTGADLGLVNDYFEGVQKYLQFLKQTADEDFT--GIHVALD 179

Query: 183 CANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIAL 242
           CA+GA+  +A  +F +L ADV  +G  PNG+NIN   GST+  +L   V E  ADIG+A 
Sbjct: 180 CAHGATSSIATHLFADLDADVSTMGTSPNGLNINDGVGSTHPEALSAFVKEKNADIGLAF 239

Query: 243 DGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLGL 302
           DGDGDR+I VDEKG IV+GDQIM + A+   S   L+ + +V+TVMSN+G  + +    +
Sbjct: 240 DGDGDRLIAVDEKGNIVDGDQIMYICAKYLKSEGRLKDDTVVSTVMSNLGFYKALEKEEI 299

Query: 303 SLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKPV 362
              +T VGDRY++E MK +G+NVGGEQSGH+I  DY +TGDGL++A+ ++  +K   K +
Sbjct: 300 KSVQTAVGDRYVVEAMKKDGYNVGGEQSGHLIFLDYNTTGDGLLSAIMLVNTLKASGKTL 359

Query: 363 STICHCFEEYPQFLRSVSVKDT-SILNSSSIVQAIADAESELRGIDRLIVRASGTESLIR 421
           S +    +++PQ L +V V D   +  ++ +   I++ E E+ G  R++VR SGTE L+R
Sbjct: 360 SELADEMKKFPQLLVNVKVTDKYKVEENAKVKAVISEVEKEMNGDGRILVRPSGTEPLVR 419

Query: 422 IMAEGDDLSRIKRIVDDLAKVIP 444
           +MAE          V  +  V+ 
Sbjct: 420 VMAEARTKELCDEYVTKIVDVVR 442


>gi|325130744|gb|EGC53481.1| phosphoglucosamine mutase [Neisseria meningitidis OX99.30304]
 gi|325136661|gb|EGC59261.1| phosphoglucosamine mutase [Neisseria meningitidis M0579]
          Length = 444

 Score =  260 bits (664), Expect = 3e-67,   Method: Composition-based stats.
 Identities = 197/445 (44%), Positives = 291/445 (65%), Gaps = 6/445 (1%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKK--KHRRVVIGKDTRLSGYML 58
           M +++FGTDG+RG+   FPITP+F++++G A G +       +   V+IGKDTR+SGYML
Sbjct: 1   MAKKYFGTDGVRGEVGQFPITPDFVLKLGYAAGQVLVQHDTDQKPTVLIGKDTRISGYML 60

Query: 59  ENSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDG 118
           E +LVAGFTAAG++    GP+P+P VA LTR+LR   GVMISASHN Y DNGIK F   G
Sbjct: 61  EAALVAGFTAAGVNVVQTGPLPTPGVAYLTRALRLSAGVMISASHNAYSDNGIKFFAEGG 120

Query: 119 YKVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLR 178
            K+S ++E  IE  ++ ++ +       +G A+R++G  DRYIE  K T P    L+GL+
Sbjct: 121 VKLSDEVELEIEAKIDGEMKTQP--SARLGRARRINGADDRYIEFCKSTFPTHSDLRGLK 178

Query: 179 IVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADI 238
           +VVD ANGA+Y VAP+VF ELGA VV IGD+PNG NIN  CG+T   +LQ  V +  AD 
Sbjct: 179 LVVDAANGAAYSVAPKVFHELGAQVVSIGDEPNGYNINEKCGATYTKTLQAAVLQHEADY 238

Query: 239 GIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIA 298
           GIALDGDGDR+++VD+ G + +GD ++ +IA+   +   +   G+V TVM+N+ +E  + 
Sbjct: 239 GIALDGDGDRLMMVDKNGKVYDGDSLIYVIAK-ARAREGINIGGVVGTVMTNMAMEIALK 297

Query: 299 GLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQY 358
             G+   R +VGDRY++E +   G+ +GGE SGHI+  D  +TGDG+++ALQVL  ++  
Sbjct: 298 EQGVDFCRAKVGDRYVLEQLNQRGWLIGGEASGHILCMDKHNTGDGIISALQVLAALQIL 357

Query: 359 DKPVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTES 418
           ++ ++T+C  ++ YPQ + +V +        +S    +A+ E EL G  R+++RASGTE 
Sbjct: 358 NQDLATVCADWQPYPQTMINVRIGKGQNWQEAS-KDVLAEVEKELEGKGRVVLRASGTEP 416

Query: 419 LIRIMAEGDDLSRIKRIVDDLAKVI 443
           ++R+M E       +   + +A  I
Sbjct: 417 VVRVMVEARQADWAREGAERIAAAI 441


>gi|57652179|ref|YP_186964.1| phosphoglucosamine mutase GlmM [Staphylococcus aureus subsp. aureus
           COL]
 gi|87160822|ref|YP_494757.1| phosphoglucosamine mutase [Staphylococcus aureus subsp. aureus
           USA300_FPR3757]
 gi|88196066|ref|YP_500881.1| phosphoglucosamine mutase [Staphylococcus aureus subsp. aureus NCTC
           8325]
 gi|151222274|ref|YP_001333096.1| phosphoglucosamine-mutase [Staphylococcus aureus subsp. aureus str.
           Newman]
 gi|161510366|ref|YP_001576025.1| phosphoglucosamine mutase [Staphylococcus aureus subsp. aureus
           USA300_TCH1516]
 gi|221141053|ref|ZP_03565546.1| phosphoglucosamine mutase [Staphylococcus aureus subsp. aureus str.
           JKD6009]
 gi|258452435|ref|ZP_05700444.1| phosphoglucosamine mutase [Staphylococcus aureus A5948]
 gi|262050091|ref|ZP_06022947.1| phosphoglucosamine-mutase [Staphylococcus aureus D30]
 gi|262052594|ref|ZP_06024789.1| phosphoglucosamine-mutase [Staphylococcus aureus 930918-3]
 gi|282925618|ref|ZP_06333269.1| phosphoglucosamine mutase [Staphylococcus aureus A9765]
 gi|284025192|ref|ZP_06379590.1| phosphoglucosamine mutase [Staphylococcus aureus subsp. aureus 132]
 gi|294850128|ref|ZP_06790865.1| phosphoglucosamine mutase [Staphylococcus aureus A9754]
 gi|304379344|ref|ZP_07362081.1| phosphoglucosamine mutase [Staphylococcus aureus subsp. aureus ATCC
           BAA-39]
 gi|81694025|sp|Q5HE43|GLMM_STAAC RecName: Full=Phosphoglucosamine mutase
 gi|84029255|sp|P0C0V7|GLMM_STAA8 RecName: Full=Phosphoglucosamine mutase
 gi|123484885|sp|Q2FEX1|GLMM_STAA3 RecName: Full=Phosphoglucosamine mutase
 gi|172048995|sp|A6QJ02|GLMM_STAAE RecName: Full=Phosphoglucosamine mutase
 gi|189040800|sp|A8YYC6|GLMM_STAAT RecName: Full=Phosphoglucosamine mutase
 gi|1684749|emb|CAA70762.1| femD [Staphylococcus aureus]
 gi|3892895|emb|CAA75651.1| phosphoglucosamine-mutase [Staphylococcus aureus]
 gi|5834648|emb|CAA71060.2| phosphoglucosamine mutase, GlmM [Staphylococcus aureus subsp.
           aureus COL]
 gi|57286365|gb|AAW38459.1| phosphoglucosamine mutase GlmM [Staphylococcus aureus subsp. aureus
           COL]
 gi|87126796|gb|ABD21310.1| phosphoglucosamine mutase [Staphylococcus aureus subsp. aureus
           USA300_FPR3757]
 gi|87203624|gb|ABD31434.1| phosphoglucosamine mutase [Staphylococcus aureus subsp. aureus NCTC
           8325]
 gi|150375074|dbj|BAF68334.1| phosphoglucosamine-mutase [Staphylococcus aureus subsp. aureus str.
           Newman]
 gi|160369175|gb|ABX30146.1| phosphoglucosamine mutase [Staphylococcus aureus subsp. aureus
           USA300_TCH1516]
 gi|257859910|gb|EEV82749.1| phosphoglucosamine mutase [Staphylococcus aureus A5948]
 gi|259159520|gb|EEW44569.1| phosphoglucosamine-mutase [Staphylococcus aureus 930918-3]
 gi|259161824|gb|EEW46410.1| phosphoglucosamine-mutase [Staphylococcus aureus D30]
 gi|269941756|emb|CBI50164.1| putative phosphoglucosamine mutase [Staphylococcus aureus subsp.
           aureus TW20]
 gi|282592453|gb|EFB97466.1| phosphoglucosamine mutase [Staphylococcus aureus A9765]
 gi|294823076|gb|EFG39508.1| phosphoglucosamine mutase [Staphylococcus aureus A9754]
 gi|302752037|gb|ADL66214.1| putative phosphoglucosamine mutase [Staphylococcus aureus subsp.
           aureus str. JKD6008]
 gi|304342074|gb|EFM07976.1| phosphoglucosamine mutase [Staphylococcus aureus subsp. aureus ATCC
           BAA-39]
 gi|315196090|gb|EFU26448.1| phosphoglucosamine mutase [Staphylococcus aureus subsp. aureus
           CGS01]
 gi|320141699|gb|EFW33533.1| phosphoglucosamine mutase [Staphylococcus aureus subsp. aureus
           MRSA131]
 gi|320143587|gb|EFW35366.1| phosphoglucosamine mutase [Staphylococcus aureus subsp. aureus
           MRSA177]
 gi|329314844|gb|AEB89257.1| Phosphoglucosamine mutase [Staphylococcus aureus subsp. aureus
           T0131]
 gi|329724005|gb|EGG60529.1| phosphoglucosamine mutase [Staphylococcus aureus subsp. aureus
           21189]
          Length = 451

 Score =  260 bits (664), Expect = 3e-67,   Method: Composition-based stats.
 Identities = 187/445 (42%), Positives = 274/445 (61%), Gaps = 7/445 (1%)

Query: 4   RFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKK--KHRRVVIGKDTRLSGYMLENS 61
           ++FGTDG+RG +N   +TP    ++G   GY+    K  KH RV++G+DTR+SG MLE++
Sbjct: 3   KYFGTDGVRGVANQ-ELTPELAFKLGRYGGYVLAHNKGEKHPRVLVGRDTRVSGEMLESA 61

Query: 62  LVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKV 121
           L+AG  + G +   LG I +P VA LTR + A++GVMISASHNP  DNGIK FG DG+K+
Sbjct: 62  LIAGLISIGAEVMRLGIISTPGVAYLTRDMGAELGVMISASHNPVADNGIKFFGSDGFKL 121

Query: 122 STDIEDRIETLLEDDLTSYLSCYDS-IGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           S + E+ IE LL+ +         + I H         +Y+ ++K T+   V  +GL+I 
Sbjct: 122 SDEQENEIEALLDQENPELPRPVGNDIVHYSDYFEGAQKYLSYLKSTVD--VNFEGLKIA 179

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           +D ANG++  +AP +F +L AD   IG  P+G NIN  CGST+   L  KV E  +D G+
Sbjct: 180 LDGANGSTSSLAPFLFGDLEADTETIGCSPDGYNINEKCGSTHPEKLAEKVVETESDFGL 239

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           A DGDGDR+I VDE G IV+GDQIM +I +E   +  L  + IV+TVMSN+G  + +   
Sbjct: 240 AFDGDGDRIIAVDENGQIVDGDQIMFIIGQEMHKNQELNNDMIVSTVMSNLGFYKALEQE 299

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           G+   +T+VGDRY++E M+   +N+GGEQSGHI++ DY +TGDGL+  +Q+   IK   K
Sbjct: 300 GIKSNKTKVGDRYVVEEMRRGNYNLGGEQSGHIVMMDYNTTGDGLLTGIQLASVIKMTGK 359

Query: 361 PVSTICHCFEEYPQFLRSVSVKDT-SILNSSSIVQAIADAESELRGIDRLIVRASGTESL 419
            +S +    ++YPQ L +V V D   +  +  + + +   E E+ G  R++VR SGTE L
Sbjct: 360 SLSELAGQMKKYPQSLINVRVTDKYRVEENVDVKEVMTKVEVEMNGEGRILVRPSGTEPL 419

Query: 420 IRIMAEGDDLSRIKRIVDDLAKVIP 444
           +R+M E       +R    +A V+ 
Sbjct: 420 VRVMVEAATDEDAERFAQQIADVVQ 444


>gi|301631405|ref|XP_002944788.1| PREDICTED: phosphoglucosamine mutase-like [Xenopus (Silurana)
           tropicalis]
          Length = 444

 Score =  260 bits (664), Expect = 3e-67,   Method: Composition-based stats.
 Identities = 193/443 (43%), Positives = 288/443 (65%), Gaps = 4/443 (0%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M R++FGTDGIRG     PITP+F++R+  AVG + R  ++    +IGKDTR+SGYMLE 
Sbjct: 1   MTRKYFGTDGIRGTVGQPPITPDFVLRLAHAVGRVLRRSEERPTALIGKDTRISGYMLEA 60

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +L +GF +AG+D  +LGP+P+P VA LTR+ RA +GV+ISASHNPY DNGIK F   G K
Sbjct: 61  ALESGFNSAGVDVVLLGPLPTPGVAYLTRAQRASLGVVISASHNPYADNGIKFFSASGAK 120

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +  D E  +E  +++      +    +G A+R+D    RYIE  K T   D+TL+G+RIV
Sbjct: 121 LPDDWELAVEAAMDE--PPTWADSAGLGKARRLDDAAGRYIEFCKSTFANDLTLKGVRIV 178

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           VD A+GA+Y++AP+VF ELGADVV IG  P+G+NIN + G+T+  +L R V    AD GI
Sbjct: 179 VDAAHGAAYQIAPKVFHELGADVVPIGCAPDGLNINHEVGATHPDALVRAVRANHADFGI 238

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           ALDGD DR+ + D  G + NGD+++ L+ARE M+   L    +  T M+N+ +E  +   
Sbjct: 239 ALDGDADRLQMADGSGRLFNGDELLYLLARERMARDELVPGVVG-TQMTNMAVELALRAQ 297

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           G+ L R +VGDR+++E + ++G+ +GGE SGH++  D  +TGDGLV+ALQVL+   +  +
Sbjct: 298 GVKLVRAKVGDRHVLEALSHHGWLLGGEGSGHLLALDKHTTGDGLVSALQVLQACVRSGQ 357

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQA-IADAESELRGIDRLIVRASGTESL 419
            ++ +    E +PQ L +V +      ++++++    A  E+EL G  R+++RASGTE L
Sbjct: 358 GMAELLAGVELFPQVLLNVRLPPGQDWHANTLLARETAAVEAELNGSGRVLIRASGTEPL 417

Query: 420 IRIMAEGDDLSRIKRIVDDLAKV 442
           +R+M E  + ++       LA  
Sbjct: 418 LRVMVEARNQAQASACAQRLADA 440


>gi|332971578|gb|EGK10528.1| phosphoglucosamine mutase [Kingella kingae ATCC 23330]
          Length = 443

 Score =  260 bits (664), Expect = 3e-67,   Method: Composition-based stats.
 Identities = 200/448 (44%), Positives = 295/448 (65%), Gaps = 7/448 (1%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGY--LFRGKKKHRRVVIGKDTRLSGYML 58
           M R++FGTDGIRG+   FPITP+F+M++G A G   + + ++    V+IGKDTR+SGYML
Sbjct: 1   MARKYFGTDGIRGEVGQFPITPDFVMKLGCAFGRALVRKEQEHRPTVIIGKDTRISGYML 60

Query: 59  ENSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDG 118
           E +LVAGFTAAG++    GP+P+P +A LTR+LR D GVMISASHN + DNGIK F   G
Sbjct: 61  ETALVAGFTAAGVNVVQTGPLPTPGIAYLTRALRLDGGVMISASHNEFSDNGIKFFAEGG 120

Query: 119 YKVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLR 178
            K+S ++E  IE  L+ ++ +  S    +G A+R+ G  DRYIE  K T P  + L+GLR
Sbjct: 121 VKLSDEMELAIEAELDKEMHTLPSI--ELGRARRISGADDRYIEFCKSTFPNTMNLRGLR 178

Query: 179 IVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADI 238
           +VVD ANGA Y  AP+VF ELGA+V+ IG +PNG NIN   G+T   +LQ  V +  A+ 
Sbjct: 179 LVVDMANGAGYHTAPKVFHELGAEVISIGAEPNGYNINDKIGATYPKTLQAAVLQHDANY 238

Query: 239 GIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIA 298
           GIALDGDGDR+++VD+ G + +GD+++ +IA+   +   L   G+V TVMSN+ +E+ + 
Sbjct: 239 GIALDGDGDRLMMVDKNGVVYDGDKLIYVIAK-ARAQQGLPFGGVVGTVMSNLAMEKALN 297

Query: 299 GLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQY 358
             G+   R +VGDRY++E +K   + +GGE SGHI+  D  +TGDG ++ALQVL  +K  
Sbjct: 298 ARGIEFARAKVGDRYVLEQLKQRDWLIGGEASGHILCMDKHNTGDGTISALQVLAALKVL 357

Query: 359 DKPVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTES 418
           ++ +++    ++ YPQ + +V +       S+S   A+A+ E+EL    R+++RASGTE 
Sbjct: 358 EQDLASAID-WQPYPQTMINVRIPKDQDWESAS-QAALAEVEAELGERGRVVLRASGTEP 415

Query: 419 LIRIMAEGDDLSRIKRIVDDLAKVIPMI 446
           ++R+M E D     ++    +A  I  +
Sbjct: 416 VVRVMVEADSAPLAEQGAKRIADAIAAV 443


>gi|260102526|ref|ZP_05752763.1| phosphoglucosamine mutase [Lactobacillus helveticus DSM 20075]
 gi|260083668|gb|EEW67788.1| phosphoglucosamine mutase [Lactobacillus helveticus DSM 20075]
 gi|328461811|gb|EGF34041.1| phosphoglucosamine mutase [Lactobacillus helveticus MTCC 5463]
          Length = 450

 Score =  260 bits (664), Expect = 3e-67,   Method: Composition-based stats.
 Identities = 179/447 (40%), Positives = 273/447 (61%), Gaps = 8/447 (1%)

Query: 4   RFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHR---RVVIGKDTRLSGYMLEN 60
           ++FGTDG+RG +N   +TP    ++G   GY+    KK     +V++ +DTR+SG MLE 
Sbjct: 3   KYFGTDGVRGVANQG-LTPEMAFKLGRDGGYVLTKNKKDGEQAKVLVSRDTRISGQMLEY 61

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +L++G  + G++   +G I +P ++ L R+  AD GV ISASHNP +DNGIK FG DG K
Sbjct: 62  ALISGLLSVGIEVLEVGVITTPGLSYLVRAQGADAGVQISASHNPVEDNGIKFFGSDGLK 121

Query: 121 VSTDIEDRIETLLEDDLTS-YLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRI 179
           +S ++E+ IE L++    +      + +G          +Y++ ++ T+P    L G+++
Sbjct: 122 LSDEMEEEIEKLIDAKEDNLPRPSAEGLGTVTDFHEGSAKYLQFIENTIPE--DLDGIKV 179

Query: 180 VVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIG 239
           V+D ANGAS  +   +F + G D   I   PNG+NIN  CG+T+  +LQ++V +  A +G
Sbjct: 180 VIDGANGASSALISRLFADCGVDFTTIYTHPNGLNINDHCGATHTENLQKEVVKQGAQLG 239

Query: 240 IALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAG 299
           +A DGD DR I VDE G  V+GD IM +I      H  L+ + IVTTVMSN+G  + +  
Sbjct: 240 LAFDGDADRCIAVDENGNEVDGDHIMYVIGSYLAEHGRLKKDTIVTTVMSNLGFTKALEK 299

Query: 300 LGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYD 359
            GL   RT+VGDRY+ E M+ +G+N+GGEQSGH+I+SDY +TGDG++  L ++  +K+  
Sbjct: 300 EGLKNVRTQVGDRYVSEEMRAHGYNLGGEQSGHVIMSDYHNTGDGMLTGLHLMLVMKKTG 359

Query: 360 KPVSTICHCFEEYPQFLRSVSVKDTS-ILNSSSIVQAIADAESELRGIDRLIVRASGTES 418
           K +S +   F++YPQ L +V VKD         I+  IA+ E ++ G  R++VR SGT+ 
Sbjct: 360 KSLSELLKDFKDYPQCLVNVPVKDKKSWKEHQPILDVIAEVEKDMNGNGRVLVRPSGTQD 419

Query: 419 LIRIMAEGDDLSRIKRIVDDLAKVIPM 445
           L+R+MAEG         VD + KV+  
Sbjct: 420 LLRVMAEGPTQEETDAYVDRIVKVVEK 446


>gi|227520211|ref|ZP_03950260.1| phosphoglucosamine mutase [Enterococcus faecalis TX0104]
 gi|227555354|ref|ZP_03985401.1| phosphoglucosamine mutase [Enterococcus faecalis HH22]
 gi|229545324|ref|ZP_04434049.1| phosphoglucosamine mutase [Enterococcus faecalis TX1322]
 gi|229549568|ref|ZP_04438293.1| phosphoglucosamine mutase [Enterococcus faecalis ATCC 29200]
 gi|255972266|ref|ZP_05422852.1| phosphoglucosamine mutase [Enterococcus faecalis T1]
 gi|256619567|ref|ZP_05476413.1| phosphoglucosamine mutase [Enterococcus faecalis ATCC 4200]
 gi|256762962|ref|ZP_05503542.1| phosphoglucosamine mutase [Enterococcus faecalis T3]
 gi|256853607|ref|ZP_05558972.1| phosphoglucosamine mutase [Enterococcus faecalis T8]
 gi|256956543|ref|ZP_05560714.1| phosphoglucosamine mutase [Enterococcus faecalis DS5]
 gi|256963435|ref|ZP_05567606.1| phosphoglucosamine mutase [Enterococcus faecalis HIP11704]
 gi|257079468|ref|ZP_05573829.1| phosphoglucosamine mutase [Enterococcus faecalis JH1]
 gi|257082149|ref|ZP_05576510.1| phosphoglucosamine mutase [Enterococcus faecalis E1Sol]
 gi|257084765|ref|ZP_05579126.1| phosphoglucosamine mutase [Enterococcus faecalis Fly1]
 gi|257087292|ref|ZP_05581653.1| phosphoglucosamine mutase [Enterococcus faecalis D6]
 gi|257090424|ref|ZP_05584785.1| phosphoglucosamine mutase [Enterococcus faecalis CH188]
 gi|257416471|ref|ZP_05593465.1| phosphoglucosamine mutase [Enterococcus faecalis AR01/DG]
 gi|257419713|ref|ZP_05596707.1| phosphoglucosamine mutase [Enterococcus faecalis T11]
 gi|257422128|ref|ZP_05599118.1| phosphoglucosamine mutase [Enterococcus faecalis X98]
 gi|293385165|ref|ZP_06630985.1| phosphoglucosamine mutase [Enterococcus faecalis R712]
 gi|293388203|ref|ZP_06632725.1| phosphoglucosamine mutase [Enterococcus faecalis S613]
 gi|294780370|ref|ZP_06745739.1| phosphoglucosamine mutase [Enterococcus faecalis PC1.1]
 gi|300860258|ref|ZP_07106345.1| phosphoglucosamine mutase [Enterococcus faecalis TUSoD Ef11]
 gi|307270218|ref|ZP_07551531.1| phosphoglucosamine mutase [Enterococcus faecalis TX4248]
 gi|307272715|ref|ZP_07553962.1| phosphoglucosamine mutase [Enterococcus faecalis TX0855]
 gi|307276087|ref|ZP_07557220.1| phosphoglucosamine mutase [Enterococcus faecalis TX2134]
 gi|307287348|ref|ZP_07567409.1| phosphoglucosamine mutase [Enterococcus faecalis TX0109]
 gi|307295632|ref|ZP_07575467.1| phosphoglucosamine mutase [Enterococcus faecalis TX0411]
 gi|312900820|ref|ZP_07760114.1| phosphoglucosamine mutase [Enterococcus faecalis TX0470]
 gi|312902868|ref|ZP_07762072.1| phosphoglucosamine mutase [Enterococcus faecalis TX0635]
 gi|312908252|ref|ZP_07767216.1| phosphoglucosamine mutase [Enterococcus faecalis DAPTO 512]
 gi|312910677|ref|ZP_07769518.1| phosphoglucosamine mutase [Enterococcus faecalis DAPTO 516]
 gi|312951170|ref|ZP_07770073.1| phosphoglucosamine mutase [Enterococcus faecalis TX0102]
 gi|227072290|gb|EEI10253.1| phosphoglucosamine mutase [Enterococcus faecalis TX0104]
 gi|227175565|gb|EEI56537.1| phosphoglucosamine mutase [Enterococcus faecalis HH22]
 gi|229305233|gb|EEN71229.1| phosphoglucosamine mutase [Enterococcus faecalis ATCC 29200]
 gi|229309531|gb|EEN75518.1| phosphoglucosamine mutase [Enterococcus faecalis TX1322]
 gi|255963284|gb|EET95760.1| phosphoglucosamine mutase [Enterococcus faecalis T1]
 gi|256599094|gb|EEU18270.1| phosphoglucosamine mutase [Enterococcus faecalis ATCC 4200]
 gi|256684213|gb|EEU23908.1| phosphoglucosamine mutase [Enterococcus faecalis T3]
 gi|256710550|gb|EEU25593.1| phosphoglucosamine mutase [Enterococcus faecalis T8]
 gi|256947039|gb|EEU63671.1| phosphoglucosamine mutase [Enterococcus faecalis DS5]
 gi|256953931|gb|EEU70563.1| phosphoglucosamine mutase [Enterococcus faecalis HIP11704]
 gi|256987498|gb|EEU74800.1| phosphoglucosamine mutase [Enterococcus faecalis JH1]
 gi|256990179|gb|EEU77481.1| phosphoglucosamine mutase [Enterococcus faecalis E1Sol]
 gi|256992795|gb|EEU80097.1| phosphoglucosamine mutase [Enterococcus faecalis Fly1]
 gi|256995322|gb|EEU82624.1| phosphoglucosamine mutase [Enterococcus faecalis D6]
 gi|256999236|gb|EEU85756.1| phosphoglucosamine mutase [Enterococcus faecalis CH188]
 gi|257158299|gb|EEU88259.1| phosphoglucosamine mutase [Enterococcus faecalis ARO1/DG]
 gi|257161541|gb|EEU91501.1| phosphoglucosamine mutase [Enterococcus faecalis T11]
 gi|257163952|gb|EEU93912.1| phosphoglucosamine mutase [Enterococcus faecalis X98]
 gi|291077538|gb|EFE14902.1| phosphoglucosamine mutase [Enterococcus faecalis R712]
 gi|291082443|gb|EFE19406.1| phosphoglucosamine mutase [Enterococcus faecalis S613]
 gi|294452634|gb|EFG21067.1| phosphoglucosamine mutase [Enterococcus faecalis PC1.1]
 gi|300849297|gb|EFK77047.1| phosphoglucosamine mutase [Enterococcus faecalis TUSoD Ef11]
 gi|306496344|gb|EFM65921.1| phosphoglucosamine mutase [Enterococcus faecalis TX0411]
 gi|306501589|gb|EFM70884.1| phosphoglucosamine mutase [Enterococcus faecalis TX0109]
 gi|306507417|gb|EFM76554.1| phosphoglucosamine mutase [Enterococcus faecalis TX2134]
 gi|306510329|gb|EFM79352.1| phosphoglucosamine mutase [Enterococcus faecalis TX0855]
 gi|306513434|gb|EFM82053.1| phosphoglucosamine mutase [Enterococcus faecalis TX4248]
 gi|310625666|gb|EFQ08949.1| phosphoglucosamine mutase [Enterococcus faecalis DAPTO 512]
 gi|310630835|gb|EFQ14118.1| phosphoglucosamine mutase [Enterococcus faecalis TX0102]
 gi|310633922|gb|EFQ17205.1| phosphoglucosamine mutase [Enterococcus faecalis TX0635]
 gi|311289053|gb|EFQ67609.1| phosphoglucosamine mutase [Enterococcus faecalis DAPTO 516]
 gi|311291919|gb|EFQ70475.1| phosphoglucosamine mutase [Enterococcus faecalis TX0470]
 gi|315025841|gb|EFT37773.1| phosphoglucosamine mutase [Enterococcus faecalis TX2137]
 gi|315028612|gb|EFT40544.1| phosphoglucosamine mutase [Enterococcus faecalis TX4000]
 gi|315031085|gb|EFT43017.1| phosphoglucosamine mutase [Enterococcus faecalis TX0017]
 gi|315034721|gb|EFT46653.1| phosphoglucosamine mutase [Enterococcus faecalis TX0027]
 gi|315143363|gb|EFT87379.1| phosphoglucosamine mutase [Enterococcus faecalis TX2141]
 gi|315149283|gb|EFT93299.1| phosphoglucosamine mutase [Enterococcus faecalis TX0012]
 gi|315152656|gb|EFT96672.1| phosphoglucosamine mutase [Enterococcus faecalis TX0031]
 gi|315157163|gb|EFU01180.1| phosphoglucosamine mutase [Enterococcus faecalis TX0043]
 gi|315159496|gb|EFU03513.1| phosphoglucosamine mutase [Enterococcus faecalis TX0312]
 gi|315164705|gb|EFU08722.1| phosphoglucosamine mutase [Enterococcus faecalis TX1302]
 gi|315171596|gb|EFU15613.1| phosphoglucosamine mutase [Enterococcus faecalis TX1342]
 gi|315173793|gb|EFU17810.1| phosphoglucosamine mutase [Enterococcus faecalis TX1346]
 gi|315575145|gb|EFU87336.1| phosphoglucosamine mutase [Enterococcus faecalis TX0309B]
 gi|315577166|gb|EFU89357.1| phosphoglucosamine mutase [Enterococcus faecalis TX0630]
 gi|315582572|gb|EFU94763.1| phosphoglucosamine mutase [Enterococcus faecalis TX0309A]
 gi|327535549|gb|AEA94383.1| phosphoglucosamine mutase [Enterococcus faecalis OG1RF]
          Length = 451

 Score =  260 bits (664), Expect = 3e-67,   Method: Composition-based stats.
 Identities = 182/447 (40%), Positives = 270/447 (60%), Gaps = 8/447 (1%)

Query: 4   RFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGK---KKHRRVVIGKDTRLSGYMLEN 60
           ++FGTDG+RG +N   +TP    ++G   GY+        +  RV++G+DTR+SG MLE 
Sbjct: 3   KYFGTDGVRGIANK-ELTPELAFKLGRYGGYVLSQHEDSSRKPRVLVGRDTRISGEMLEQ 61

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +L+AG  + G++ F LG I +P VA LTR  +A  GVMISASHNP +DNGIK FG DG+K
Sbjct: 62  ALIAGLLSVGIEVFQLGVISTPGVAYLTRLQKASAGVMISASHNPAEDNGIKFFGADGFK 121

Query: 121 VSTDIEDRIETLLE-DDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRI 179
           +  D E  IE LL+ ++ T      + +G          +Y + + +++P    L  + +
Sbjct: 122 LVDDQEAEIEALLDAEEDTLPRPSAEGLGSLDEFPEGLLKYSQFLVQSIPG--DLADMTV 179

Query: 180 VVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIG 239
            +D ANGA+      VF +L  D   +G  PNG+NIN   GST+  +L   V E  AD G
Sbjct: 180 CLDAANGATATAVNRVFADLETDFYTMGTSPNGLNINDGVGSTHPEALAEMVVEKGADAG 239

Query: 240 IALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAG 299
           +A DGDGDR+I VDE G I++GD+IM + A+       L+ + IVTTVMSN+G  + +  
Sbjct: 240 LAFDGDGDRIIAVDELGRIIDGDKIMYICAKYLAEKKRLKKDTIVTTVMSNLGFHKAVEE 299

Query: 300 LGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYD 359
           +GL    T+VGDRY++E M+ N +N GGEQSGH+I  DY +TGDG+++ +Q+L  +KQ  
Sbjct: 300 IGLKDVVTQVGDRYVVEEMRKNDYNFGGEQSGHMIFLDYNTTGDGMLSGIQLLNVMKQTG 359

Query: 360 KPVSTICHCFEEYPQFLRSVSVKDTS-ILNSSSIVQAIADAESELRGIDRLIVRASGTES 418
           K +S +      YPQ L ++ V D +  +   +I   +  AE+E+ G  R++VR SGTE 
Sbjct: 360 KKLSELADEVTIYPQKLVNIRVTDKNGAMEVPAIKAVVEQAEAEMNGEGRILVRPSGTEP 419

Query: 419 LIRIMAEGDDLSRIKRIVDDLAKVIPM 445
           L+R+MAE     ++   VD +A+V+  
Sbjct: 420 LLRVMAEAPTQEKVDYYVDKIAEVVRA 446


>gi|167587470|ref|ZP_02379858.1| Phosphoglucosamine mutase [Burkholderia ubonensis Bu]
          Length = 451

 Score =  260 bits (664), Expect = 3e-67,   Method: Composition-based stats.
 Identities = 194/454 (42%), Positives = 280/454 (61%), Gaps = 9/454 (1%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGK-----KKHRRVVIGKDTRLSG 55
           M RR+FGTDGIRG     PITP+F++R+G A G +  G           V+IGKDTR+SG
Sbjct: 1   MGRRYFGTDGIRGTVGEAPITPDFVLRLGYAAGKVLAGSADVAAGARPTVLIGKDTRVSG 60

Query: 56  YMLENSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFG 115
           YMLE +L AGF+AAG+D  + GP+P+P VA LTR+LR   GV+ISASHNPY DNGIK F 
Sbjct: 61  YMLEAALEAGFSAAGVDVMLAGPMPTPGVAYLTRALRLSAGVVISASHNPYHDNGIKFFS 120

Query: 116 PDGYKVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQ 175
            DG K+  + E  IE  L   L       D +G A+R+D    RYIE  K T P    L+
Sbjct: 121 ADGNKLPDETEAAIEAWLGKPLECAP--SDGLGKARRLDDAAGRYIEFCKSTFPAAFDLR 178

Query: 176 GLRIVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVR 235
           G+++VVDCA+GA+Y+VAP VF ELGADV+ IG  PNG NIN   G+T   +L R V    
Sbjct: 179 GMKLVVDCAHGAAYQVAPHVFHELGADVIPIGVAPNGFNINDGVGATAPDALVRAVRANH 238

Query: 236 ADIGIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLER 295
           AD+GIALDGD DR+ +VD  G + NGD+++ ++ ++ ++ +      + T  M+N+ +E 
Sbjct: 239 ADLGIALDGDADRLQVVDSTGRLFNGDELLYVLVKDRIATNGQVEGAVGTL-MTNLAVEV 297

Query: 296 FIAGLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYI 355
            +   G+   R  VGDRY++E ++ +G+ +G E SGHI+  D  +TGDG+V+AL VL  +
Sbjct: 298 ALQREGVQFVRAAVGDRYVLERLREHGWQLGAEGSGHILSLDRHTTGDGIVSALLVLAAL 357

Query: 356 KQYDKPVSTICHCFEEYPQFLRSVSVKDTSILNSSS-IVQAIADAESELRGIDRLIVRAS 414
           K+  + ++ +      +PQ L +V +K  +    ++ I  AI  AE  L G  R+++RAS
Sbjct: 358 KRSGRTLAQMLDGVTLFPQKLINVRMKPGADWKGNASIRAAIDGAEQALAGSGRVLIRAS 417

Query: 415 GTESLIRIMAEGDDLSRIKRIVDDLAKVIPMIDS 448
           GTE ++R+M E +  +   R  + +A  +    +
Sbjct: 418 GTEPVLRVMVEAEQAADASRHAEAIADAVRAATA 451


>gi|312898262|ref|ZP_07757653.1| phosphoglucosamine mutase [Megasphaera micronuciformis F0359]
 gi|310620759|gb|EFQ04328.1| phosphoglucosamine mutase [Megasphaera micronuciformis F0359]
          Length = 452

 Score =  260 bits (664), Expect = 3e-67,   Method: Composition-based stats.
 Identities = 195/448 (43%), Positives = 279/448 (62%), Gaps = 8/448 (1%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M R  FGTDG+RG +N   +TP     +G A  ++    K+H   +IG+DTRLSG ML +
Sbjct: 1   MAR-LFGTDGVRGVANA-SLTPELAYHLGRAAAFILGKDKEHPTFLIGRDTRLSGTMLAD 58

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
            L AG  +AG + F+   IP+PA+A LT+    D GV+ISASHNP++ NGIK F   GYK
Sbjct: 59  ILAAGIASAGGNCFMADVIPTPAIAYLTKLHHMDAGVVISASHNPFEYNGIKFFDQYGYK 118

Query: 121 VSTDIEDRIETLLEDDL---TSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGL 177
           +  + ED IE  +  D             IG    +  + + YI+++  +    V L GL
Sbjct: 119 LPDETEDLIEEFMLKDERAGQEGRPTGAEIGTITELPDLQEEYIDYIVNSTD--VDLSGL 176

Query: 178 RIVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRAD 237
           ++V D ANGA+YKV PE+   LGA+++ I  +PNGININ  CGST++ S++  V    AD
Sbjct: 177 KVVHDAANGAAYKVGPEILRRLGAELISIHAQPNGININDKCGSTHLESIKEAVLAHHAD 236

Query: 238 IGIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFI 297
           +GIA DGD DR +++DE G  ++GD+IM + A +      L+ + +V TVMSNIG  +  
Sbjct: 237 LGIANDGDADRCLVIDENGEELDGDRIMLICALQMKEEKRLQEDTVVGTVMSNIGFHKAA 296

Query: 298 AGLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQ 357
             +G   + T VGDRY++E M+N G+++GGEQSGHII  DY +TGDGL+ A+Q++R +K+
Sbjct: 297 KEMGCKTEVTAVGDRYVLECMRNKGYSLGGEQSGHIIFLDYNTTGDGLLTAVQLMRVMKK 356

Query: 358 YDKPVSTICHCFEEYPQFLRSVSVKDTS-ILNSSSIVQAIADAESELRGIDRLIVRASGT 416
             K +S +     +YPQ L++V V+  S    ++ I  AI+  ESEL    R++VR SGT
Sbjct: 357 QGKKLSELAGIMTKYPQILKNVRVETKSGWEENTLIAAAISAGESELGDDGRILVRPSGT 416

Query: 417 ESLIRIMAEGDDLSRIKRIVDDLAKVIP 444
           E LIR+MAEG D   ++RIVDD+A VI 
Sbjct: 417 EPLIRVMAEGPDEVELERIVDDIAAVIE 444


>gi|241763940|ref|ZP_04761982.1| phosphoglucosamine mutase [Acidovorax delafieldii 2AN]
 gi|241366763|gb|EER61204.1| phosphoglucosamine mutase [Acidovorax delafieldii 2AN]
          Length = 444

 Score =  260 bits (663), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 195/443 (44%), Positives = 287/443 (64%), Gaps = 4/443 (0%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M R++FGTDGIRG     PITP+F++R+  AVG + R  ++   V+IGKDTR+SGYMLE+
Sbjct: 1   MTRKYFGTDGIRGTVGQPPITPDFVLRLAHAVGRVLRQTEERPTVLIGKDTRISGYMLES 60

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +L +GF +AG+D  +LGP+P+P VA LTR+ RA +GV+ISASHN Y DNGIK F   G K
Sbjct: 61  ALESGFNSAGVDVVLLGPLPTPGVAYLTRAQRASLGVVISASHNAYPDNGIKFFSAQGTK 120

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +    E+ +E  L++      +   S+G A+R+D    RYIE  K T+P  ++L+GL+IV
Sbjct: 121 LPDAWEEAVEAALDE--PPRWADSASLGKARRLDDAAGRYIEFCKSTVPHALSLRGLKIV 178

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           VD A+GA+Y+VAP+VF ELGA+V+ IG  P+G+NIN + G+T+  +L R V   RAD GI
Sbjct: 179 VDAAHGAAYQVAPKVFHELGAEVLAIGCAPDGLNINHEVGATHTDALVRAVRANRADYGI 238

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           ALDGD DR+ +VD  G + NGD+++ L+A + M         + T  M+N+G+E  +   
Sbjct: 239 ALDGDADRLQMVDATGRLYNGDELLYLMAADRMGRDEHVPGVVGTL-MTNMGVELALQAR 297

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           G+ L R  VGDRY++E +  + + +GGE SGH++  D  +TGDGLV+ALQVL    + ++
Sbjct: 298 GVKLVRARVGDRYVLEELARHHWILGGEGSGHLLALDRHTTGDGLVSALQVLMACVRSER 357

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTSILNSSSIV-QAIADAESELRGIDRLIVRASGTESL 419
            ++ +    E YPQ L +V +       S++++ +A  D E+EL    R+++RASGTE L
Sbjct: 358 TLAQLLADVELYPQVLLNVRLAPGQDWKSNALLAKATQDVEAELGMAGRVLIRASGTEPL 417

Query: 420 IRIMAEGDDLSRIKRIVDDLAKV 442
           +R+M E  D+         LA  
Sbjct: 418 LRVMVEAKDVQVASSCAQRLADA 440


>gi|239815607|ref|YP_002944517.1| phosphoglucosamine mutase [Variovorax paradoxus S110]
 gi|259647730|sp|C5CKU7|GLMM_VARPS RecName: Full=Phosphoglucosamine mutase
 gi|239802184|gb|ACS19251.1| phosphoglucosamine mutase [Variovorax paradoxus S110]
          Length = 445

 Score =  260 bits (663), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 189/445 (42%), Positives = 281/445 (63%), Gaps = 4/445 (0%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M R++FGTDGIRG     PITP+F++R+  AVG + +  +    V+IGKDTR+SGYMLE+
Sbjct: 1   MTRKYFGTDGIRGTVGQSPITPDFVLRLAHAVGRVLKKSEARPTVLIGKDTRISGYMLES 60

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +L +GF +AG+D  +LGP+P+P VA LTR+ RA +GV+ISASHN Y DNGIK F   G K
Sbjct: 61  ALESGFNSAGVDVVLLGPLPTPGVAYLTRAQRASLGVVISASHNAYPDNGIKFFSAQGTK 120

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +    E  +E  LE+          ++G A+R++    RYIE  K T   D+TL+G+++V
Sbjct: 121 LDDAWELAVEAALEE--APVWVDSANLGKARRLNDAPGRYIEFCKSTFANDLTLRGMKLV 178

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           VD A+GA+Y+VAP VF ELGA+V  IG  P+G+NIN   G+T+  +L   V   +AD GI
Sbjct: 179 VDAAHGAAYQVAPNVFHELGAEVSSIGCAPDGLNINKGFGATHPAALVEAVTAQKADYGI 238

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           ALDGD DR+ +VD  G + NGD+++ L+  E ++    +  G+V T+M+N  +E  + G 
Sbjct: 239 ALDGDADRLQLVDASGRLFNGDELLYLMVAERIAR-GDKPAGVVGTLMTNKAIEVALRGQ 297

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           G+ L R +VGDRY++E ++  G+ +GGE SGH++  D  +TGDG+V+ALQVL+   +  K
Sbjct: 298 GIELVRAKVGDRYVLEELEKRGWLLGGEGSGHLLALDRHTTGDGIVSALQVLQACVRSGK 357

Query: 361 PVSTICHCFEEYPQFLRSVSV-KDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESL 419
            V+ +      +PQ L +V +       N+ ++       E+EL    R+++RASGTE L
Sbjct: 358 TVAQLLAEITLFPQVLINVRLTPGQDWKNNDALAGETRRIEAELGDSGRVLIRASGTEPL 417

Query: 420 IRIMAEGDDLSRIKRIVDDLAKVIP 444
           +R+M E  D  + +     LA  + 
Sbjct: 418 VRVMVEARDAKQAQSCAQRLAATLE 442


>gi|289423627|ref|ZP_06425427.1| phosphoglucosamine mutase [Peptostreptococcus anaerobius 653-L]
 gi|289155995|gb|EFD04660.1| phosphoglucosamine mutase [Peptostreptococcus anaerobius 653-L]
          Length = 449

 Score =  260 bits (663), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 193/447 (43%), Positives = 281/447 (62%), Gaps = 7/447 (1%)

Query: 3   RRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSL 62
           R++FGTDG+RG +NT  ++P+   ++G A GY+    K+  +VV+G+DTR+SG MLE +L
Sbjct: 2   RKYFGTDGVRGIANT-ELSPSMAFKLGRAGGYVLAENKEKVKVVVGRDTRISGDMLEAAL 60

Query: 63  VAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVS 122
           ++G  + G D   +G IP+P VA LTR   AD GV+ISASHNP + NGIK F   G+K+ 
Sbjct: 61  ISGLMSVGCDVITVGIIPTPGVAYLTRKYEADCGVVISASHNPVEYNGIKFFNKSGFKLD 120

Query: 123 TDIEDRIETLLED-DLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVV 181
             IE  IE  +++ DL       D +G           Y +++K  +   V+L+G++ V+
Sbjct: 121 DSIELEIEKYIDNMDLIDVNPTGDMVGRKIFDHEAIRHYADYLKSKID--VSLEGVKCVL 178

Query: 182 DCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIA 241
           DCANGA+Y+VAP VF ELGA+V+ I  +P+G NIN  CGST+   LQ+KV EV ADIG+A
Sbjct: 179 DCANGAAYRVAPMVFEELGAEVIAINAQPDGTNINDKCGSTHPEGLQKKVIEVGADIGLA 238

Query: 242 LDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLG 301
            DGD DR+I VDEKG +V+GD+IM L A +      L  + +V TVMSNIGL       G
Sbjct: 239 YDGDADRLIAVDEKGNLVDGDKIMVLGAIDMKKKGKLVKDTLVVTVMSNIGLTIAAKEHG 298

Query: 302 LSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKP 361
           ++L  T VGDRY++E M+ +G+ +GGEQSGH++  DY +TGDG +++L + + + +  K 
Sbjct: 299 INLATTAVGDRYVLEEMQKSGYVLGGEQSGHLVFLDYNTTGDGTMSSLVLTQIMVEEKKA 358

Query: 362 VSTICHCFEEYPQFLRSVSVKDTSI---LNSSSIVQAIADAESELRGIDRLIVRASGTES 418
           +S +    ++YPQ L +V VK+      ++   I   I   E E+ G  R+++R SGTE 
Sbjct: 359 MSELASVMDQYPQVLENVKVKNEFKNSYMDFKEIADEIVRIEKEMDGKGRVLIRPSGTEP 418

Query: 419 LIRIMAEGDDLSRIKRIVDDLAKVIPM 445
           L+R+M EG D   I  +   LA +I  
Sbjct: 419 LVRVMLEGKDQDHIHELALGLAAIIKE 445


>gi|89070589|ref|ZP_01157873.1| Phosphoglucomutase/phosphomannomutase [Oceanicola granulosus
           HTCC2516]
 gi|89043806|gb|EAR50007.1| Phosphoglucomutase/phosphomannomutase [Oceanicola granulosus
           HTCC2516]
          Length = 449

 Score =  260 bits (663), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 227/445 (51%), Positives = 311/445 (69%), Gaps = 4/445 (0%)

Query: 3   RRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKK-KHRRVVIGKDTRLSGYMLENS 61
           R  FGTDG+RG +NT+P+T +  ++IG A G  FR       RVVIGKDTRLSGYM EN+
Sbjct: 2   RTLFGTDGVRGTANTWPMTADMALKIGAAAGRYFRNDGSNGHRVVIGKDTRLSGYMFENA 61

Query: 62  LVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKV 121
           L AG T+ GM+  +LGP+P+PAV +LT S+RAD+G+MISASHNP++DNGIK FGPDG+K+
Sbjct: 62  LTAGLTSTGMNVLLLGPVPTPAVGLLTTSMRADLGIMISASHNPHEDNGIKFFGPDGFKL 121

Query: 122 STDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVV 181
           S   E  IE L+  DL        +IG A+RVD    RY E VK T P+ + L GL++V+
Sbjct: 122 SDAAEAEIEALVSADLAPA--MPGNIGRARRVDDGRFRYAERVKATFPQGMRLDGLKVVI 179

Query: 182 DCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIA 241
           DCANGA++KVAPEV WELGADV+ +G  PNG+NIN +CGST+  +    +    ADIGI 
Sbjct: 180 DCANGAAHKVAPEVLWELGADVIPVGTSPNGLNINQNCGSTSTGTAAETIVAHGADIGIC 239

Query: 242 LDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLG 301
           LDGD DRV+I+DE GA+ +GDQ+MAL A  W     LR   +V TVMSN+GLERF+ G G
Sbjct: 240 LDGDADRVMILDETGAVADGDQVMALFADRWARQQRLRDGTLVATVMSNLGLERFLGGKG 299

Query: 302 LSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKP 361
           L L+RT+VGDRY++E M++ G+N+GGEQSGHI+++DY +TGDGL+A LQ L  + + D+P
Sbjct: 300 LKLQRTKVGDRYVVEAMRSGGWNLGGEQSGHIVMTDYATTGDGLLAGLQFLAAMIETDQP 359

Query: 362 VSTICHCFEEYPQFLRSVSVKD-TSILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
            S +   FE  PQ L++V  +     L++ S+  AI  A+ ++    R+++R SGTE L+
Sbjct: 360 ASRLARNFERVPQLLQNVRYEPGQDPLSAESVQAAITAAQGDMGETGRVLIRKSGTEPLV 419

Query: 421 RIMAEGDDLSRIKRIVDDLAKVIPM 445
           R+MAE +D + + R+V+ +   +  
Sbjct: 420 RVMAECEDEAMLARVVESIVSEVKA 444


>gi|283771325|ref|ZP_06344214.1| phosphoglucosamine mutase [Staphylococcus aureus subsp. aureus H19]
 gi|283459530|gb|EFC06623.1| phosphoglucosamine mutase [Staphylococcus aureus subsp. aureus H19]
          Length = 451

 Score =  260 bits (663), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 188/445 (42%), Positives = 274/445 (61%), Gaps = 7/445 (1%)

Query: 4   RFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKK--KHRRVVIGKDTRLSGYMLENS 61
           ++FGTDG+RG +N   +TP    ++G   GY+    K  KH RV++G+DTR+SG MLE++
Sbjct: 3   KYFGTDGVRGVANQ-ELTPELAFKLGRYGGYVLAHNKGEKHPRVLVGRDTRVSGEMLESA 61

Query: 62  LVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKV 121
           L+AG  + G +   LG I +P VA LTR + A++GVMISASHNP  DNGIK FG DG+K+
Sbjct: 62  LIAGLISIGAEVMRLGIISTPGVAYLTRDMGAELGVMISASHNPVADNGIKFFGSDGFKL 121

Query: 122 STDIEDRIETLLEDDLTSYLSCYDS-IGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           S + E+ IE LL+ +         + I H         +Y+ ++K T+   V  +GL+IV
Sbjct: 122 SDEQENEIEALLDQENPELPRPVGNDIVHYSDYFEGAQKYLSYLKSTVD--VNFEGLKIV 179

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           +D ANG++  +AP +F +L AD   IG  P+G NIN  CGST+   L  KV E  +D G+
Sbjct: 180 LDGANGSTSSLAPFLFGDLEADTETIGCSPDGYNINEKCGSTHPEKLAEKVVETESDFGL 239

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           A DGDGDR+I VDE G IV+GDQIM +I +E   +  L  + IV+TVMSN+G  + +   
Sbjct: 240 AFDGDGDRIIAVDENGQIVDGDQIMFIIGQEMHKNQELNNDMIVSTVMSNLGFYKALEQE 299

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           G+   +T+VGDRY++E M+    N+GGEQSGHI++ DY +TGDGL+  +Q+   IK   K
Sbjct: 300 GIKSNKTKVGDRYVVEEMRRGNHNLGGEQSGHIVMMDYNTTGDGLLTGIQLASVIKMTGK 359

Query: 361 PVSTICHCFEEYPQFLRSVSVKDT-SILNSSSIVQAIADAESELRGIDRLIVRASGTESL 419
            +S +    ++YPQ L +V V D   +  +  + + +   E E+ G  R++VR SGTE L
Sbjct: 360 SLSELAGQMKKYPQSLINVRVTDKYRVEENVDVKEVMTKVEVEMNGEGRILVRPSGTEPL 419

Query: 420 IRIMAEGDDLSRIKRIVDDLAKVIP 444
           +R+M E       +R    +A V+ 
Sbjct: 420 VRVMVEAATDEDAERFAQQIADVVQ 444


>gi|220924417|ref|YP_002499719.1| phosphoglucosamine mutase [Methylobacterium nodulans ORS 2060]
 gi|254798585|sp|B8ID24|GLMM_METNO RecName: Full=Phosphoglucosamine mutase
 gi|219949024|gb|ACL59416.1| phosphoglucosamine mutase [Methylobacterium nodulans ORS 2060]
          Length = 446

 Score =  260 bits (663), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 259/429 (60%), Positives = 330/429 (76%), Gaps = 1/429 (0%)

Query: 3   RRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSL 62
           R++FGTDGIRG++N   ITP   +++G A G LF+  +   RVVIGKDTRLSGYM+E +L
Sbjct: 2   RKYFGTDGIRGRAN-GVITPELALKVGQAAGLLFQRGEYRHRVVIGKDTRLSGYMIETAL 60

Query: 63  VAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVS 122
           VAGFT+ GMD  +LGP+P+PAVAMLTRS+RAD+GVMISASHNPY+DNGIKLFGPDG+K+S
Sbjct: 61  VAGFTSVGMDVLLLGPMPTPAVAMLTRSMRADLGVMISASHNPYEDNGIKLFGPDGFKLS 120

Query: 123 TDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVVD 182
            ++E  IE L++ DL   LS    +G AKR++ VH RYIE  KRTLPR++TL GLR+VVD
Sbjct: 121 DEVEHEIERLIDSDLQKRLSASADLGRAKRIESVHARYIEFAKRTLPRNITLDGLRVVVD 180

Query: 183 CANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIAL 242
           CANGA+Y+VAPE  WELGA+V+ IG +P+G NIN D GST   +L RKV E+RADIGIAL
Sbjct: 181 CANGAAYRVAPETLWELGAEVIAIGTEPDGFNINRDVGSTAPDALVRKVRELRADIGIAL 240

Query: 243 DGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLGL 302
           DGD DRV++VDEKG  V+GDQ+MA++AR W     L   GIV T+MSN+GLER++ GLGL
Sbjct: 241 DGDADRVLVVDEKGQRVDGDQLMAVVARSWKEDERLTQPGIVATIMSNLGLERYLGGLGL 300

Query: 303 SLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKPV 362
           SL RT VGDRY++E+M+ +G+N+GGEQSGHII+SDY +TGDGLVAALQ+L  +++  +PV
Sbjct: 301 SLVRTAVGDRYVLEHMREHGYNLGGEQSGHIIMSDYATTGDGLVAALQLLTVVQRQKRPV 360

Query: 363 STICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLIRI 422
           S +CHCF+  PQ L++V       L   S+V AI  A   L    RL++R SGTE +IR+
Sbjct: 361 SEVCHCFDPLPQVLKNVRYGAGEPLRKDSVVTAIEGARQRLGNAGRLVIRPSGTEPVIRV 420

Query: 423 MAEGDDLSR 431
           MAEGDD   
Sbjct: 421 MAEGDDRDL 429


>gi|255975377|ref|ZP_05425963.1| phosphoglucosamine mutase [Enterococcus faecalis T2]
 gi|307277757|ref|ZP_07558843.1| phosphoglucosamine mutase [Enterococcus faecalis TX0860]
 gi|255968249|gb|EET98871.1| phosphoglucosamine mutase [Enterococcus faecalis T2]
 gi|306505636|gb|EFM74820.1| phosphoglucosamine mutase [Enterococcus faecalis TX0860]
 gi|315146224|gb|EFT90240.1| phosphoglucosamine mutase [Enterococcus faecalis TX4244]
 gi|315167534|gb|EFU11551.1| phosphoglucosamine mutase [Enterococcus faecalis TX1341]
          Length = 451

 Score =  260 bits (663), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 181/447 (40%), Positives = 269/447 (60%), Gaps = 8/447 (1%)

Query: 4   RFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGK---KKHRRVVIGKDTRLSGYMLEN 60
           ++FGTDG+RG +N   +TP    ++G   GY+        +  RV++G+DTR+SG MLE 
Sbjct: 3   KYFGTDGVRGIANK-ELTPELAFKLGRYGGYVLSQHEDSSRKPRVLVGRDTRISGEMLEQ 61

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +L+AG  + G++ F LG I +P VA LTR  +A  GVMISASHNP +DNGIK FG DG+K
Sbjct: 62  ALIAGLLSVGIEVFQLGVISTPGVAYLTRLQKASAGVMISASHNPAEDNGIKFFGADGFK 121

Query: 121 VSTDIEDRIETLLE-DDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRI 179
           +  D E  IE LL+ ++        + +G          +Y + + +++P    L  + +
Sbjct: 122 LVDDQEAEIEALLDAEEDALPRPSAEGLGSLDEFPEGLLKYSQFLVQSIPG--DLADMTV 179

Query: 180 VVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIG 239
            +D ANGA+      VF +L  D   +G  PNG+NIN   GST+  +L   V E  AD G
Sbjct: 180 CLDAANGATATAVNRVFADLETDFYTMGTSPNGLNINDGVGSTHPEALAEMVVEKGADAG 239

Query: 240 IALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAG 299
           +A DGDGDR+I VDE G I++GD+IM + A+       L+ + IVTTVMSN+G  + +  
Sbjct: 240 LAFDGDGDRIIAVDELGRIIDGDKIMYICAKYLAEKKRLKKDTIVTTVMSNLGFHKAVEE 299

Query: 300 LGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYD 359
           +GL    T+VGDRY++E M+ N +N GGEQSGH+I  DY +TGDG+++ +Q+L  +KQ  
Sbjct: 300 IGLKDVVTQVGDRYVVEEMRKNDYNFGGEQSGHMIFLDYNTTGDGMLSGIQLLNVMKQTG 359

Query: 360 KPVSTICHCFEEYPQFLRSVSVKDTS-ILNSSSIVQAIADAESELRGIDRLIVRASGTES 418
           K +S +      YPQ L ++ V D +  +   +I   +  AE+E+ G  R++VR SGTE 
Sbjct: 360 KKLSELADEVTIYPQKLVNIRVTDKNGAMEVPAIKAVVEQAEAEMNGEGRILVRPSGTEP 419

Query: 419 LIRIMAEGDDLSRIKRIVDDLAKVIPM 445
           L+R+MAE     ++   VD +A+V+  
Sbjct: 420 LLRVMAEAPTQEKVDYYVDKIAEVVRA 446


>gi|223043963|ref|ZP_03614004.1| phosphoglucosamine mutase [Staphylococcus capitis SK14]
 gi|314934225|ref|ZP_07841586.1| phosphoglucosamine mutase [Staphylococcus caprae C87]
 gi|222442678|gb|EEE48782.1| phosphoglucosamine mutase [Staphylococcus capitis SK14]
 gi|313653130|gb|EFS16891.1| phosphoglucosamine mutase [Staphylococcus caprae C87]
          Length = 452

 Score =  260 bits (663), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 186/445 (41%), Positives = 274/445 (61%), Gaps = 7/445 (1%)

Query: 4   RFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKK--KHRRVVIGKDTRLSGYMLENS 61
           ++FGTDG+RG +N   +TP    ++G   GY+    K  KH +V++G+DTR+SG MLE++
Sbjct: 3   KYFGTDGVRGIANQ-ELTPELAFKLGRYGGYVLAHNKGEKHPKVLVGRDTRVSGEMLESA 61

Query: 62  LVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKV 121
           L+AG  + G +   LG I +P VA LT+ + A +GVMISASHNP  DNGIK FG DG+K+
Sbjct: 62  LIAGLISIGAEVMRLGIISTPGVAYLTKEMEAALGVMISASHNPVADNGIKFFGSDGFKL 121

Query: 122 STDIEDRIETLLEDDLTS-YLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           S D E+ IE LL+ D         + I H         +Y+ ++K T+   V  +GL+I 
Sbjct: 122 SDDQENEIEELLDQDNPELPRPIGEDIVHYSDYFEGAQKYLSYLKSTVD--VNFEGLKIA 179

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           +D ANG++  +AP +F +L AD   IG  P+G NIN  CGST+   L   V E  +D G+
Sbjct: 180 LDGANGSTSSLAPFLFGDLEADTETIGCNPDGYNINEQCGSTHPEKLAETVLETESDFGL 239

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           A DGDGDR+I VDE G IV+GDQIM +I +E   +  L  + IV+TVMSN+G  + +   
Sbjct: 240 AFDGDGDRIIAVDENGQIVDGDQIMFIIGQEMHKNHELNNDMIVSTVMSNLGFYKALENE 299

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           G+   +T+VGDRY++E M+   +N+GGEQSGHI++ DY +TGDGL+  +Q+   IK   K
Sbjct: 300 GIQSNKTKVGDRYVVEEMRRGNYNLGGEQSGHIVMMDYNTTGDGLLTGVQLASVIKMSGK 359

Query: 361 PVSTICHCFEEYPQFLRSVSVKDT-SILNSSSIVQAIADAESELRGIDRLIVRASGTESL 419
            +S +    ++YPQ L +V V D   +  +  + + +   E+E+ G  R++VR SGTE L
Sbjct: 360 SLSELASQMKKYPQSLINVKVTDKYRVEENIHVQEVMTKVETEMNGEGRILVRPSGTEPL 419

Query: 420 IRIMAEGDDLSRIKRIVDDLAKVIP 444
           +R+M E       +R   ++A V+ 
Sbjct: 420 VRVMVEAATNEDAQRFAQEIADVVQ 444


>gi|302671940|ref|YP_003831900.1| phosphoglucosamine mutase GlmM [Butyrivibrio proteoclasticus B316]
 gi|302396413|gb|ADL35318.1| phosphoglucosamine mutase GlmM [Butyrivibrio proteoclasticus B316]
          Length = 449

 Score =  259 bits (662), Expect = 5e-67,   Method: Composition-based stats.
 Identities = 190/451 (42%), Positives = 273/451 (60%), Gaps = 9/451 (1%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGK-KKHRRVVIGKDTRLSGYMLE 59
           M R  FGTDG+RG +N   +TP   M++G A  Y+   +      +++G DTRLSG ML 
Sbjct: 1   MSR-LFGTDGVRGVAND-ELTPLLAMQLGQAGAYVLSKEVNHRPTIMVGCDTRLSGDMLA 58

Query: 60  NSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGY 119
           ++L+AG  + G D   +G IP+PAVA LTR  R D GV+ISASHNP + NGIK F  +G+
Sbjct: 59  SALMAGACSVGADVVNVGIIPTPAVAYLTRKYRVDAGVVISASHNPMEFNGIKFFDANGF 118

Query: 120 KVSTDIEDRIETLLEDDLTSYLSCYD-SIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLR 178
           K+   +ED IE L+++++          +G  K      + YI H    +   + L G++
Sbjct: 119 KLPDAMEDEIEALIKNNMDGVKMPTGAGVGKIKNRTDAREEYINHNLNAVD--INLTGMK 176

Query: 179 IVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADI 238
           IV+DCA GASY  + E   +LGA+VVVI + P+G NIN  CGST++  L  +V   +A++
Sbjct: 177 IVMDCAEGASYYTSVEAIRQLGAEVVVIHNNPDGTNINAGCGSTHMEELMGRVVTEKANV 236

Query: 239 GIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIA 298
           G+A DGD DR + VDE G +V+GD+IMA+I +    +  L  N IV TVMSN+G  +   
Sbjct: 237 GLAFDGDADRFLAVDENGKMVDGDEIMAIIGKFMKENGKLAKNTIVATVMSNLGFFKMAE 296

Query: 299 GLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQY 358
             G+ + +T+VGDRY++E+MK  G N+GGEQSGHII  D  +TGDGL++AL +L  +   
Sbjct: 297 REGIQVDKTKVGDRYVLEHMKEIGANLGGEQSGHIIFLDDNTTGDGLLSALHLLEVMVST 356

Query: 359 DKPVSTICHCFEEYPQFLRSVSV---KDTSILNSSSIVQAIADAESELRGIDRLIVRASG 415
            KP+S +    E  PQ L +  V   K  S +    I  AIA+ E +  G  R+++R SG
Sbjct: 357 GKPLSELAKVMEVMPQALVNAHVPTHKKDSFMEYPEIAGAIAELEKQFAGDGRVLIRPSG 416

Query: 416 TESLIRIMAEGDDLSRIKRIVDDLAKVIPMI 446
           TE L+R+M EG D  +I+     LAK+I  +
Sbjct: 417 TEPLVRVMIEGKDQKQIEDEAKKLAKLIEEV 447


>gi|260892153|ref|YP_003238250.1| phosphoglucosamine mutase [Ammonifex degensii KC4]
 gi|260864294|gb|ACX51400.1| phosphoglucosamine mutase [Ammonifex degensii KC4]
          Length = 459

 Score =  259 bits (662), Expect = 5e-67,   Method: Composition-based stats.
 Identities = 189/446 (42%), Positives = 277/446 (62%), Gaps = 5/446 (1%)

Query: 4   RFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSLV 63
             FGTDG+RG +N   +TP    R+G A  Y+   K   + V++G+DTR SG MLE +LV
Sbjct: 3   VLFGTDGVRGVANR-ELTPELAFRLGRAGAYVLAEKTGKKTVLVGRDTRASGDMLEAALV 61

Query: 64  AGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVST 123
           AG T+AG++  +LG +P+PAVA LTR+  A  G++ISASHNP +DNGIK FGPDGYK+  
Sbjct: 62  AGITSAGLNVCLLGVLPTPAVAFLTRARGAAGGIVISASHNPAEDNGIKFFGPDGYKLPD 121

Query: 124 DIEDRIETLLEDDLTSYLSCYD-SIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVVD 182
            +E+ IE L+   +    S     +G A       + Y+EHV+R  P   TL+G++I VD
Sbjct: 122 ALEEEIENLVLGSMERIPSPTGAGVGRAYSCAEAVEEYLEHVRRIGP--PTLKGMKIAVD 179

Query: 183 CANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIAL 242
           CA+GA+Y +AP +   LGA V+ +G +P+G NIN  CGST    L   V E  AD+G+A 
Sbjct: 180 CAHGAAYALAPTLLEGLGAKVIPLGVEPDGHNINDGCGSTKPHRLSLLVKETGADLGLAF 239

Query: 243 DGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLGL 302
           DGD DR+I VD +G + +GD ++   AR   +H  L+ + +V TVMSN+GL+R +    +
Sbjct: 240 DGDADRLIGVDGRGEVADGDVVIWGCARYLKAHRRLKEDTVVVTVMSNLGLKRALQAENI 299

Query: 303 SLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKPV 362
            +  T VGDRY++E M  +G  +GGEQSGHII  D+ +TGDGL+ A+ +LR + +  + +
Sbjct: 300 RVLETRVGDRYVLEAMLKSGACLGGEQSGHIIFLDHNTTGDGLITAMMLLRLLVETGQRL 359

Query: 363 STICHCFEEYPQFLRSVSVKDT-SILNSSSIVQAIADAESELRGIDRLIVRASGTESLIR 421
             +      YPQ L +V V+D   ++ S  ++ AI   ++ L    R++VR SGTE +IR
Sbjct: 360 EDLNRSLVRYPQLLENVRVRDKGRVMQSPELLAAIEAEKARLGEEGRVLVRPSGTEPVIR 419

Query: 422 IMAEGDDLSRIKRIVDDLAKVIPMID 447
           +M E  D  + + ++D L  VI  I+
Sbjct: 420 VMVEALDPEKARSVLDSLVDVIRGIE 445


>gi|70734333|ref|YP_257973.1| phosphoglucosamine mutase [Pseudomonas fluorescens Pf-5]
 gi|84029250|sp|Q4KIG0|GLMM_PSEF5 RecName: Full=Phosphoglucosamine mutase
 gi|68348632|gb|AAY96238.1| phosphoglucosamine mutase [Pseudomonas fluorescens Pf-5]
          Length = 445

 Score =  259 bits (662), Expect = 5e-67,   Method: Composition-based stats.
 Identities = 196/449 (43%), Positives = 295/449 (65%), Gaps = 5/449 (1%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M +++FGTDGIRG+   FPITP+FM+++G A G  FR      RV++GKDTR+SGYM E+
Sbjct: 1   MTKKYFGTDGIRGRVGEFPITPDFMLKLGWAAGMAFRSMGA-CRVLVGKDTRISGYMFES 59

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +L AG +AAG D  +LGP+P+PA+A LTR+  A+ G++ISASHNP+ DNGIK F  +G K
Sbjct: 60  ALEAGLSAAGADVMLLGPMPTPAIAYLTRTFHAEAGIVISASHNPHDDNGIKFFSGEGTK 119

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +  ++E  IE LL+  +T  +     +G   R++    RYIE  K ++P   +  GL++V
Sbjct: 120 LPDEVELMIEELLDAPMT--VVESSKLGKVSRINDASGRYIEFCKSSVPSSTSFAGLKVV 177

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           +DCA+GA+YKVAP VF ELGA V V+  +PNG+NIN +CGST++  LQ  V    AD+GI
Sbjct: 178 LDCAHGATYKVAPSVFRELGAQVTVLSAQPNGLNINENCGSTHMSQLQAAVLAEHADLGI 237

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           A DGDGDRV++VD+ GAIV+GD+++ +IAR+      L+G  + T  MSN+GLE  +A L
Sbjct: 238 AFDGDGDRVLMVDQTGAIVDGDELLFIIARDLHERDKLQGGVVGTL-MSNLGLELALADL 296

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           G+   R  VGDRY++  +    + VGGE SGHI+   + +TGD ++AALQVL  +K   +
Sbjct: 297 GIPFVRANVGDRYVIAELLERNWLVGGENSGHIVCFRHATTGDAIIAALQVLMALKARGE 356

Query: 361 PVSTICHCFEEYPQFLRSVSV-KDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESL 419
            ++       + PQ L +V      + +   ++ +A     + + G  R+++R SGTE L
Sbjct: 357 SLAQSRQGLRKCPQVLVNVRFGGGENPVEHPAVKEACERVTAAMAGRGRVLLRKSGTEPL 416

Query: 420 IRIMAEGDDLSRIKRIVDDLAKVIPMIDS 448
           +R+M EGDD ++++   ++LAK++  + +
Sbjct: 417 VRVMVEGDDEAQVRAYAEELAKLVAEVSA 445


>gi|319410943|emb|CBY91338.1| phosphoglucosamine mutase [Neisseria meningitidis WUE 2594]
          Length = 444

 Score =  259 bits (662), Expect = 5e-67,   Method: Composition-based stats.
 Identities = 196/445 (44%), Positives = 290/445 (65%), Gaps = 6/445 (1%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKK--KHRRVVIGKDTRLSGYML 58
           M +++FGTDG+RG+   FPITP+F++++G A G +       +   V+IGKDTR+SGYML
Sbjct: 1   MAKKYFGTDGVRGEVGQFPITPDFVLKLGYAAGQVLVQHDTDQKPTVLIGKDTRISGYML 60

Query: 59  ENSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDG 118
           E +LVAGFTAAG++    GP+P+P VA LTR+LR   GVMISASHN Y DNGIK F   G
Sbjct: 61  EAALVAGFTAAGVNVIQTGPLPTPGVAYLTRALRLSAGVMISASHNAYSDNGIKFFAEGG 120

Query: 119 YKVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLR 178
            K+S +IE  IE  +++++ +       +G A+R+ G  DRYIE  K T P    L+GL+
Sbjct: 121 VKLSDEIELEIEAKIDEEMKTQP--SARLGRARRISGADDRYIEFCKSTFPSHSDLRGLK 178

Query: 179 IVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADI 238
           +V+D ANGA Y VAP+VF ELGA VV IGD+PNG NIN  CG+T   +LQ  V +  AD 
Sbjct: 179 LVIDTANGAGYGVAPKVFHELGAQVVSIGDEPNGYNINEKCGATYTKTLQAAVLQHEADY 238

Query: 239 GIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIA 298
           GIALDGDGDR+++VD+ G + +GD ++ +IA+   +   +   G+V TVM+N+ +E  + 
Sbjct: 239 GIALDGDGDRLMMVDKNGKVYDGDSLIYVIAK-ARAREGINIGGVVGTVMTNMAMEIALK 297

Query: 299 GLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQY 358
             G+   R +VGDRY++E +    + +GGE SGHI+  D  +TGDG+++ALQVL  ++  
Sbjct: 298 EQGVDFCRAKVGDRYVLEQLNQRSWLIGGEASGHILCMDKHNTGDGIISALQVLAALQTL 357

Query: 359 DKPVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTES 418
           ++ ++T+C  ++ YPQ + +V ++       +S    +A+ E EL G  R+++RASGTE 
Sbjct: 358 NQDLATVCADWQPYPQTMINVRIQKGQKWQEAS-KDVLAEVEKELEGKGRVVLRASGTEP 416

Query: 419 LIRIMAEGDDLSRIKRIVDDLAKVI 443
           ++R+M E       +   + +A  I
Sbjct: 417 VVRVMVEARQADWARDGAERIASAI 441


>gi|254452197|ref|ZP_05065634.1| phosphoglucosamine mutase [Octadecabacter antarcticus 238]
 gi|198266603|gb|EDY90873.1| phosphoglucosamine mutase [Octadecabacter antarcticus 238]
          Length = 451

 Score =  259 bits (662), Expect = 5e-67,   Method: Composition-based stats.
 Identities = 231/448 (51%), Positives = 301/448 (67%), Gaps = 4/448 (0%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKK-KHRRVVIGKDTRLSGYMLE 59
           M R+FFGTDG+RG +N +P+T    ++IG A G  FR       RVVIGKDTRLSGYM E
Sbjct: 1   MARKFFGTDGVRGTANKYPMTAEMGLKIGAAAGCYFRNDGSNGHRVVIGKDTRLSGYMFE 60

Query: 60  NSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGY 119
           ++L AG T+ GM+  +LGPIP+PAVAMLT S+RAD+G+MISASHNP  DNGIK FGPDG+
Sbjct: 61  SALTAGLTSTGMNVLLLGPIPTPAVAMLTTSMRADLGIMISASHNPAVDNGIKFFGPDGF 120

Query: 120 KVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRI 179
           K+S + E  IE LLE DL        +IG AKR+D    RY E +K T P  + L G+++
Sbjct: 121 KLSDEAEAEIERLLEGDLVPA--QASNIGRAKRIDDGRFRYAERLKGTFPHGMRLDGIKV 178

Query: 180 VVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIG 239
           V+DCANGA YKVAPEV WELGA V+ +G  P+G NIN  CGST   +    +    AD+G
Sbjct: 179 VIDCANGAGYKVAPEVLWELGATVIPVGTHPDGFNINEGCGSTAPRTAAETIVTHGADVG 238

Query: 240 IALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAG 299
           I LDGD DRV+I+DE G + +GDQIM L A  W     L    +V TVMSN+GLERF+  
Sbjct: 239 ICLDGDADRVMILDEHGNVADGDQIMGLFANRWAQADRLNKGTLVATVMSNLGLERFLND 298

Query: 300 LGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYD 359
            GLSL+R +VGDRY++E M+  GFN+GGEQSGHI+++D+ +TGDGL+A LQ L  + +  
Sbjct: 299 KGLSLERADVGDRYVVEAMRAGGFNLGGEQSGHIVMTDFATTGDGLLAGLQFLAAMIETG 358

Query: 360 KPVSTICHCFEEYPQFLRSVSVKD-TSILNSSSIVQAIADAESELRGIDRLIVRASGTES 418
           KP S +   FE  PQ L++V   D    L    +  AIA AE+ L G  RL++R SGTE 
Sbjct: 359 KPASELIRVFETVPQMLKNVRYSDGADPLGQPPVKAAIAAAEASLVGKGRLLIRKSGTEP 418

Query: 419 LIRIMAEGDDLSRIKRIVDDLAKVIPMI 446
           LIR+MAE +D + + ++VD +   +  +
Sbjct: 419 LIRVMAECEDDALLAQVVDGIVAQVEAV 446


>gi|241888894|ref|ZP_04776200.1| phosphoglucosamine mutase [Gemella haemolysans ATCC 10379]
 gi|241864570|gb|EER68946.1| phosphoglucosamine mutase [Gemella haemolysans ATCC 10379]
          Length = 447

 Score =  259 bits (662), Expect = 5e-67,   Method: Composition-based stats.
 Identities = 186/444 (41%), Positives = 287/444 (64%), Gaps = 4/444 (0%)

Query: 3   RRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSL 62
           R++FGTDGIRG +    +T +   ++G A+G L   +K+H +VVIG+DTR+S  M+E++L
Sbjct: 2   RKYFGTDGIRGIAGE-SLTADLSFKVGKALGKLLTEEKEHPKVVIGRDTRISCDMIEHAL 60

Query: 63  VAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVS 122
            AG T+ G++   +G IP+PA+A LT+++  D G+MISASHNPYQDNGIK+FGPDG+K++
Sbjct: 61  TAGLTSTGVNVMTVGTIPTPAIAYLTKTIETDSGIMISASHNPYQDNGIKIFGPDGFKLT 120

Query: 123 TDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVVD 182
            + E  IE+L+++      + ++ IG     + +  +YI+H+K+++     L  ++I +D
Sbjct: 121 DEQELEIESLIDNSEKIKNASFEKIGKVYGGNELTQKYIQHIKQSITG--DLSDIKIALD 178

Query: 183 CANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIAL 242
           CANGA+  VAP +F +L AD+  IG +PNG+NIN + GST + ++   V E   D+G A 
Sbjct: 179 CANGATTGVAPFIFGDLEADIETIGCQPNGVNINDNVGSTKIETISEFVKENNVDVGFAF 238

Query: 243 DGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLGL 302
           DGDGDRV+ VD  G IV+GD+IM ++A+       L+ N +V+TVMSNIG  + I   GL
Sbjct: 239 DGDGDRVLAVDANGNIVDGDKIMFILAKHLKEQGELKDNMVVSTVMSNIGFYKAIEENGL 298

Query: 303 SLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKPV 362
              +T VGDRY++E M+ N +++GGEQSGHI+L +Y +TGDG++ A+++   IK   K +
Sbjct: 299 QSVKTAVGDRYVVEEMRKNDYSLGGEQSGHIVLMNYATTGDGILTAVKLANIIKTSGKSL 358

Query: 363 STICHCFEEYPQFLRSVSVKDTS-ILNSSSIVQAIADAESELRGIDRLIVRASGTESLIR 421
             +      YPQ L ++ V D    +  S I+      E EL G  R+++RASGTE+LIR
Sbjct: 359 EELASEVSIYPQKLVNIKVIDKKTAMEDSEILSECEKVEKELEGNGRILLRASGTENLIR 418

Query: 422 IMAEGDDLSRIKRIVDDLAKVIPM 445
           +M E        +  + +AK++  
Sbjct: 419 VMVEASSDELTDKYCEQVAKIVRE 442


>gi|194017593|ref|ZP_03056204.1| phosphoglucosamine mutase [Bacillus pumilus ATCC 7061]
 gi|194010865|gb|EDW20436.1| phosphoglucosamine mutase [Bacillus pumilus ATCC 7061]
          Length = 448

 Score =  259 bits (662), Expect = 5e-67,   Method: Composition-based stats.
 Identities = 184/444 (41%), Positives = 275/444 (61%), Gaps = 5/444 (1%)

Query: 4   RFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSLV 63
           ++FGTDG+RG +N   +TP    +IG   GY+    K+  +V++G+DTR+SG+MLE +LV
Sbjct: 3   KYFGTDGVRGVAN-SELTPELAFKIGRFGGYVLTKDKERPKVLVGRDTRVSGHMLEGALV 61

Query: 64  AGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVST 123
           AG  + G +   LG I +P V+ LT+++ A+ GVMISASHNP QDNGIK FG DG+K+S 
Sbjct: 62  AGLLSIGAEVMRLGVISTPGVSYLTKAMDAEAGVMISASHNPVQDNGIKFFGGDGFKLSD 121

Query: 124 DIEDRIETLLEDDLTSYLSCYD-SIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVVD 182
           + E+ IE L++  +          +G          +Y++ +K+T   D T  G+ + +D
Sbjct: 122 EQENEIEQLMDQPVDQLPRPVGADLGTVNDYFEGGQKYLQFLKQTADEDFT--GIHVALD 179

Query: 183 CANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIAL 242
           CA+GA+  +A  +F +L ADV  +G  PNG+NIN   GST+  +L   + E  ADIG+A 
Sbjct: 180 CAHGATSSLATHLFADLDADVSTMGTSPNGLNINDGVGSTHPEALSAFMKEKGADIGLAF 239

Query: 243 DGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLGL 302
           DGDGDR+I VDEKG IV+GDQIM + AR       L+ + +V+TVMSN+G  + +   G+
Sbjct: 240 DGDGDRLIAVDEKGDIVDGDQIMYICARYLKGEGRLKDDTVVSTVMSNLGFYKALEKQGI 299

Query: 303 SLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKPV 362
              +T VGDRY++E MK +G+NVGGEQSGH+I  DY +TGDG+++A+ ++  +K   K +
Sbjct: 300 KSIQTAVGDRYVVEAMKKDGYNVGGEQSGHLIFLDYNTTGDGMLSAIMLVNTLKATGKTL 359

Query: 363 STICHCFEEYPQFLRSVSVKDT-SILNSSSIVQAIADAESELRGIDRLIVRASGTESLIR 421
           S +    E++PQ L +V V D   +  +  +   I + E E+ G  R++VR SGTE L+R
Sbjct: 360 SELAAEMEKFPQLLVNVKVSDKYKVEENEKVKAVIQEVEKEMNGDGRILVRPSGTEPLVR 419

Query: 422 IMAEGDDLSRIKRIVDDLAKVIPM 445
           +MAE          V  +  V+  
Sbjct: 420 VMAEAKTKELCDDYVTRITAVVKE 443


>gi|91788711|ref|YP_549663.1| phosphoglucosamine mutase [Polaromonas sp. JS666]
 gi|123164758|sp|Q129M7|GLMM_POLSJ RecName: Full=Phosphoglucosamine mutase
 gi|91697936|gb|ABE44765.1| phosphoglucosamine mutase [Polaromonas sp. JS666]
          Length = 443

 Score =  259 bits (662), Expect = 5e-67,   Method: Composition-based stats.
 Identities = 190/445 (42%), Positives = 281/445 (63%), Gaps = 4/445 (0%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M R++FGTDGIRG     PITP+F++R+  AVG + R  +    V+IGKDTR+SGYMLE+
Sbjct: 1   MTRKYFGTDGIRGTVGQPPITPDFVLRLAHAVGRVLRRVESRPTVLIGKDTRISGYMLES 60

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +L +GF +AG+D  +LGP+P+P VA LTR+ RA +GV+ISASHN Y DNGIK F   G K
Sbjct: 61  ALESGFNSAGVDVVLLGPLPTPGVAYLTRAQRASLGVVISASHNAYPDNGIKFFSAQGTK 120

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +S + E  +E  LE+          ++G A+R+D    RYIE  K T   D+TL+GL+IV
Sbjct: 121 LSDEWELAVEAALEE--PPVWVDSATLGKARRLDDAAGRYIEFCKSTFAHDLTLKGLKIV 178

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           VD A+GA+Y +AP+VF ELGA+V+ IG  P+G+NIN + G+T+  +L   V   +AD GI
Sbjct: 179 VDGAHGAAYHIAPKVFHELGAEVIAIGCAPDGLNINHEVGATHPEALITAVKANQADYGI 238

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           ALDGD DR+ +VD  G + NGD+++ L+  E ++        + T  M+N+ +E  +   
Sbjct: 239 ALDGDADRLQMVDADGRLFNGDEVLFLMVSERLARGEKVPGTVGTL-MTNMAVELALKSR 297

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           G+   R +VGDRY++E ++  G+ +GGE SGH++  D  +TGDGL++ALQVL+   +  K
Sbjct: 298 GVEFVRAKVGDRYVLEELEKRGWLLGGEGSGHLLALDKHTTGDGLISALQVLQACVRSGK 357

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQ-AIADAESELRGIDRLIVRASGTESL 419
            ++ +      +PQ L +V +K      +S  +       E+EL    RL++RASGTE L
Sbjct: 358 TIAQLLGDVVLFPQTLVNVRLKPGQDWKASEKLALETKAVEAELGDTGRLLIRASGTEPL 417

Query: 420 IRIMAEGDDLSRIKRIVDDLAKVIP 444
           +R+M E  D  + K   + +A  + 
Sbjct: 418 LRVMVEARDARQAKACAERVADTVR 442


>gi|118580671|ref|YP_901921.1| phosphoglucosamine mutase [Pelobacter propionicus DSM 2379]
 gi|158512564|sp|A1AR93|GLMM_PELPD RecName: Full=Phosphoglucosamine mutase
 gi|118503381|gb|ABK99863.1| phosphoglucosamine mutase [Pelobacter propionicus DSM 2379]
          Length = 453

 Score =  259 bits (662), Expect = 5e-67,   Method: Composition-based stats.
 Identities = 206/446 (46%), Positives = 295/446 (66%), Gaps = 3/446 (0%)

Query: 3   RRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHR-RVVIGKDTRLSGYMLENS 61
           ++ FGTDG+RG +N +P+T    M++G A  Y+F+   K R R+VIGKDTRLSGYMLEN+
Sbjct: 2   KKLFGTDGVRGVANVYPMTTEMAMQLGRAAAYIFKSSSKRRHRIVIGKDTRLSGYMLENA 61

Query: 62  LVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKV 121
           +VAG  + G+D  ++GP+P+P +A +T S+RAD GV+ISASHNP+QDNGIK F  DG+K+
Sbjct: 62  MVAGICSMGVDVLLVGPLPTPGIANITSSMRADAGVVISASHNPFQDNGIKFFSADGFKL 121

Query: 122 STDIEDRIETLLEDD-LTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
              IE +IE L+E + + S       +G A R+D    RYI  +K T P ++ L G++IV
Sbjct: 122 PDQIELKIEKLIESNKIDSLRPTASEVGKAFRIDDAAGRYIVFLKNTFPTEMDLSGMKIV 181

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           +DCANGA+Y+VAP VF ELGA+V+ +G  PNG NIN DCGS     +   V + RADIGI
Sbjct: 182 LDCANGAAYRVAPAVFEELGAEVICLGVSPNGTNINADCGSLYPQVISEAVKKHRADIGI 241

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           ALDGD DRVI+ DE G  V+GD IMA+ A + +   LL+   +VTTVMSN+GL+  +   
Sbjct: 242 ALDGDADRVIVCDEFGHEVDGDHIMAICATDMLRRKLLKKKTLVTTVMSNMGLDIAMRAA 301

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           G  + +T VGDRY++E M+  G+N+GGEQSGH+I  D  +TGDG+++ALQ+L  +++ +K
Sbjct: 302 GGKIVKTAVGDRYVVEEMRKGGYNLGGEQSGHMIFLDSNTTGDGILSALQLLAVMRRTEK 361

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTSIL-NSSSIVQAIADAESELRGIDRLIVRASGTESL 419
           P+S +       PQ L +  V++   +     I   I D E +L    R+++R SGTE L
Sbjct: 362 PLSELSEVMIALPQVLVNTRVREKKDITTIPEIAARIRDVEEKLGNEGRVLIRYSGTEPL 421

Query: 420 IRIMAEGDDLSRIKRIVDDLAKVIPM 445
           +R+M EG D   I    +++  ++  
Sbjct: 422 LRVMLEGKDTYEITAWANEIIDLVRK 447


>gi|311070831|ref|YP_003975754.1| phosphoglucosamine mutase [Bacillus atrophaeus 1942]
 gi|310871348|gb|ADP34823.1| phosphoglucosamine mutase [Bacillus atrophaeus 1942]
          Length = 448

 Score =  259 bits (662), Expect = 5e-67,   Method: Composition-based stats.
 Identities = 182/443 (41%), Positives = 275/443 (62%), Gaps = 5/443 (1%)

Query: 4   RFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSLV 63
           ++FGTDG+RG +N   +TP    ++G   GY+    K+  +V+IG+DTR+SG+MLE +LV
Sbjct: 3   KYFGTDGVRGVAN-SELTPELAFKVGRFGGYVLTKDKQRPKVLIGRDTRISGHMLEGALV 61

Query: 64  AGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVST 123
           AG  + G +   LG I +P V+ LT+++ A+ GVMISASHNP QDNGIK FG DG+K+S 
Sbjct: 62  AGLLSIGAEVMRLGVISTPGVSYLTKAMDAEAGVMISASHNPVQDNGIKFFGGDGFKLSD 121

Query: 124 DIEDRIETLLEDDLTSYLSCYD-SIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVVD 182
           + E+ IE L+++            +G          +Y++ +K++   D T  G+ + +D
Sbjct: 122 EQEEEIERLMDEPEDKLPRPVGADLGLVNDYFEGGQKYLQFLKQSADDDFT--GIHVALD 179

Query: 183 CANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIAL 242
           CA+GA+  +A  +F +L ADV  +G  PNG+NIN   GST+  +L   V E  ADIG+A 
Sbjct: 180 CAHGATSSLATHLFADLDADVSTMGTSPNGLNINDGVGSTHPEALSAFVKEKNADIGLAF 239

Query: 243 DGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLGL 302
           DGDGDR+I VDEKG +V+GDQIM + A+   S   L+   +V+TVMSN+G  + +    +
Sbjct: 240 DGDGDRLIAVDEKGNVVDGDQIMYICAKYLKSEGRLKEETVVSTVMSNLGFYKALEKEEI 299

Query: 303 SLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKPV 362
              +T VGDRY++E M+  G+NVGGEQSGH+I  DY +TGDGL++A+ ++  +K   KP+
Sbjct: 300 KSIQTAVGDRYVVEAMRKEGYNVGGEQSGHLIFLDYNTTGDGLLSAIMLMNTLKASGKPL 359

Query: 363 STICHCFEEYPQFLRSVSVKDT-SILNSSSIVQAIADAESELRGIDRLIVRASGTESLIR 421
           S +    +++PQ L +V V D   +  +  +   I++ E E+ G  R++VR SGTE L+R
Sbjct: 360 SELAAEMQKFPQLLVNVKVSDKYKVEENEKVKAVISEVEKEMNGDGRILVRPSGTEPLVR 419

Query: 422 IMAEGDDLSRIKRIVDDLAKVIP 444
           +MAE          V  +  V+ 
Sbjct: 420 VMAEARTKELCDEYVTRIVNVVR 442


>gi|323481225|gb|ADX80664.1| phosphoglucosamine mutase [Enterococcus faecalis 62]
          Length = 451

 Score =  259 bits (662), Expect = 5e-67,   Method: Composition-based stats.
 Identities = 182/447 (40%), Positives = 270/447 (60%), Gaps = 8/447 (1%)

Query: 4   RFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGK---KKHRRVVIGKDTRLSGYMLEN 60
           ++FGTDG+RG +N   +TP    ++G   GY+        +  RV++G+DTR+SG MLE 
Sbjct: 3   KYFGTDGVRGIANK-ELTPELAFKLGRYGGYVLSQHEDSSRKPRVLVGRDTRISGEMLEQ 61

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +L+AG  + G++ F LG I +P VA LTR  +A  GVMISASHNP +DNGIK FG DG+K
Sbjct: 62  ALIAGLLSVGIEVFQLGVISTPGVAYLTRLQKASAGVMISASHNPAEDNGIKFFGADGFK 121

Query: 121 VSTDIEDRIETLLE-DDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRI 179
           +  D E  IE LL+ ++ T      + +G          +Y + + +++P    L  + +
Sbjct: 122 LVDDQEAEIEVLLDAEEDTLPRPSAEGLGSLDEFPEGLLKYSQFLVQSIPG--DLADMTV 179

Query: 180 VVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIG 239
            +D ANGA+      VF +L  D   +G  PNG+NIN   GST+  +L   V E  AD G
Sbjct: 180 CLDAANGATSTAVNRVFADLETDFYTMGTSPNGLNINDGVGSTHPEALAEMVVEKGADAG 239

Query: 240 IALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAG 299
           +A DGDGDR+I VDE G I++GD+IM + A+       L+ + IVTTVMSN+G  + +  
Sbjct: 240 LAFDGDGDRIIAVDELGRIIDGDKIMYICAKYLAEKKRLKKDTIVTTVMSNLGFHKAVEE 299

Query: 300 LGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYD 359
           +GL    T+VGDRY++E M+ N +N GGEQSGH+I  DY +TGDG+++ +Q+L  +KQ  
Sbjct: 300 IGLKDVVTQVGDRYVVEEMRKNDYNFGGEQSGHMIFLDYNTTGDGMLSGIQLLNVMKQTG 359

Query: 360 KPVSTICHCFEEYPQFLRSVSVKDTS-ILNSSSIVQAIADAESELRGIDRLIVRASGTES 418
           K +S +      YPQ L ++ V D +  +   +I   +  AE+E+ G  R++VR SGTE 
Sbjct: 360 KKLSELADEVTIYPQKLVNIRVTDKNGAMEVPAIKAVVEQAEAEMNGEGRILVRPSGTEP 419

Query: 419 LIRIMAEGDDLSRIKRIVDDLAKVIPM 445
           L+R+MAE     ++   VD +A+V+  
Sbjct: 420 LLRVMAEAPTQEKVDYYVDKIAEVVRA 446


>gi|119775378|ref|YP_928118.1| phosphoglucosamine mutase [Shewanella amazonensis SB2B]
 gi|158705790|sp|A1S7U2|GLMM2_SHEAM RecName: Full=Phosphoglucosamine mutase 2
 gi|119767878|gb|ABM00449.1| phosphoglucosamine mutase [Shewanella amazonensis SB2B]
          Length = 452

 Score =  259 bits (662), Expect = 6e-67,   Method: Composition-based stats.
 Identities = 199/451 (44%), Positives = 289/451 (64%), Gaps = 7/451 (1%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M R++FGTDG+RGK   FPITP+F M++G A G +       + V+IGKDTRLSGYMLE+
Sbjct: 1   MSRKYFGTDGVRGKVGEFPITPDFAMKLGWAAGTVMAA-SGTKEVIIGKDTRLSGYMLES 59

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           ++ AGF AAG++  + GP+P+PA+A LT + RAD GV+ISASHNPY DNGIK F   G K
Sbjct: 60  AMEAGFCAAGVNVALTGPLPTPAIAYLTSTFRADAGVVISASHNPYYDNGIKFFSNTGTK 119

Query: 121 VSTDIEDRIETLLEDDLTSYLSC---YDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGL 177
           ++ + E  IE LL   +          D +G  +R++    RYIE  K T P  ++L GL
Sbjct: 120 LTDEQELEIERLLVSAIEGGAMTCVASDKLGKVRRINDAAGRYIEFCKGTFPNSLSLTGL 179

Query: 178 RIVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRAD 237
           +IVVD A+GA+Y +A  V+ ELGA+V+ I DKP+GININ  CG+T++ SLQ  V    AD
Sbjct: 180 KIVVDSAHGAAYHIAKNVYRELGAEVISINDKPDGININEHCGATHMDSLQTAVMIHEAD 239

Query: 238 IGIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFI 297
           +GIALDGD DR+++VD KG +++GD ++ L+A+            I T  MSN+G E+ +
Sbjct: 240 LGIALDGDADRLMMVDSKGQVIDGDALLYLLAKSAQQRGEQVSGVIGTL-MSNLGFEQAL 298

Query: 298 AGLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQ 357
           A LG+  KR +VGDRY++E +K  G+ +GGE SGH+++ D+ +TGD +VA+LQVLR + +
Sbjct: 299 ANLGIPFKRAKVGDRYVVELLKETGWRLGGENSGHLLMLDFTTTGDAIVASLQVLRALLE 358

Query: 358 YDKPVSTICHCFEEYPQFLRSVSVKDTSI--LNSSSIVQAIADAESELRGIDRLIVRASG 415
               ++        +PQ L +V +   +   L+  S+  A+A AES L    R+++R SG
Sbjct: 359 SGAGLADAITELNMFPQVLINVRLNGNAAVGLSHPSVSDAVATAESALGNDGRVLLRKSG 418

Query: 416 TESLIRIMAEGDDLSRIKRIVDDLAKVIPMI 446
           TE LIR+M E  D  +  +  + +A  +  +
Sbjct: 419 TEPLIRVMVEAKDAVKANQYAELIADAVRAV 449


>gi|229551830|ref|ZP_04440555.1| phosphoglucosamine mutase [Lactobacillus rhamnosus LMS2-1]
 gi|258539231|ref|YP_003173730.1| phosphoglucosamine mutase [Lactobacillus rhamnosus Lc 705]
 gi|229314774|gb|EEN80747.1| phosphoglucosamine mutase [Lactobacillus rhamnosus LMS2-1]
 gi|257150907|emb|CAR89879.1| Phosphoglucosamine mutase [Lactobacillus rhamnosus Lc 705]
          Length = 454

 Score =  259 bits (662), Expect = 6e-67,   Method: Composition-based stats.
 Identities = 179/451 (39%), Positives = 268/451 (59%), Gaps = 10/451 (2%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRR----VVIGKDTRLSGY 56
           M + +FGTDG+RG +N   ++P    R+G   GY+    K+       V++ +DTR+SG 
Sbjct: 1   MTK-YFGTDGVRGIANK-ELSPEMAFRLGRTGGYVLTQHKEDASRRPLVLVARDTRISGQ 58

Query: 57  MLENSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGP 116
           ML ++L+AG  + G++   LG I +PAVA L +   AD G+ ISASHNP  DNGIK FG 
Sbjct: 59  MLADALIAGLLSVGIEVLDLGVITTPAVAYLIKIQGADAGIQISASHNPVADNGIKFFGA 118

Query: 117 DGYKVSTDIEDRIETLLEDDLTS-YLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQ 175
           DGYK+S + E+ IE LL+           + +G          +Y + +++TL     L 
Sbjct: 119 DGYKLSDETEEEIEALLDAPEDKLPRPAAEGLGTVDDYPEGALKYTQFLEQTLAD--DLS 176

Query: 176 GLRIVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVR 235
           G+ + +D ANGA+  +   +F +L  D   +   P+G+NIN D GST+  +L + V E  
Sbjct: 177 GIHVCLDGANGATSGLVSRIFADLETDFDTMATTPDGLNINADVGSTHPQALAKFVVEKG 236

Query: 236 ADIGIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLER 295
           AD+G+A DGDGDR I VDE+G IV+GD+IM ++     S   L+ + +VTTVMSN+GL +
Sbjct: 237 ADVGLAFDGDGDRCIAVDEEGNIVDGDKIMFILGNYMKSQGRLKQDTVVTTVMSNLGLYK 296

Query: 296 FIAGLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYI 355
            +   G+   +T VGDR+++E M+ +G+N+GGEQSGHIIL DY +TGDG++  + +L  +
Sbjct: 297 ALEANGMKSVQTAVGDRHVVEAMRKDGYNIGGEQSGHIILFDYHNTGDGMLTGIHLLNVM 356

Query: 356 KQYDKPVSTICHCFEEYPQFLRSVSVKDT-SILNSSSIVQAIADAESELRGIDRLIVRAS 414
           K+  K +S +    ++YPQ L +V V D  +      I  AI   E E+ G  R++VR S
Sbjct: 357 KKTGKKLSELAAPVKDYPQKLVNVKVADKENWQAYPEIQAAIDTVEKEMAGDGRVLVRPS 416

Query: 415 GTESLIRIMAEGDDLSRIKRIVDDLAKVIPM 445
           GTE L+R+MAE      + R VD +  V+  
Sbjct: 417 GTEPLLRVMAEAKTEDLVSRYVDQIVDVVKQ 447


>gi|199597318|ref|ZP_03210749.1| Phosphomannomutase [Lactobacillus rhamnosus HN001]
 gi|199591834|gb|EDY99909.1| Phosphomannomutase [Lactobacillus rhamnosus HN001]
          Length = 454

 Score =  259 bits (662), Expect = 6e-67,   Method: Composition-based stats.
 Identities = 179/451 (39%), Positives = 268/451 (59%), Gaps = 10/451 (2%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRR----VVIGKDTRLSGY 56
           M + +FGTDG+RG +N   ++P    R+G   GY+    K+       V++ +DTR+SG 
Sbjct: 1   MTK-YFGTDGVRGIANK-ELSPEMAFRLGRTGGYVLTQHKEDASRRPLVLVARDTRISGQ 58

Query: 57  MLENSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGP 116
           ML ++L+AG  + G++   LG I +PAVA L +   AD G+ ISASHNP  DNGIK FG 
Sbjct: 59  MLADALIAGLLSVGIEVLDLGVITTPAVAYLIKIQGADAGIQISASHNPVADNGIKFFGA 118

Query: 117 DGYKVSTDIEDRIETLLEDDLTS-YLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQ 175
           DGYK+S + E+ IE LL+           + +G          +Y + +++TL     L 
Sbjct: 119 DGYKLSDETEEEIEALLDAPEDKLPRPAAEGLGTVDDYPEGALKYTQFLEQTLAD--DLS 176

Query: 176 GLRIVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVR 235
           G+ + +D ANGA+  +   +F +L  D   +   P+G+NIN D GST+  +L + V E  
Sbjct: 177 GIHVCLDGANGATSGLVSRIFADLETDFDTMATTPDGLNINADVGSTHPQALAKFVVEKG 236

Query: 236 ADIGIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLER 295
           AD+G+A DGDGDR I VDE+G IV+GD+IM ++     S   L+ + +VTTVMSN+GL +
Sbjct: 237 ADVGLAFDGDGDRCIAVDEEGNIVDGDKIMFILGNYMKSQGRLKQDTVVTTVMSNLGLYK 296

Query: 296 FIAGLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYI 355
            +   G+   +T VGDR+++E M+ +G+N+GGEQSGHIIL DY +TGDG++  + +L  +
Sbjct: 297 ALEANGMKSVQTAVGDRHVVEAMRKDGYNIGGEQSGHIILFDYHNTGDGMLTGIHLLNVM 356

Query: 356 KQYDKPVSTICHCFEEYPQFLRSVSVKDT-SILNSSSIVQAIADAESELRGIDRLIVRAS 414
           K+  K +S +    ++YPQ L +V V D  +      I  AI   E E+ G  R++VR S
Sbjct: 357 KKTGKKLSELAAPVKDYPQKLVNVKVADKENWQAYPEIQAAIDTVEKEMAGDGRVLVRPS 416

Query: 415 GTESLIRIMAEGDDLSRIKRIVDDLAKVIPM 445
           GTE L+R+MAE      + R VD +  V+  
Sbjct: 417 GTEPLLRVMAEAKTEDLVSRYVDQIVDVVKQ 447


>gi|315161343|gb|EFU05360.1| phosphoglucosamine mutase [Enterococcus faecalis TX0645]
          Length = 451

 Score =  259 bits (662), Expect = 6e-67,   Method: Composition-based stats.
 Identities = 182/447 (40%), Positives = 270/447 (60%), Gaps = 8/447 (1%)

Query: 4   RFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGK---KKHRRVVIGKDTRLSGYMLEN 60
           ++FGTDG+RG +N   +TP    ++G   GY+        +  RV++G+DTR+SG MLE 
Sbjct: 3   KYFGTDGVRGIANK-ELTPELAFKLGRYGGYVLSQHEDSSRKPRVLVGRDTRISGEMLEQ 61

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +L+AG  + G++ F LG I +P VA LTR  +A  GVMISASHNP +DNGIK FG DG+K
Sbjct: 62  ALIAGLLSVGIEVFQLGVISTPGVAYLTRLQKASAGVMISASHNPAEDNGIKFFGADGFK 121

Query: 121 VSTDIEDRIETLLE-DDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRI 179
           +  D E  IE LL+ ++ T      + +G          +Y + + +++P    L  + +
Sbjct: 122 LVDDQEAEIEVLLDAEEDTLPRPSAEGLGSLDEFPEGLLKYSQFLVQSIPG--DLADMTV 179

Query: 180 VVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIG 239
            +D ANGA+      VF +L  D   +G  PNG+NIN   GST+  +L   V E  AD G
Sbjct: 180 CLDAANGATATAVNRVFADLETDFYTMGTSPNGLNINDGVGSTHPEALAEMVVEKGADAG 239

Query: 240 IALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAG 299
           +A DGDGDR+I VDE G I++GD+IM + A+       L+ + IVTTVMSN+G  + +  
Sbjct: 240 LAFDGDGDRIIAVDELGRIIDGDKIMYICAKYLAEKKRLKKDTIVTTVMSNLGFHKAVEE 299

Query: 300 LGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYD 359
           +GL    T+VGDRY++E M+ N +N GGEQSGH+I  DY +TGDG+++ +Q+L  +KQ  
Sbjct: 300 IGLKDVVTQVGDRYVVEEMRKNDYNFGGEQSGHMIFLDYNTTGDGMLSGIQLLNVMKQTG 359

Query: 360 KPVSTICHCFEEYPQFLRSVSVKDTS-ILNSSSIVQAIADAESELRGIDRLIVRASGTES 418
           K +S +      YPQ L ++ V D +  +   +I   +  AE+E+ G  R++VR SGTE 
Sbjct: 360 KKLSELADEVTIYPQKLVNIRVTDKNGAMEVPAIKAVVEQAEAEMNGEGRILVRPSGTEP 419

Query: 419 LIRIMAEGDDLSRIKRIVDDLAKVIPM 445
           L+R+MAE     ++   VD +A+V+  
Sbjct: 420 LLRVMAEAPTQEKVDYYVDKIAEVVRA 446


>gi|15599943|ref|NP_253437.1| phosphoglucosamine mutase [Pseudomonas aeruginosa PAO1]
 gi|116052896|ref|YP_793213.1| phosphoglucosamine mutase [Pseudomonas aeruginosa UCBPP-PA14]
 gi|296391576|ref|ZP_06881051.1| phosphoglucosamine mutase [Pseudomonas aeruginosa PAb1]
 gi|313109730|ref|ZP_07795670.1| phosphoglucosamine mutase [Pseudomonas aeruginosa 39016]
 gi|81622061|sp|Q9HV50|GLMM_PSEAE RecName: Full=Phosphoglucosamine mutase
 gi|122257093|sp|Q02FS3|GLMM_PSEAB RecName: Full=Phosphoglucosamine mutase
 gi|9951011|gb|AAG08135.1|AE004888_10 phosphoglucosamine mutase [Pseudomonas aeruginosa PAO1]
 gi|115588117|gb|ABJ14132.1| phosphoglucosamine mutase [Pseudomonas aeruginosa UCBPP-PA14]
 gi|310882172|gb|EFQ40766.1| phosphoglucosamine mutase [Pseudomonas aeruginosa 39016]
          Length = 445

 Score =  259 bits (662), Expect = 6e-67,   Method: Composition-based stats.
 Identities = 198/447 (44%), Positives = 288/447 (64%), Gaps = 5/447 (1%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M R++FGTDGIRG+   FPITP+F++++G AVG  FR +  + RV+IGKDTR SGYM E+
Sbjct: 1   MSRKYFGTDGIRGRVGEFPITPDFVLKLGWAVGMAFRRQG-NCRVLIGKDTRSSGYMFES 59

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +  AG +A+G D  +LGP+P+P +A LTR+  A+ GV+ISASHNP+ DNGIK F   G K
Sbjct: 60  AFEAGLSASGADTLLLGPMPTPGIAYLTRTFHAEAGVVISASHNPHDDNGIKFFSGQGTK 119

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +  D+E  IE LL+  +T  +     +G   R++    RYIE  K ++P      GL++V
Sbjct: 120 LPDDVELMIEELLDAPMT--VVESARLGKVSRINDAAGRYIEFCKSSVPTSTDFNGLKVV 177

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           +DCANGA+YK+AP VF ELGA+V V+   PNG+NIN  CGST++  LQ  V E  AD+GI
Sbjct: 178 LDCANGATYKIAPSVFRELGAEVTVLAASPNGLNINDKCGSTHLDGLQAAVVEHHADLGI 237

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           A DGDGDRV++VD  GA+V+GD+++ LIAR+      L+G  + T  MSN+GLE  +  L
Sbjct: 238 AFDGDGDRVMMVDHTGAVVDGDELLFLIARDLQESGRLQGGVVGTL-MSNLGLELALQEL 296

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
            +   R +VGDRY+M  +    + +GGE SGHI+     +TGD ++AALQVL  +K   +
Sbjct: 297 HIPFVRAKVGDRYVMAELLARNWMLGGENSGHIVCCQNTTTGDAIIAALQVLMALKHRGQ 356

Query: 361 PVSTICHCFEEYPQFLRSVSVK-DTSILNSSSIVQAIADAESELRGIDRLIVRASGTESL 419
            ++       + PQ L +V  K +   L   S+ +A      ++ G  R+++R SGTE L
Sbjct: 357 TLAEARQGIRKCPQVLINVRFKGENDPLEHPSVKEASVRVTEQMGGRGRVLLRKSGTEPL 416

Query: 420 IRIMAEGDDLSRIKRIVDDLAKVIPMI 446
           +R+M EGD+ + ++   + LAK++  +
Sbjct: 417 VRVMVEGDEEASVRAHAEQLAKIVSEV 443


>gi|170741256|ref|YP_001769911.1| phosphoglucosamine mutase [Methylobacterium sp. 4-46]
 gi|205830888|sp|B0ULF6|GLMM_METS4 RecName: Full=Phosphoglucosamine mutase
 gi|168195530|gb|ACA17477.1| phosphoglucosamine mutase [Methylobacterium sp. 4-46]
          Length = 446

 Score =  259 bits (662), Expect = 6e-67,   Method: Composition-based stats.
 Identities = 258/429 (60%), Positives = 328/429 (76%), Gaps = 1/429 (0%)

Query: 3   RRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSL 62
           R++FGTDGIRG++N   ITP   +++G A G LF+      RVVIGKDTRLSGYM+E +L
Sbjct: 2   RKYFGTDGIRGRAN-GVITPELALKVGQAAGLLFQRGDHRHRVVIGKDTRLSGYMIETAL 60

Query: 63  VAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVS 122
           VAGFT+ GMD  +LGP+P+PAVAMLTRS+RAD+GVMISASHNPY+DNGIKLFGPDG+K+S
Sbjct: 61  VAGFTSVGMDVLLLGPMPTPAVAMLTRSMRADIGVMISASHNPYEDNGIKLFGPDGFKLS 120

Query: 123 TDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVVD 182
            ++E  IE LL+ DL   LS    +G AKR++ VH RYIE  KRTLPR +TL+GLR+VVD
Sbjct: 121 DEVEHEIERLLDADLQKRLSGSADLGRAKRIESVHARYIEFAKRTLPRSITLEGLRVVVD 180

Query: 183 CANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIAL 242
           CANGA+Y+VAPE  WELGA+V+ IG +P+G NIN D GST   +L RKV E+RADIGIAL
Sbjct: 181 CANGAAYRVAPETLWELGAEVIAIGTEPDGFNINRDVGSTAPDALVRKVRELRADIGIAL 240

Query: 243 DGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLGL 302
           DGD DRV++VDEKG  V+GDQ+MA++AR W     L   GIV T+MSN+GLER++  LGL
Sbjct: 241 DGDADRVLVVDEKGQRVDGDQLMAVVARSWKEDQRLTQPGIVATIMSNLGLERYLGELGL 300

Query: 303 SLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKPV 362
            L RT VGDRY++EYM+ +G+N+GGEQSGHII+SDY +TGDGLVAALQ+L  +++  +PV
Sbjct: 301 GLVRTAVGDRYVLEYMREHGYNLGGEQSGHIIMSDYATTGDGLVAALQLLTVVQRQQRPV 360

Query: 363 STICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLIRI 422
           S +CHCF+  PQ L++V  +    L   S+V AI  A   L    RL++R SGTE +IR+
Sbjct: 361 SEVCHCFDPLPQVLKNVRYRAGEPLRQDSVVTAIEGARQRLGNAGRLVIRPSGTEPVIRV 420

Query: 423 MAEGDDLSR 431
           MAEGD+   
Sbjct: 421 MAEGDNRDL 429


>gi|73541856|ref|YP_296376.1| phosphoglucosamine mutase [Ralstonia eutropha JMP134]
 gi|84029253|sp|Q46ZA1|GLMM_RALEJ RecName: Full=Phosphoglucosamine mutase
 gi|72119269|gb|AAZ61532.1| phosphoglucosamine mutase [Ralstonia eutropha JMP134]
          Length = 447

 Score =  259 bits (662), Expect = 6e-67,   Method: Composition-based stats.
 Identities = 196/450 (43%), Positives = 285/450 (63%), Gaps = 8/450 (1%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGK----KKHRRVVIGKDTRLSGY 56
           M R++FGTDG+RGK    PITP+F+MR+G A G +        +    V+IGKDTR+SGY
Sbjct: 1   MTRKYFGTDGVRGKVGESPITPDFVMRLGHAAGKVLAHGASTGQGRPTVLIGKDTRISGY 60

Query: 57  MLENSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGP 116
           MLE +L AGFT+AG+   + GP+P+P +A LTR+LR   GV+ISASHNPY DNGIK F  
Sbjct: 61  MLEAALEAGFTSAGVHVLLTGPLPTPGIAYLTRALRLSAGVVISASHNPYYDNGIKFFSA 120

Query: 117 DGYKVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQG 176
           DG K+  ++E +IE  LE+ +T      D +G A+R++    RYIE  K T P    L+G
Sbjct: 121 DGDKLPDEVEAKIEAALEEPMTCAP--SDDLGRARRINDAPGRYIEFCKSTFPNSQDLRG 178

Query: 177 LRIVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRA 236
           L++VVDCA+GA+Y +AP VF ELGADV+ IG++P+G NIN   G+T    L   V E  A
Sbjct: 179 LKLVVDCAHGAAYHIAPHVFHELGADVIAIGNQPDGRNINDGYGATAPGKLIEAVREHGA 238

Query: 237 DIGIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERF 296
           D+G+A DGD DR+ +VD +G + NGD+++ LI R+ M+       G V T+M+N+ +E  
Sbjct: 239 DLGLAFDGDADRLQVVDSEGRLYNGDELLYLIVRDRMAA-GFAVEGAVGTLMTNMAVELA 297

Query: 297 IAGLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIK 356
           +  +G+   R +VGDRY++E +    + +GGE SGH++  D  STGDG+V+ALQVL  ++
Sbjct: 298 LKRIGVEFVRAKVGDRYVLEELNKRHWTLGGEGSGHLLCLDRHSTGDGIVSALQVLAALR 357

Query: 357 QYDKPVSTICHCFEEYPQFLRSVSVKDTSILNSSS-IVQAIADAESELRGIDRLIVRASG 415
           +  K ++ +      +PQ L +V V+      S + +  A A  E EL G  R+++RASG
Sbjct: 358 RSGKTLAGLLDGVSLFPQKLINVRVEKGFDWQSHAGLKAARAVVEPELAGRGRVLIRASG 417

Query: 416 TESLIRIMAEGDDLSRIKRIVDDLAKVIPM 445
           TE ++R+M E +     +R    LA+ +  
Sbjct: 418 TEPVVRVMVEAEHAETAERAAQTLAEALRA 447


>gi|254671658|emb|CBA09393.1| hypothetical. mrsA protein homolog [Neisseria meningitidis
           alpha153]
          Length = 444

 Score =  259 bits (661), Expect = 6e-67,   Method: Composition-based stats.
 Identities = 196/445 (44%), Positives = 290/445 (65%), Gaps = 6/445 (1%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKK--KHRRVVIGKDTRLSGYML 58
           M +++FGTDG+RG+   FPITP+F++++G A G +       +   V+IGKDTR+SGYML
Sbjct: 1   MAKKYFGTDGVRGEVGQFPITPDFVLKLGYAAGQVLVQHDTDQKPTVLIGKDTRISGYML 60

Query: 59  ENSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDG 118
           E +LVAGFTAAG++    GP+P+P VA LTR+LR   GVMISASHN Y DNGIK F   G
Sbjct: 61  EAALVAGFTAAGVNVVQTGPLPTPGVAYLTRALRLSAGVMISASHNAYSDNGIKFFAEGG 120

Query: 119 YKVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLR 178
            K+S ++E  IE  ++ ++ +       +G A+R++G  DRYIE  K T P    L+GL+
Sbjct: 121 VKLSDEVELEIEAKIDGEMKTQP--SARLGRARRINGADDRYIEFCKSTFPTHSDLRGLK 178

Query: 179 IVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADI 238
           +VVD ANGA+Y VAP+VF ELGA VV IGD+PNG NIN  CG+T   +LQ  V +  A+ 
Sbjct: 179 LVVDAANGAAYSVAPKVFHELGAQVVSIGDEPNGYNINEKCGATYTKTLQAAVLQHEANY 238

Query: 239 GIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIA 298
           GIALDGDGDR+++VD+ G + +GD ++ +IA+   +   +   G+V TVM+N+ +E  + 
Sbjct: 239 GIALDGDGDRLMMVDKNGKVYDGDSLIYVIAK-ARAREGINIGGVVGTVMTNMAMEIALK 297

Query: 299 GLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQY 358
             G+   R +VGDRY++E +   G+ VGGE SGHI+  D  +TGDG+++ALQVL  ++  
Sbjct: 298 EQGVDFCRAKVGDRYVLEQLNQRGWLVGGEASGHILCMDKHNTGDGIISALQVLAALQTL 357

Query: 359 DKPVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTES 418
           ++ ++ +C  ++ YPQ + +V +        +S    +A+ E EL G  R+++RASGTE 
Sbjct: 358 NQDLAAVCADWQPYPQTMINVRIGKGQNWQEAS-KDVLAEVEKELEGKGRVVLRASGTEP 416

Query: 419 LIRIMAEGDDLSRIKRIVDDLAKVI 443
           ++R+M E       +   + +A  I
Sbjct: 417 VVRVMVEARQADWAREGAERIAAAI 441


>gi|320527963|ref|ZP_08029129.1| phosphoglucosamine mutase [Solobacterium moorei F0204]
 gi|320131589|gb|EFW24153.1| phosphoglucosamine mutase [Solobacterium moorei F0204]
          Length = 445

 Score =  259 bits (661), Expect = 6e-67,   Method: Composition-based stats.
 Identities = 177/445 (39%), Positives = 269/445 (60%), Gaps = 6/445 (1%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M R +FGTDGIRGK+N   +T     ++G  +GY F  + K++ +VIGKDTRLS  M EN
Sbjct: 1   MGR-YFGTDGIRGKANEV-LTAERAFQVGRYLGYYFSKQGKNK-IVIGKDTRLSSDMFEN 57

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +L AG T+ G DA++ G  P+P + +LT+      G MISASHNP+ DNGIK+F  DG+K
Sbjct: 58  ALAAGITSEGCDAYLAGYCPTPMICLLTKENGFACGAMISASHNPFYDNGIKVFSNDGFK 117

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +S DIE  IE  ++  +T        IG         + Y++ + +  P  + L G +I 
Sbjct: 118 LSGDIEGLIEDYIDGKVTIPYRTDSEIGKVIAYPQGIEIYLDWIVKEYP--LDLSGWKIA 175

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           +DCANG+S   A +    LGA+V    ++PNGININ  CGST+      ++ +    +G+
Sbjct: 176 IDCANGSSSYTAKKALERLGAEVTAFHNEPNGININTKCGSTHPELFCEEMRKGNYTVGL 235

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
             DGD DR I+V   G +VNGD ++ ++ +     + L  N IVTTVM+N+GL + +   
Sbjct: 236 TFDGDADRQIMVRPDGELVNGDFMLYIVGKYLRDQNKLTNNTIVTTVMANLGLYKAMERE 295

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           G+ +++T+VGD+Y+ E M  + + +GGEQSGHIIL ++ +TGDGL+ AL VL  +K   K
Sbjct: 296 GIRVEKTQVGDKYVSEVMFRDNYVIGGEQSGHIILKEHATTGDGLLTALSVLEVMKNTGK 355

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTS-ILNSSSIVQAIADAESELRGIDRLIVRASGTESL 419
            +  +C   + YPQ L +V V D + +++   + ++I +   EL G  R++VR SGTE L
Sbjct: 356 SIIELCDGLKIYPQLLVNVKVTDKTLVMDDKEVQKSIDEVNEELNGNGRILVRPSGTEPL 415

Query: 420 IRIMAEGDDLSRIKRIVDDLAKVIP 444
           +R+MAE +     +R+V  +A +I 
Sbjct: 416 LRVMAEAETDKICERLVGKVADIIR 440


>gi|161870538|ref|YP_001599710.1| phosphoglucomutase/phosphomannomutase [Neisseria meningitidis
           053442]
 gi|189040789|sp|A9M1R2|GLMM_NEIM0 RecName: Full=Phosphoglucosamine mutase
 gi|161596091|gb|ABX73751.1| phosphoglucomutase/phosphomannomutase [Neisseria meningitidis
           053442]
          Length = 444

 Score =  259 bits (661), Expect = 6e-67,   Method: Composition-based stats.
 Identities = 196/445 (44%), Positives = 292/445 (65%), Gaps = 6/445 (1%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKK--KHRRVVIGKDTRLSGYML 58
           M +++FGTDG+RG+   FPITP+F++++G A G +       +   V+IGKDTR+SGYML
Sbjct: 1   MAKKYFGTDGVRGEVGQFPITPDFVLKLGYAAGQVLVQHDTDQKPTVLIGKDTRISGYML 60

Query: 59  ENSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDG 118
           E +LVAGFTAAG++    GP+P+P VA LTR+LR   GVMISASHN Y DNGIK F   G
Sbjct: 61  EAALVAGFTAAGVNVIQTGPLPTPGVAYLTRALRLSAGVMISASHNAYSDNGIKFFAEGG 120

Query: 119 YKVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLR 178
            K+S +IE  IE  +++++ +       +G A+R+ G  DRYIE  K T P    L+GL+
Sbjct: 121 VKLSDEIELEIEAKIDEEMKTQP--SARLGRARRISGADDRYIEFCKSTFPTHSDLRGLK 178

Query: 179 IVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADI 238
           +VVD ANGA+Y VAP+VF ELGA VV IGD+P+G NIN  CG+T+  +LQ  V +  AD 
Sbjct: 179 LVVDAANGAAYSVAPKVFHELGAQVVSIGDEPDGYNINEKCGATHTKTLQAAVLQNEADY 238

Query: 239 GIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIA 298
           GIALDGDGDR+++VD+ G + +GD ++ +IA+   +   +   G+V TVM+N+ +E  + 
Sbjct: 239 GIALDGDGDRLMMVDKNGKVYDGDSLIYVIAK-ARAREGINIGGVVGTVMTNMAMEIALK 297

Query: 299 GLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQY 358
             G+   R +VGDRY++E +    + +GGE SGHI+  D  +TGDG+++ALQVL  ++  
Sbjct: 298 EQGVDFCRAKVGDRYVLEQLNQRSWLIGGEASGHILCMDKHNTGDGIISALQVLAALQTL 357

Query: 359 DKPVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTES 418
           ++ ++T+C  ++ YPQ + +V ++       +S    +A+ E EL G  R+++RASGTE 
Sbjct: 358 NQDLATVCADWQPYPQTMINVRIQKGQKWQEAS-KDVLAEVEKELEGKGRVVLRASGTEP 416

Query: 419 LIRIMAEGDDLSRIKRIVDDLAKVI 443
           ++R+M E       +   + +A  I
Sbjct: 417 VVRVMVEARQADWARDGAERIASAI 441


>gi|152995053|ref|YP_001339888.1| phosphoglucosamine mutase [Marinomonas sp. MWYL1]
 gi|205830886|sp|A6VU24|GLMM_MARMS RecName: Full=Phosphoglucosamine mutase
 gi|150835977|gb|ABR69953.1| phosphoglucosamine mutase [Marinomonas sp. MWYL1]
          Length = 448

 Score =  259 bits (661), Expect = 6e-67,   Method: Composition-based stats.
 Identities = 204/445 (45%), Positives = 289/445 (64%), Gaps = 6/445 (1%)

Query: 3   RRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSL 62
           R++FGTDGIRGK  T PITP FM+++G A G +F+     ++++IGKDTR+SGYM E++L
Sbjct: 2   RKYFGTDGIRGKVGTTPITPEFMLKLGWAAGQVFKEN--DKKILIGKDTRISGYMFESAL 59

Query: 63  VAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVS 122
            +G  AAG D  ++GP+P+PA+A LTR+ RA  G++ISASHNPY DNGIK F  +G K+S
Sbjct: 60  ESGIVAAGADVRLVGPMPTPAIAYLTRTFRASAGIVISASHNPYTDNGIKFFSAEGGKIS 119

Query: 123 TDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVVD 182
            ++E+RIE  LE  +   +     IG AKR+D    RYIE+ K T P  + L GL+IVVD
Sbjct: 120 DELEERIEYFLEQPME--VVESSQIGRAKRIDDAAGRYIEYCKGTFPIGLQLSGLKIVVD 177

Query: 183 CANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIAL 242
           CA+GA+Y VAP VF ELGA+V+ IG  P+G+NIN   G+T    L++ V    AD+GIAL
Sbjct: 178 CADGATYHVAPRVFSELGAEVISIGVNPDGLNINEFSGATKPELLRKNVLAEEADLGIAL 237

Query: 243 DGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLGL 302
           DGDGDR+I+VD  G + +GD I+ +IA   M      G  + T  MSN GLE   +  G+
Sbjct: 238 DGDGDRLILVDRHGVVRDGDDILYIIANHLMRTGRFSGGVVGTL-MSNFGLELAFSETGI 296

Query: 303 SLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKPV 362
              R  VGDRY+ E +  +G+ +GGE SGHI+     +TGDG++AALQVLR + +  K +
Sbjct: 297 GFSRAAVGDRYVNEKLMQHGWVLGGEPSGHIVCRSITTTGDGIIAALQVLRAMVEEGKAL 356

Query: 363 STICHCFEEYPQFLRSVSVKDTSILNSSS-IVQAIADAESELRGIDRLIVRASGTESLIR 421
             +     ++PQ L+++ V    + N    + +AIA A   L G+ R+++RASGTE LIR
Sbjct: 357 DELLVGLVKFPQKLKNIRVAKRFVPNEEPTLQKAIAVANERLNGLGRVLLRASGTEPLIR 416

Query: 422 IMAEGDDLSRIKRIVDDLAKVIPMI 446
           +M EG D   +  +V+ L + +  +
Sbjct: 417 VMVEGRDNDTVDELVEYLVEEVNSV 441


>gi|161525191|ref|YP_001580203.1| phosphoglucosamine mutase [Burkholderia multivorans ATCC 17616]
 gi|189350070|ref|YP_001945698.1| phosphoglucosamine mutase [Burkholderia multivorans ATCC 17616]
 gi|226722718|sp|A9ACL5|GLMM_BURM1 RecName: Full=Phosphoglucosamine mutase
 gi|160342620|gb|ABX15706.1| phosphoglucosamine mutase [Burkholderia multivorans ATCC 17616]
 gi|189334092|dbj|BAG43162.1| phosphoglucosamine mutase [Burkholderia multivorans ATCC 17616]
          Length = 451

 Score =  259 bits (661), Expect = 6e-67,   Method: Composition-based stats.
 Identities = 202/454 (44%), Positives = 283/454 (62%), Gaps = 9/454 (1%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGK-----KKHRRVVIGKDTRLSG 55
           M RR+FGTDGIRG     PITP+F++R+G A G +  G           V+IGKDTR+SG
Sbjct: 1   MGRRYFGTDGIRGTVGDAPITPDFVLRLGYAAGKVLAGTADVAPGARPTVLIGKDTRVSG 60

Query: 56  YMLENSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFG 115
           YMLE +L AGF+AAG+D  + GP+P+P VA LTR+LR   GV+ISASHNPY DNGIK F 
Sbjct: 61  YMLEAALEAGFSAAGVDVMLAGPMPTPGVAYLTRALRLSAGVVISASHNPYPDNGIKFFS 120

Query: 116 PDGYKVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQ 175
            DG K+  D E  IE  L+  L       D +G A+R+D    RYIE  K T P    L+
Sbjct: 121 ADGNKLPDDTEAAIEAWLDKPLECAP--SDGLGKARRLDDAAGRYIEFCKSTFPAAFDLR 178

Query: 176 GLRIVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVR 235
           GL++VVDCA+GA+Y+VAP VF ELGADV+ IG  PNG NIN   G+T   +L R V   R
Sbjct: 179 GLKLVVDCAHGAAYQVAPHVFHELGADVIPIGVAPNGFNINDGVGATAPDALMRAVRANR 238

Query: 236 ADIGIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLER 295
           AD+GIALDGD DR+ IVD  G + NGD+++ ++ ++ ++        + T  M+N+ +E 
Sbjct: 239 ADLGIALDGDADRLQIVDASGRLYNGDELLYVLVQDRIATDGKVEGAVGTL-MTNLAVEV 297

Query: 296 FIAGLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYI 355
            +   G+   R  VGDRY++E ++ +G+ +G E SGHI+  D  STGDG+V+AL VL  +
Sbjct: 298 ALQRAGVQFVRAAVGDRYVLEKLREHGWQLGAEGSGHILSLDRHSTGDGIVSALLVLAAL 357

Query: 356 KQYDKPVSTICHCFEEYPQFLRSVSVKD-TSILNSSSIVQAIADAESELRGIDRLIVRAS 414
           K+  K ++ +      +PQ L +V +K      +S+SI  AI  AE+ L G  R+++RAS
Sbjct: 358 KRSGKTLAQMLDGVTLFPQKLINVRMKPGADWKDSASIRAAIETAEAALAGSGRVLIRAS 417

Query: 415 GTESLIRIMAEGDDLSRIKRIVDDLAKVIPMIDS 448
           GTE ++R+M E    +   R  + +A+ +    +
Sbjct: 418 GTEPVLRVMVEAQQAADATRHAEAIAEAVRAATA 451


>gi|332970633|gb|EGK09616.1| phosphoglucosamine mutase [Desmospora sp. 8437]
          Length = 451

 Score =  259 bits (661), Expect = 6e-67,   Method: Composition-based stats.
 Identities = 195/448 (43%), Positives = 285/448 (63%), Gaps = 10/448 (2%)

Query: 4   RFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKK-----KHRRVVIGKDTRLSGYML 58
            +FGTDGIRG +N   +TP    R+G A  Y+   +          VV+G+DTRLSG ML
Sbjct: 3   NYFGTDGIRGVANR-ELTPELAYRLGRAGAYVLTQQNRNEQEGKPLVVVGRDTRLSGEML 61

Query: 59  ENSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDG 118
           E++LVAG  + G+D   LG I +P VA LT+ ++A  GVMISASHNP++DNGIK FG DG
Sbjct: 62  ESALVAGMLSIGVDVARLGVITTPGVAWLTKEMKASAGVMISASHNPFEDNGIKFFGHDG 121

Query: 119 YKVSTDIEDRIETLLEDDLTSYLSCY-DSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGL 177
           +K+   +E+ IE LL+ D         + IG  +     +  Y++H++ T+     L G+
Sbjct: 122 FKLFDSLEEEIEALLDTDEDRLPRPVGEQIGRVEDRGDAYQLYLQHLRSTI--QTDLCGM 179

Query: 178 RIVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRAD 237
            IVVDCANGA+ ++AP +  +LGADV  +   P+G+NIN+DCGST+   L+++V    A 
Sbjct: 180 DIVVDCANGAASRLAPMLLRDLGADVTAMCADPDGVNINVDCGSTHPERLRQEVLHRNAH 239

Query: 238 IGIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFI 297
           +G+A DGD DR+I VDE+G +V+GDQI+ + A        L+ + +VTTVMSNIGL + +
Sbjct: 240 LGLAFDGDADRLIAVDEQGKLVDGDQILCICADFMKEQGELKEDTLVTTVMSNIGLYKAM 299

Query: 298 AGLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQ 357
             +G+  ++T+VGDRY+ME M+  GFN+GGEQSGHII  D+ +TGDG++ ALQ+LR +K+
Sbjct: 300 DSMGIRTEQTKVGDRYVMEKMRQGGFNLGGEQSGHIIFLDHNTTGDGMLTALQLLRVVKE 359

Query: 358 YDKPVSTICHCFEEYPQFLRSVSVKDTS-ILNSSSIVQAIADAESELRGIDRLIVRASGT 416
               ++ +      YPQ L +V V++      +  I+  I + E  L    R++VR SGT
Sbjct: 360 KATTLNQLAQTMTRYPQILVNVPVREKEHWDQNQEIMGKIREVEQALGKDGRVLVRPSGT 419

Query: 417 ESLIRIMAEGDDLSRIKRIVDDLAKVIP 444
           E LIR+MAEG D  +++  V+ +A VI 
Sbjct: 420 EPLIRVMAEGPDKQQLESYVNKIADVIR 447


>gi|148259828|ref|YP_001233955.1| phosphoglucosamine mutase [Acidiphilium cryptum JF-5]
 gi|326403244|ref|YP_004283325.1| phosphoglucosamine mutase [Acidiphilium multivorum AIU301]
 gi|172047766|sp|A5FWQ4|GLMM_ACICJ RecName: Full=Phosphoglucosamine mutase
 gi|146401509|gb|ABQ30036.1| phosphoglucosamine mutase [Acidiphilium cryptum JF-5]
 gi|325050105|dbj|BAJ80443.1| phosphoglucosamine mutase [Acidiphilium multivorum AIU301]
          Length = 456

 Score =  259 bits (661), Expect = 6e-67,   Method: Composition-based stats.
 Identities = 250/444 (56%), Positives = 326/444 (73%)

Query: 2   KRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENS 61
           KRR FGTDGIRG++NT P+T    +R+G A G LF       RV+IGKDTRLSGYMLE +
Sbjct: 9   KRRLFGTDGIRGRANTAPMTAEIALRLGQAAGLLFTRGDHRHRVIIGKDTRLSGYMLEPA 68

Query: 62  LVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKV 121
           L AGF  AGMD  + GP+P+PA+AMLTRSLRAD+GV+ISASHNP++DNGIKLFGPDG K+
Sbjct: 69  LTAGFIGAGMDVTLAGPLPTPAIAMLTRSLRADLGVVISASHNPFEDNGIKLFGPDGAKL 128

Query: 122 STDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVV 181
           S + E  IE L+E+DL+  L+   ++G A R+     RY+E  K +LPR + L GLR+V+
Sbjct: 129 SDETEAEIEALMEEDLSGRLAAPSALGRAMRLVDAAGRYVESAKSSLPRGLRLDGLRVVL 188

Query: 182 DCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIA 241
           DCANGA+YKVAP   WELGA+V+ +G  P+G NIN +CGST   +L   V + RAD+GIA
Sbjct: 189 DCANGAAYKVAPAALWELGAEVITLGVSPDGFNINHECGSTVPSALSAAVVKHRADLGIA 248

Query: 242 LDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLG 301
           LDGD DRVI+ DE+G I++GDQ++ALIAR + +   L G+GIV TVMSN+GLER++ GLG
Sbjct: 249 LDGDADRVILADERGRIIDGDQVLALIARAFQADGRLSGSGIVATVMSNLGLERYLGGLG 308

Query: 302 LSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKP 361
           L+L RT VGDRY+ E+M+ +G N+GGEQSGH+IL+D+ +TGDGL+AALQVL  + +  +P
Sbjct: 309 LALHRTPVGDRYVAEHMRAHGLNLGGEQSGHVILADFATTGDGLIAALQVLAVLVREGRP 368

Query: 362 VSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLIR 421
            S +C  F   PQ LR+V     S L S ++  A A AE+ L GI RL++RASGTE LIR
Sbjct: 369 ASEVCRLFTPLPQLLRNVRYSGASPLLSPAVTAAAAAAEARLAGIGRLLLRASGTEPLIR 428

Query: 422 IMAEGDDLSRIKRIVDDLAKVIPM 445
           +MAEG+D   +  +VD+L  VI  
Sbjct: 429 VMAEGEDEQLVAAVVDELCAVIEA 452


>gi|319778413|ref|YP_004129326.1| Phosphoglucosamine mutase [Taylorella equigenitalis MCE9]
 gi|317108437|gb|ADU91183.1| Phosphoglucosamine mutase [Taylorella equigenitalis MCE9]
          Length = 457

 Score =  259 bits (661), Expect = 7e-67,   Method: Composition-based stats.
 Identities = 193/453 (42%), Positives = 285/453 (62%), Gaps = 13/453 (2%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKH---RRVVIGKDTRLSGYM 57
           M R++FGTDG+RG+     I   F +R+G A G +   + K+     V+IGKDTR+SGYM
Sbjct: 1   MSRKYFGTDGVRGEVGGDTINAEFALRLGYAAGKVLTREHKNSNRPTVLIGKDTRVSGYM 60

Query: 58  LENSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPD 117
           LE++L AG +AAG+D  + GPIP+PAVA LT++ R D G++ISASHNPY DNGIK F  +
Sbjct: 61  LESALEAGLSAAGIDVLLAGPIPTPAVAYLTKAFRLDAGIVISASHNPYYDNGIKFFSGE 120

Query: 118 GYKVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGL 177
           G K+  ++E +IE L+++ L       D IG A+R+     RYIE  K T   D+ L+GL
Sbjct: 121 GTKLPDEVELQIENLIDEPL--GCVGSDDIGKARRISDASGRYIEFCKSTFAGDLNLRGL 178

Query: 178 RIVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRAD 237
           +IVVD A+GA+Y++A  VF ELGA+V+ IGD PNG NIN   G+    S+ ++V +  AD
Sbjct: 179 KIVVDAAHGAAYRIATPVFQELGAEVISIGDDPNGFNINDGMGALYPESIAQEVLKNNAD 238

Query: 238 IGIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVT-------TVMSN 290
            GIALDGD DR+++ D  G I NGDQ++  I ++ +S     G   +        T+M+N
Sbjct: 239 YGIALDGDADRIVMCDNDGTIYNGDQLLYAIVKDRLSRYERLGRNQLYALDGVVGTLMTN 298

Query: 291 IGLERFIAGLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQ 350
            GLE+ +  LG+ LKR++VGDRY+M+ + + G+ +GGE SGHI+  D  +TGDG+++ALQ
Sbjct: 299 YGLEKRLNELGIPLKRSKVGDRYVMQDLLDKGWKLGGESSGHILCLDQHTTGDGIISALQ 358

Query: 351 VLRYIKQYDKPVSTICHCFEEYPQFLRSVSV-KDTSILNSSSIVQAIADAESELRGIDRL 409
           VLR   + +  +         YPQ + SV   K  +  N   +V  + + +++L    R+
Sbjct: 359 VLRGTVRNNSSLKDWLSDLNMYPQAMISVPCEKGFNWENCRPLVAKVDEIKAQLGSRGRV 418

Query: 410 IVRASGTESLIRIMAEGDDLSRIKRIVDDLAKV 442
           ++R SGTE  +R+M E +D    +  VD+LA +
Sbjct: 419 LIRPSGTEPKLRLMVEAEDEKVAQSAVDELAAI 451


>gi|94264458|ref|ZP_01288246.1| Phosphoglucosamine mutase [delta proteobacterium MLMS-1]
 gi|93455089|gb|EAT05313.1| Phosphoglucosamine mutase [delta proteobacterium MLMS-1]
          Length = 453

 Score =  259 bits (661), Expect = 7e-67,   Method: Composition-based stats.
 Identities = 199/445 (44%), Positives = 295/445 (66%), Gaps = 2/445 (0%)

Query: 3   RRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSL 62
           RR FGTDGIRG +N +P+T    M++G  + ++ + + +  R+VIGKDTR+SGYM+EN+L
Sbjct: 2   RRLFGTDGIRGVANLYPMTTEIAMQVGRGIAFVVKRQGRRHRIVIGKDTRISGYMIENAL 61

Query: 63  VAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVS 122
            AG  + G+D  ++GP+P+P +A +T S+RAD GV+ISASHNP+ DNGIK+F  DGYK+ 
Sbjct: 62  AAGICSMGVDILLVGPLPTPGIAFITTSMRADAGVVISASHNPFPDNGIKIFAADGYKLP 121

Query: 123 TDIEDRIETLL-EDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVV 181
              E  IE L+    + S     + IG A R+D    RYI  +K T P + TL    IV+
Sbjct: 122 DAQELEIEELIFSQKMASLRPTAEEIGKASRIDDARGRYIVFLKNTFPAEYTLDDFHIVL 181

Query: 182 DCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIA 241
           DCA+GA+Y VAP VF ELGA V  +G +P+G NIN DCG+    ++  +V E+ AD+GIA
Sbjct: 182 DCAHGATYGVAPAVFAELGARVSCLGVEPDGTNINHDCGALQPQAMAARVRELGADLGIA 241

Query: 242 LDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLG 301
           LDGDGDR+++ DE G I++GDQ+MA+ A + +    L    +V TVMSNIGLE F+ GLG
Sbjct: 242 LDGDGDRLMVADETGQILDGDQVMAICAADLLKRKKLNKKTLVATVMSNIGLEHFMKGLG 301

Query: 302 LSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKP 361
             L+R++VGDRY++E M+  G+N GGEQSGH+I  D+ +TGDG++AAL++L  +   ++ 
Sbjct: 302 GRLERSQVGDRYVVEKMRAKGYNFGGEQSGHLIFLDHNTTGDGILAALRLLAVMIGENRR 361

Query: 362 VSTICHCFEEYPQFLRSVSVKDT-SILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
           +S +    +  PQ LR+V ++   ++     +   +   E+EL    R+++RASGTE L+
Sbjct: 362 LSELASRLQLLPQVLRNVRLEQPVAVKAIGGLKSLVKKLEAELGSDGRILIRASGTEPLL 421

Query: 421 RIMAEGDDLSRIKRIVDDLAKVIPM 445
           R+M EG    RI+ + +++ + I  
Sbjct: 422 RVMIEGPHRERIEAMAEEICQHIQQ 446


>gi|114321122|ref|YP_742805.1| phosphoglucosamine mutase [Alkalilimnicola ehrlichii MLHE-1]
 gi|122311299|sp|Q0A772|GLMM_ALHEH RecName: Full=Phosphoglucosamine mutase
 gi|114227516|gb|ABI57315.1| phosphoglucosamine mutase [Alkalilimnicola ehrlichii MLHE-1]
          Length = 451

 Score =  259 bits (661), Expect = 7e-67,   Method: Composition-based stats.
 Identities = 204/446 (45%), Positives = 295/446 (66%), Gaps = 5/446 (1%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           MK+ +FGTDGIRG     PITP+FM+ +G A G +   +     V++GKDTR+SGYMLE+
Sbjct: 1   MKKEYFGTDGIRGTVGEPPITPDFMLHLGWAAGRVL-ARAGQSSVLVGKDTRISGYMLES 59

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +L +GF AAG++  +LGP+P+PA+A LTR+LRA  GV+ISASHNP++DNGIK F  DG K
Sbjct: 60  ALESGFAAAGVNVKLLGPMPTPAIAYLTRTLRAAAGVVISASHNPHEDNGIKFFSDDGEK 119

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +    E  IE  L   L         +G A R++    RYIE  KR+ P +++L+GLR+V
Sbjct: 120 LDDATELAIEAELRQPLKPAP--SARLGKASRINDAPGRYIEFCKRSFPYELSLRGLRLV 177

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           VDCANGA+Y VAP VF ELGA+V+ + D P+G+NIN DCGS +   LQ  V E  AD GI
Sbjct: 178 VDCANGATYHVAPAVFHELGAEVIPLADDPDGLNINADCGSLHPKGLQAAVREHDADAGI 237

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           A DGDGDRVI+VD +G +V+GD ++ +IAR+ M++       +V TVMSN+GLE+ I  L
Sbjct: 238 AFDGDGDRVIMVDHRGEVVDGDGLLYIIARQRMAN-GGLAGPVVGTVMSNLGLEQGIGRL 296

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           GL   R +VGDRY+ME ++  G  +GGE SGH+I  D  +TGDG+V+ALQVL  +   ++
Sbjct: 297 GLPFLRAKVGDRYVMEMLRREGGILGGESSGHLICLDRTTTGDGIVSALQVLEAMAAQER 356

Query: 361 PVSTICHCFEEYPQFLRSVSV-KDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESL 419
            ++ +    +  PQ + +V + +   + + +++  A+ DAE+ L G  R+++R SGTE +
Sbjct: 357 TLAELADGMDRLPQIMVNVPISRGVPVQDHATVTDAVRDAETRLAGRGRVLLRPSGTEPV 416

Query: 420 IRIMAEGDDLSRIKRIVDDLAKVIPM 445
           +R+M EG D + +    + +A  +  
Sbjct: 417 LRVMVEGPDQAEVSATAEAIAGAVRE 442


>gi|297618285|ref|YP_003703444.1| phosphoglucosamine mutase [Syntrophothermus lipocalidus DSM 12680]
 gi|297146122|gb|ADI02879.1| phosphoglucosamine mutase [Syntrophothermus lipocalidus DSM 12680]
          Length = 448

 Score =  259 bits (661), Expect = 7e-67,   Method: Composition-based stats.
 Identities = 196/445 (44%), Positives = 276/445 (62%), Gaps = 4/445 (0%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M R  FGTDG+RG +N   +TP    ++G A  Y+   +  H R+++GKDTR+SG MLE 
Sbjct: 1   MGR-LFGTDGVRGVANE-DLTPELAYKLGRAGSYVLAQEFDHPRILVGKDTRISGDMLEA 58

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +L+AG  + G      G +P+PAVA LTR   A  GV+ISASHNP +DNGIK F  +GYK
Sbjct: 59  ALIAGILSTGASVLKAGIVPTPAVAYLTRRYEASSGVVISASHNPMEDNGIKFFSANGYK 118

Query: 121 VSTDIEDRIETLLEDDLTSYLSCY-DSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRI 179
           +  + EDRIE L++  +        D IG    V      YI+++K        L GL +
Sbjct: 119 LPDETEDRIEELVKKGVDDLARPVGDGIGRVYEVAEAETNYIDYLKSCYRAPRDLSGLCV 178

Query: 180 VVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIG 239
           VVDCANGA+Y VAP ++ ELGA V+ I + PNGININ  CGST    L+R V E +AD G
Sbjct: 179 VVDCANGAAYSVAPRLWEELGAKVISISNHPNGININDRCGSTYPEKLRRAVLEHKADFG 238

Query: 240 IALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAG 299
           +A DGD DRVI+VDE+G +++GD IM +    W     L  + +V TVMSNIGL+  +  
Sbjct: 239 VAYDGDADRVIVVDERGNVLDGDVIMVICGLHWQRTKRLVPSKVVATVMSNIGLDIALRR 298

Query: 300 LGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYD 359
             + ++  +VGDRY++E M   G  +GGEQSGHIIL DY +TGDGL++ L++   +++  
Sbjct: 299 EKVEVEYCQVGDRYVLEKMMETGARMGGEQSGHIILLDYATTGDGLLSGLKLAEVMRETG 358

Query: 360 KPVSTICHCFEEYPQFLRSVSVKDTS-ILNSSSIVQAIADAESELRGIDRLIVRASGTES 418
            P+S +    E  PQ L +V +KD   IL++ ++ + IA A+  L    +++VR SGTE 
Sbjct: 359 LPLSELALEMERLPQILVNVDLKDKEGILDNDNVKEVIAKADIRLGEWGKVLVRPSGTEP 418

Query: 419 LIRIMAEGDDLSRIKRIVDDLAKVI 443
            IRIMA+G D   +K +V+++ K I
Sbjct: 419 KIRIMAQGRDEFMLKEVVEEIRKAI 443


>gi|258646925|ref|ZP_05734394.1| phosphoglucosamine mutase [Dialister invisus DSM 15470]
 gi|260404365|gb|EEW97912.1| phosphoglucosamine mutase [Dialister invisus DSM 15470]
          Length = 447

 Score =  259 bits (661), Expect = 7e-67,   Method: Composition-based stats.
 Identities = 185/442 (41%), Positives = 274/442 (61%), Gaps = 4/442 (0%)

Query: 5   FFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSLVA 64
            FGTDG+RG  N+  + P    ++G A G  F  ++   RV+IG DTR+SG M+  +L A
Sbjct: 4   LFGTDGVRGVVNSTLM-PELAFQLGRAAGAYFCREEGTHRVLIGMDTRISGTMVAAALSA 62

Query: 65  GFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVSTD 124
           G  A+G++  + G IP+P +A LTR+   D GV+ISASHNP+ DNGIK F  +G+K+   
Sbjct: 63  GLCASGVNVDLAGVIPTPGIAYLTRTENYDAGVVISASHNPFPDNGIKFFDRNGHKLPDQ 122

Query: 125 IEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVVDCA 184
            E+ IE +L  D        + +G  +  + +  +Y  ++  T+      +G++IV D A
Sbjct: 123 AEEEIENILRHDEELARPTGEKVGFIRHRNELAWKYKNYILSTVKG--DFKGMKIVTDSA 180

Query: 185 NGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIALDG 244
           NGA+    P++  ELGA++  +  +PNG+NIN DCGST++ +LQ+ V E+ AD GIA DG
Sbjct: 181 NGAASGFLPDILRELGAEITALYCEPNGVNINKDCGSTHMETLQKMVVEMGADCGIANDG 240

Query: 245 DGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLGLSL 304
           D DR + VDE+G I++GD IM + A        L  N +V TVMSN+G  + +A  G   
Sbjct: 241 DADRCLFVDEQGDIMDGDHIMVINALRMKKEGRLNANMVVGTVMSNLGFGKALAEHGCRT 300

Query: 305 KRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKPVST 364
             T VGDRY++E MK +G+++GGEQSGHII  ++ +TGDGL+ A+Q L  ++ +D P+S 
Sbjct: 301 VATNVGDRYVLEEMKAHGYSLGGEQSGHIIFPEFNTTGDGLITAMQTLMVLRDHDGPLSE 360

Query: 365 ICHCFEEYPQFLRSVSVKDTS-ILNSSSIVQAIADAESELRGIDRLIVRASGTESLIRIM 423
           + H    YPQ L++V V   +    +  I  AIA A+ EL    R++VRASGTE LIR+M
Sbjct: 361 LNHLMTTYPQLLKNVKVYSKNGWEENEQIRAAIAAAKDELGNDGRILVRASGTEPLIRVM 420

Query: 424 AEGDDLSRIKRIVDDLAKVIPM 445
            EG D  R++R++DD+  V+  
Sbjct: 421 GEGSDKDRLERVIDDIVSVVEQ 442


>gi|300113262|ref|YP_003759837.1| phosphoglucosamine mutase [Nitrosococcus watsonii C-113]
 gi|299539199|gb|ADJ27516.1| phosphoglucosamine mutase [Nitrosococcus watsonii C-113]
          Length = 451

 Score =  259 bits (661), Expect = 7e-67,   Method: Composition-based stats.
 Identities = 215/445 (48%), Positives = 305/445 (68%), Gaps = 5/445 (1%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M++++FGTDGIRG+   +PITP+F++ +G AVG +   + +  +V+IGKDTR+SGYM E+
Sbjct: 1   MEKKYFGTDGIRGQVGEYPITPDFILHLGWAVGRVL-ARGRQSKVLIGKDTRISGYMFES 59

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +L AG +AAG+D  +LGP+P+PA+A LTR+L A  G++ISASHNPY DNGIK F   G K
Sbjct: 60  ALQAGLSAAGVDIRLLGPMPTPAIAYLTRTLHAKAGIVISASHNPYYDNGIKFFSSAGTK 119

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +  +IE  IE  LE  + + +     +G A+RV     RYIE  K T P  V L GLR+V
Sbjct: 120 LPDEIEVAIEAELEKPMQTTV--SSCLGKAERVVDAAGRYIEFCKSTGPASVDLSGLRLV 177

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           VDCA+GA+Y+VAPEVF E+GAD+ VIG  P+G+NIN +CGST + SLQ KV E  AD GI
Sbjct: 178 VDCAHGATYQVAPEVFAEMGADITVIGVSPDGLNINENCGSTALESLQHKVLECNADAGI 237

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           ALDGDGDRVI++D +G IV+GD I+ +IAR     S L G  + T  MSN+GLE+ +A L
Sbjct: 238 ALDGDGDRVIMIDHRGEIVDGDDILYIIARARQRTSKLMGAVVGTL-MSNLGLEKALAAL 296

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           G+ L R++VGDRY++E ++ NG+++GGE SGHII  D  +TGDG+V+ALQVL  +     
Sbjct: 297 GIPLMRSQVGDRYVLEMLQCNGYSLGGESSGHIICLDRTTTGDGIVSALQVLVEMVAMGH 356

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTSIL-NSSSIVQAIADAESELRGIDRLIVRASGTESL 419
            +  +     +YPQ L +V V       N+++I+ A+   E++L    R+++R SGTE +
Sbjct: 357 SLYELKSGVVKYPQCLINVQVARAINFSNNNAIISAVQAIENQLGDEGRVLLRPSGTEPV 416

Query: 420 IRIMAEGDDLSRIKRIVDDLAKVIP 444
           +R+M EG D S++  +   LA+ + 
Sbjct: 417 VRVMVEGRDTSQVNTLAQQLAQEVA 441


>gi|224477148|ref|YP_002634754.1| phosphoglucosamine mutase [Staphylococcus carnosus subsp. carnosus
           TM300]
 gi|254798593|sp|B9DM98|GLMM_STACT RecName: Full=Phosphoglucosamine mutase
 gi|222421755|emb|CAL28569.1| phosphoglucosamine-mutase [Staphylococcus carnosus subsp. carnosus
           TM300]
          Length = 451

 Score =  259 bits (661), Expect = 7e-67,   Method: Composition-based stats.
 Identities = 186/446 (41%), Positives = 279/446 (62%), Gaps = 7/446 (1%)

Query: 4   RFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFR--GKKKHRRVVIGKDTRLSGYMLENS 61
           ++FGTDG+RG +N   +TP    ++G   GY+      KKH +V++G+DTR+SG MLE++
Sbjct: 3   KYFGTDGVRGVANK-ELTPELAFKLGRYGGYVLAHNEDKKHPQVLVGRDTRVSGEMLESA 61

Query: 62  LVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKV 121
           L+AG  + G +   LG I +P VA LT+ + A++GVMISASHNP  DNGIK FG DG+K+
Sbjct: 62  LIAGLISIGAEVMRLGVISTPGVAYLTKEMDAELGVMISASHNPVADNGIKFFGSDGFKL 121

Query: 122 STDIEDRIETLLEDDLTSYLSCY-DSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           S D E+ IE LL+++         + I H         +Y+ ++K T+   V L GL+I 
Sbjct: 122 SDDQENEIEALLDEENPDLPRPVGNEIVHYSDYFEGAQKYLSYIKSTID--VNLDGLKIA 179

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           +D ANG++ ++AP +F +L AD  VIG  P+G NIN   GST+  +L + V E  +D G+
Sbjct: 180 LDGANGSTSQLAPFLFGDLEADTEVIGCSPDGYNINEGVGSTHPEALAKTVVETESDFGL 239

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           A DGDGDR+I VDEKG IV+GDQIM +I +E   +  L  N IV+TVMSN+G  + +   
Sbjct: 240 AFDGDGDRLIAVDEKGNIVDGDQIMFIIGQEMAKNQELNDNMIVSTVMSNLGFYKALEAE 299

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           G+   +T+VGDRY++E M+   +N+GGEQSGHI+L DY +TGDGL+  +Q+   +K   K
Sbjct: 300 GIKSNKTKVGDRYVVEEMRKGNYNLGGEQSGHIVLMDYNTTGDGLLTGVQLAAVVKLTGK 359

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTS-ILNSSSIVQAIADAESELRGIDRLIVRASGTESL 419
            +S +    ++YPQ L +V V D   + ++  +   +   E+++ G  R++VR SGTE L
Sbjct: 360 SLSELAEQMKKYPQSLINVRVTDKHGVTDNEDVKAEMDRVEADMNGEGRILVRPSGTEPL 419

Query: 420 IRIMAEGDDLSRIKRIVDDLAKVIPM 445
           +R+M E     + +     +A V+  
Sbjct: 420 VRVMVEAATDEKAQSYAQQIADVVEE 445


>gi|262380522|ref|ZP_06073676.1| phosphoglucosamine mutase [Acinetobacter radioresistens SH164]
 gi|262297968|gb|EEY85883.1| phosphoglucosamine mutase [Acinetobacter radioresistens SH164]
          Length = 448

 Score =  259 bits (661), Expect = 7e-67,   Method: Composition-based stats.
 Identities = 186/445 (41%), Positives = 279/445 (62%), Gaps = 9/445 (2%)

Query: 4   RFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRR--VVIGKDTRLSGYMLENS 61
            +FGTDGIRGK    PITP F +++G A G + +      +  VV+GKDTRLSGY+LE++
Sbjct: 2   SYFGTDGIRGKFGELPITPEFALKLGFAAGKVLKRINPSDKTLVVLGKDTRLSGYILESA 61

Query: 62  LVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKV 121
           L AG  AAG+   +LGP+P+PA+A LTR+L A  G++ISASHNPY DNGIK F   G K+
Sbjct: 62  LQAGLNAAGVYVHLLGPLPTPAIAHLTRALHAHAGIVISASHNPYFDNGIKFFSSQGKKL 121

Query: 122 STDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVV 181
             ++++ I   LE ++   +    ++G + RV     RYIE  K T P    L+GL+IVV
Sbjct: 122 PDELQEAINAELEKEI--RIEDTANLGKSVRVKDAAGRYIEFCKSTFPYHHDLRGLKIVV 179

Query: 182 DCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIA 241
           DCANGA+Y V P VF ELGA V+ + ++P+G+NIN  CGST+  +LQ+ V +  AD+GIA
Sbjct: 180 DCANGAAYNVGPAVFRELGAKVIALYNEPDGLNINEQCGSTHPENLQKAVIQSHADLGIA 239

Query: 242 LDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLG 301
            DGD DRV++VD+ G +++G+ I+ ++A +           +    MSN+ LE  +   G
Sbjct: 240 FDGDADRVVMVDKAGNLIDGNHILYILATQTSQKPAGIAGTL----MSNLSLELALKKAG 295

Query: 302 LSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKP 361
           +   R +VGDRY+++ ++ NG+  GGE SGHI+  D  +TGD ++AALQVL  + +  K 
Sbjct: 296 VDFVRAKVGDRYVLQALEENGWMTGGEPSGHILTLDKSTTGDAIIAALQVLTVMVEQGKA 355

Query: 362 VSTICHCFEEYPQFLRSVSVKDT-SILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
           +  +   FE +PQ L ++ ++      +  ++V     AE++L G  RL++R SGTE +I
Sbjct: 356 LDELVADFELFPQELINIRLEKMIDPYSIPALVAEFEKAEAQLEGRGRLLIRKSGTEPVI 415

Query: 421 RIMAEGDDLSRIKRIVDDLAKVIPM 445
           R+M EG++   +K +   LA  +  
Sbjct: 416 RVMVEGENEQEVKALAQHLANAVKN 440


>gi|218768710|ref|YP_002343222.1| putative phosphoglucomutase/phosphomannomutase [Neisseria
           meningitidis Z2491]
 gi|81542516|sp|Q9JT71|GLMM_NEIMA RecName: Full=Phosphoglucosamine mutase
 gi|121052718|emb|CAM09061.1| putative phosphoglucomutase/phosphomannomutase [Neisseria
           meningitidis Z2491]
          Length = 444

 Score =  259 bits (661), Expect = 7e-67,   Method: Composition-based stats.
 Identities = 196/445 (44%), Positives = 290/445 (65%), Gaps = 6/445 (1%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKK--KHRRVVIGKDTRLSGYML 58
           M +++FGTDG+RG+   FPITP+F++++G A G +       +   V+IGKDTR+SGYML
Sbjct: 1   MAKKYFGTDGVRGEVGQFPITPDFVLKLGYAAGQVLVQHDTDQKPTVLIGKDTRISGYML 60

Query: 59  ENSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDG 118
           E +LVAGFTAAG++    GP+P+P VA LTR+LR   GVMISASHN Y DNGIK F   G
Sbjct: 61  EAALVAGFTAAGVNVVQTGPLPTPGVAYLTRALRLSAGVMISASHNAYSDNGIKFFAEGG 120

Query: 119 YKVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLR 178
            K+S +IE  IE  +++++ +       +G A+R+ G  DRYIE  K T P    L+GL+
Sbjct: 121 VKLSDEIELEIEAKIDEEMKTQP--SARLGRARRISGADDRYIEFCKSTFPSHSDLRGLK 178

Query: 179 IVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADI 238
           +V+D ANGA Y VAP+VF ELGA VV IGD+PNG NIN  CG+T   +LQ  V +  AD 
Sbjct: 179 LVIDTANGAGYGVAPKVFHELGAQVVSIGDEPNGYNINEKCGATYTKTLQAAVLQHEADY 238

Query: 239 GIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIA 298
           GIALDGDGDR+++VD+ G + +GD ++ +IA+   +   +   G+V TVM+N+ +E  + 
Sbjct: 239 GIALDGDGDRLMMVDKNGKVYDGDSLIYVIAK-ARAREGINIGGVVGTVMTNMAMEIALK 297

Query: 299 GLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQY 358
             G+   R +VGDRY++E +    + +GGE SGHI+  D  +TGDG+++ALQVL  ++  
Sbjct: 298 EQGVDFCRAKVGDRYVLEQLNQRSWLIGGEASGHILCMDKHNTGDGIISALQVLAALQTL 357

Query: 359 DKPVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTES 418
           ++ ++T+C  ++ YPQ + +V ++       +S    +A+ E EL G  R+++RASGTE 
Sbjct: 358 NQDLATVCADWQPYPQTMINVRIQKGQKWQEAS-KDVLAEVEKELEGKGRVVLRASGTEP 416

Query: 419 LIRIMAEGDDLSRIKRIVDDLAKVI 443
           ++R+M E       +   + +A  I
Sbjct: 417 VVRVMVEARQADWARDGAERIASAI 441


>gi|218893844|ref|YP_002442713.1| phosphoglucosamine mutase [Pseudomonas aeruginosa LESB58]
 gi|254238515|ref|ZP_04931838.1| phosphoglucosamine mutase [Pseudomonas aeruginosa C3719]
 gi|254244349|ref|ZP_04937671.1| phosphoglucosamine mutase [Pseudomonas aeruginosa 2192]
 gi|226723905|sp|B7V1G1|GLMM_PSEA8 RecName: Full=Phosphoglucosamine mutase
 gi|126170446|gb|EAZ55957.1| phosphoglucosamine mutase [Pseudomonas aeruginosa C3719]
 gi|126197727|gb|EAZ61790.1| phosphoglucosamine mutase [Pseudomonas aeruginosa 2192]
 gi|218774072|emb|CAW29888.1| phosphoglucosamine mutase [Pseudomonas aeruginosa LESB58]
          Length = 445

 Score =  259 bits (661), Expect = 7e-67,   Method: Composition-based stats.
 Identities = 198/447 (44%), Positives = 289/447 (64%), Gaps = 5/447 (1%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M R++FGTDGIRG+   FPITP+F++++G AVG  FR +  + RV+IGKDTR SGYM E+
Sbjct: 1   MSRKYFGTDGIRGRVGEFPITPDFVLKLGWAVGMAFRRQG-NCRVLIGKDTRSSGYMFES 59

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +  AG +A+G D  +LGP+P+P +A LTR+  A+ GV+ISASHNP+ DNGIK F   G K
Sbjct: 60  AFEAGLSASGADTLLLGPMPTPGIAYLTRTFHAEAGVVISASHNPHDDNGIKFFSGQGTK 119

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +  D+E  IE LL+  +T  +     +G   R++    RYIE  K ++P      GL++V
Sbjct: 120 LPDDVELMIEELLDAPMT--VVESARLGKVSRINDAAGRYIEFCKSSVPTSTDFNGLKVV 177

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           +DCANGA+YK+AP VF ELGA+V V+   PNG+NIN  CGST++  LQ  V E  AD+GI
Sbjct: 178 LDCANGATYKIAPSVFRELGAEVTVLAASPNGLNINDKCGSTHLDGLQAAVVEHHADLGI 237

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           A DGDGDRV++VD  GA+V+GD+++ LIAR+      L+G  + T  MSN+GLE  +  L
Sbjct: 238 AFDGDGDRVMMVDHTGAVVDGDELLFLIARDLQESGRLQGGVVGTL-MSNLGLELALQEL 296

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
            +   R +VGDRY+M  +    + +GGE SGHI+     +TGD ++AALQVL  +K   +
Sbjct: 297 HIPFVRAKVGDRYVMAELLARNWMLGGENSGHIVCCQNTTTGDAIIAALQVLMALKHRGQ 356

Query: 361 PVSTICHCFEEYPQFLRSVSVK-DTSILNSSSIVQAIADAESELRGIDRLIVRASGTESL 419
            ++       + PQ L +V  K ++  L   S+ +A      ++ G  R+++R SGTE L
Sbjct: 357 TLAEARQGIRKCPQVLINVRFKGESDPLEHPSVKEASVRVTEQMGGRGRVLLRKSGTEPL 416

Query: 420 IRIMAEGDDLSRIKRIVDDLAKVIPMI 446
           +R+M EGD+ + ++   + LAK++  +
Sbjct: 417 VRVMVEGDEEASVRAHAEQLAKIVSEV 443


>gi|254487295|ref|ZP_05100500.1| phosphoglucosamine mutase [Roseobacter sp. GAI101]
 gi|214044164|gb|EEB84802.1| phosphoglucosamine mutase [Roseobacter sp. GAI101]
          Length = 448

 Score =  259 bits (661), Expect = 8e-67,   Method: Composition-based stats.
 Identities = 226/447 (50%), Positives = 310/447 (69%), Gaps = 5/447 (1%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLF-RGKKKHRRVVIGKDTRLSGYMLE 59
           M +  FGTDG+RG++N +P+T    +RIG AVG  F + +    RVVIGKDTRLSGYM E
Sbjct: 1   MTK-LFGTDGVRGQANIYPMTAENALRIGAAVGRYFGQSRSGVHRVVIGKDTRLSGYMFE 59

Query: 60  NSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGY 119
           ++L AG T+ GM+  +LGP+P+PAV +LTRS+RAD+GVMISASHNP  DNGIK FGPDG+
Sbjct: 60  SALTAGLTSTGMNVLLLGPVPTPAVGLLTRSMRADLGVMISASHNPATDNGIKFFGPDGF 119

Query: 120 KVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRI 179
           K+S  +E  IE L+++ +   L+  D IG AKR+D    RY+E VK + PR ++L GL++
Sbjct: 120 KLSDQVEAEIEALVDNGVD--LNAADQIGRAKRIDDGRFRYVERVKSSFPRQMSLDGLKV 177

Query: 180 VVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIG 239
           VVDCANGA+Y+VAPE  WELGA+VV +G KPNG NIN +CGST+       V    AD+G
Sbjct: 178 VVDCANGAAYRVAPETLWELGAEVVEVGVKPNGHNINQNCGSTHPEMAAAAVVSHGADLG 237

Query: 240 IALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAG 299
           I LDGD DRVI++DE G + +GDQ MAL+   W +   L  N +V TVMSN+GLE F+ G
Sbjct: 238 ICLDGDADRVILIDETGKVGDGDQFMALMGSRWAAEGRLANNALVATVMSNLGLEHFLQG 297

Query: 300 LGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYD 359
            G++L+RT VGDRY++E M+  GFN+GGEQSGHI+++D+ +TGDGL+A LQ L  + +  
Sbjct: 298 HGVNLERTAVGDRYVVERMREGGFNLGGEQSGHIVMTDHATTGDGLMAGLQFLAEVVRSG 357

Query: 360 KPVSTICHCFEEYPQFLRSVSVK-DTSILNSSSIVQAIADAESELRGIDRLIVRASGTES 418
           K  S + + F+  PQ L +V        L  + +  AIA AE++L G  RL++R SGTE 
Sbjct: 358 KKASELLNNFDPVPQLLMNVRFSAGQVPLEDAHVQAAIAQAEADLAGKGRLLIRKSGTEP 417

Query: 419 LIRIMAEGDDLSRIKRIVDDLAKVIPM 445
           L+R+MAE +D + + + V+ +   +  
Sbjct: 418 LVRVMAEHEDAALMAQAVNSVVDAVTQ 444


>gi|255320016|ref|ZP_05361212.1| phosphoglucosamine mutase [Acinetobacter radioresistens SK82]
 gi|255302884|gb|EET82105.1| phosphoglucosamine mutase [Acinetobacter radioresistens SK82]
          Length = 448

 Score =  259 bits (660), Expect = 8e-67,   Method: Composition-based stats.
 Identities = 187/445 (42%), Positives = 279/445 (62%), Gaps = 9/445 (2%)

Query: 4   RFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRR--VVIGKDTRLSGYMLENS 61
            +FGTDGIRGK    PITP F +++G A G + +      +  VV+GKDTRLSGY+LE++
Sbjct: 2   SYFGTDGIRGKFGELPITPEFALKLGFAAGKVLKRINPSDKTLVVLGKDTRLSGYILESA 61

Query: 62  LVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKV 121
           L AG  AAG+   +LGP+P+PA+A LTR+L A  G++ISASHNPY DNGIK F   G K+
Sbjct: 62  LQAGLNAAGVYVHLLGPLPTPAIAHLTRALHAHAGIVISASHNPYFDNGIKFFSSQGKKL 121

Query: 122 STDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVV 181
             ++++ I   LE ++   +    ++G + RV     RYIE  K T P    L+GL+IVV
Sbjct: 122 PDELQEAINAELEKEI--RIEDTANLGKSVRVKDAAGRYIEFCKSTFPYHHDLRGLKIVV 179

Query: 182 DCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIA 241
           DCANGA+Y V P VF ELGA V+ + ++P+G+NIN  CGST+  +LQ+ V +  AD+GIA
Sbjct: 180 DCANGAAYNVGPAVFRELGAKVIALYNEPDGLNINEQCGSTHPENLQKAVIQSHADLGIA 239

Query: 242 LDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLG 301
            DGD DRV++VD+ G +++GD I+ ++A +           +    MSN+ LE  +   G
Sbjct: 240 FDGDADRVVMVDKAGNLIDGDHILYILATQTSQKPAGIAGTL----MSNLSLELALKKAG 295

Query: 302 LSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKP 361
           +   R +VGDRY+++ ++ NG+  GGE SGHI+  D  +TGD ++AALQVL  + +  K 
Sbjct: 296 VDFVRAKVGDRYVLQALEENGWMTGGEPSGHILTLDKSTTGDAIIAALQVLTVMVEQGKA 355

Query: 362 VSTICHCFEEYPQFLRSVSVKDT-SILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
           +  +   FE +PQ L ++ ++      +  ++V     AE++L G  RL++R SGTE +I
Sbjct: 356 LDELVADFELFPQELINIRLEKMIDPYSIPALVAEFEKAEAQLEGRGRLLIRKSGTEPVI 415

Query: 421 RIMAEGDDLSRIKRIVDDLAKVIPM 445
           R+M EG++   +K +   LA  +  
Sbjct: 416 RVMVEGENEQEVKALAQHLANAVKN 440


>gi|296131919|ref|YP_003639166.1| phosphoglucosamine mutase [Thermincola sp. JR]
 gi|296030497|gb|ADG81265.1| phosphoglucosamine mutase [Thermincola potens JR]
          Length = 449

 Score =  259 bits (660), Expect = 8e-67,   Method: Composition-based stats.
 Identities = 194/447 (43%), Positives = 288/447 (64%), Gaps = 8/447 (1%)

Query: 5   FFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFR---GKKKHRRVVIGKDTRLSGYMLENS 61
           +FGTDG+RG +N   +TP     +G A  ++       K+  ++VIGKDTR+SG MLE +
Sbjct: 4   YFGTDGVRGVANA-QLTPQLAYELGKAGAFVLARDCEGKEKPKIVIGKDTRISGDMLEAA 62

Query: 62  LVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKV 121
           L+AG  + G+D F +G +P+PA+A LTR L A  GV+ISASHNP +DNGIK F   GYK+
Sbjct: 63  LIAGICSVGVDVFKVGIMPTPAIAFLTRDLGAAAGVVISASHNPVEDNGIKFFSATGYKL 122

Query: 122 STDIEDRIETLLEDDLTSYLSCYD-SIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
             ++EDRIE LL+  L +  +     +G    +    DRY+  VK+ +P  V L+GL++V
Sbjct: 123 PDEVEDRIEELLKSGLDNIPTPVGPEVGRVYDIHDAEDRYVNFVKKRVP--VDLRGLKMV 180

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           +DCANGA+Y+V+P +F ELGA+V+ I + P+GININ  CGST+   L ++V   +AD+G+
Sbjct: 181 IDCANGAAYRVSPRIFRELGAEVIPIFNHPDGININYHCGSTHPEELSKRVVLEKADLGL 240

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           A DGD DRVI VDEKG I++GD +M + ++     + L  N +V TVMSN+GL   +   
Sbjct: 241 AHDGDADRVIAVDEKGNIIDGDYMMLICSKYLKEKNRLPQNTVVVTVMSNLGLHIGLKEA 300

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           G+ +  T VGDRY+ME +   G   GGEQSGHII  ++ +TGDG++  LQ++  +K+  +
Sbjct: 301 GIKVLETRVGDRYVMEELLRTGAVFGGEQSGHIINLEHNTTGDGILTGLQLVAVVKECGR 360

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTS-ILNSSSIVQAIADAESELRGIDRLIVRASGTESL 419
            +  +    E++PQ L +V V D    + +  +  AI   E++L G  R++VR SGTE L
Sbjct: 361 TLGVLAGQMEKFPQVLVNVRVADKKRAMENQEVWDAIRAGEAKLAGKGRILVRPSGTEPL 420

Query: 420 IRIMAEGDDLSRIKRIVDDLAKVIPMI 446
           +R+MAEG +   ++ +VDD+A VI  +
Sbjct: 421 VRVMAEGPEEEMLQNLVDDIAAVISRV 447


>gi|330877238|gb|EGH11387.1| phosphoglucosamine mutase [Pseudomonas syringae pv. morsprunorum
           str. M302280PT]
 gi|330963970|gb|EGH64230.1| phosphoglucosamine mutase [Pseudomonas syringae pv. actinidiae str.
           M302091]
          Length = 447

 Score =  259 bits (660), Expect = 8e-67,   Method: Composition-based stats.
 Identities = 192/447 (42%), Positives = 294/447 (65%), Gaps = 6/447 (1%)

Query: 2   KRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENS 61
            R++FGTDGIRG+   FPITP FM+++G A G  FR K    R+++GKDTR+SGYM E++
Sbjct: 3   TRKYFGTDGIRGRVGQFPITPEFMLKLGWAAGMAFR-KMGACRILVGKDTRISGYMFESA 61

Query: 62  LVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKV 121
           L AG +AAG D  +LGP+P+PA+A LTR+  A+ G++ISASHNP+ DNGIK F   G K+
Sbjct: 62  LEAGLSAAGADVLLLGPMPTPAIAYLTRTFHAEAGIVISASHNPHYDNGIKFFSGQGTKL 121

Query: 122 STDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVV 181
             +IE  IE LL+  +T  ++  +++G   R++    RYIE  K ++P      GL++V+
Sbjct: 122 PDEIEMMIEELLDAPMT--VAESENLGKVSRINDAAGRYIEFCKSSVPTSTDFAGLKVVI 179

Query: 182 DCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIA 241
           DCA+GA+YKVAP VF ELGA VVV+  +P+G+NIN DCGST++ +LQ  V    AD+GI 
Sbjct: 180 DCAHGATYKVAPNVFRELGAQVVVLSAQPDGLNINKDCGSTHMEALQAAVVAEHADMGIG 239

Query: 242 LDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLG 301
            DGDGDRV++VD  G IV+GD+++ +IAR+      L+G  + T  MSN+GLE  +A   
Sbjct: 240 FDGDGDRVLMVDHTGTIVDGDELLYIIARDLHERGRLQGGVVGTL-MSNLGLELALAEQN 298

Query: 302 LSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKP 361
           +   R  VGDRY++  +    + +GGE SGHI+   + +TGD ++A+LQV+  +++    
Sbjct: 299 IPFVRANVGDRYVIAELLERNWQIGGENSGHIVCFQHATTGDAIIASLQVILALRRSGIS 358

Query: 362 VSTICHCFEEYPQFLRSVSVKDTSIL--NSSSIVQAIADAESELRGIDRLIVRASGTESL 419
           ++       + PQ L +V  + +S+      S+ +A A    ++ G  R+++R SGTE L
Sbjct: 359 LAEARLKLRKCPQILINVRFEGSSVDPVTHPSVQEACARVTEQMAGRGRVLLRKSGTEPL 418

Query: 420 IRIMAEGDDLSRIKRIVDDLAKVIPMI 446
           +R+M EG+D ++++   ++LAK++  +
Sbjct: 419 VRVMVEGEDETQVRAYAEELAKLVAEV 445


>gi|294497032|ref|YP_003560732.1| phosphoglucosamine mutase [Bacillus megaterium QM B1551]
 gi|294346969|gb|ADE67298.1| phosphoglucosamine mutase [Bacillus megaterium QM B1551]
          Length = 448

 Score =  259 bits (660), Expect = 9e-67,   Method: Composition-based stats.
 Identities = 183/444 (41%), Positives = 276/444 (62%), Gaps = 5/444 (1%)

Query: 4   RFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSLV 63
           ++FGTDG+RG +N   +TP    +IG   GY+     +  +V+IG+DTR+SG+MLE +LV
Sbjct: 3   KYFGTDGVRGVAN-SELTPELAFKIGRLGGYVLTKDSERPKVLIGRDTRVSGHMLEGALV 61

Query: 64  AGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVST 123
           AG  + G +   LG I +P VA LT++L A  GVMISASHNP QDNGIK FGPDG+K+S 
Sbjct: 62  AGLLSIGAEVMRLGVISTPGVAYLTKALGAQAGVMISASHNPVQDNGIKFFGPDGFKLSD 121

Query: 124 DIEDRIETLLEDDLTSYLSCY-DSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVVD 182
             E+ IE L++ D           +G          +Y++++K+T+       G+ + +D
Sbjct: 122 AQENEIEALMDSDTDQLPRPVGGDLGQVNDYFEGGQKYLQYLKQTVDE--DFSGIHVALD 179

Query: 183 CANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIAL 242
           CA+GA+  +A  +F +L AD+  +G  PNG+NIN   GST+  +L   + E  AD+G+A 
Sbjct: 180 CAHGATSSLAAHLFADLDADISTMGASPNGLNINDGVGSTHPEALSAFLKEKGADVGLAF 239

Query: 243 DGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLGL 302
           DGDGDR+I +DEKG IV+GDQIM + A+       L+ N +V+TVMSN+G  + +   G+
Sbjct: 240 DGDGDRLIAIDEKGEIVDGDQIMFICAKYLYEQGRLKKNTLVSTVMSNLGFYKALEASGI 299

Query: 303 SLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKPV 362
              +T VGDRY++E MK N +N+GGEQSGHII  DY +TGDG+++A+Q++  ++   KP+
Sbjct: 300 ESAQTGVGDRYVVEEMKANQYNLGGEQSGHIIFLDYNTTGDGMLSAIQLVNIMQATKKPL 359

Query: 363 STICHCFEEYPQFLRSVSVKDT-SILNSSSIVQAIADAESELRGIDRLIVRASGTESLIR 421
           S +    ++YPQ L +V V D   + ++  +   I + E E+ G  R++VR SGTE L+R
Sbjct: 360 SELAAEMKKYPQLLVNVKVTDKHHVTDNEKVKVVIEEVEKEMNGNGRVLVRPSGTEPLVR 419

Query: 422 IMAEGDDLSRIKRIVDDLAKVIPM 445
           +M E       +  V  + +V+  
Sbjct: 420 VMVEAQTQEECETYVTRIVEVVKE 443


>gi|210620472|ref|ZP_03292070.1| hypothetical protein CLOHIR_00012 [Clostridium hiranonis DSM 13275]
 gi|210155332|gb|EEA86338.1| hypothetical protein CLOHIR_00012 [Clostridium hiranonis DSM 13275]
          Length = 448

 Score =  259 bits (660), Expect = 9e-67,   Method: Composition-based stats.
 Identities = 190/447 (42%), Positives = 270/447 (60%), Gaps = 7/447 (1%)

Query: 3   RRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSL 62
           R++FGTDG+RG +NT  +  N   ++G A GY+        +VV+GKDTR+SG MLE +L
Sbjct: 2   RKYFGTDGVRGVANT-ELDCNLAYKLGRAGGYVLAKGDHRVKVVVGKDTRISGDMLEAAL 60

Query: 63  VAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVS 122
           ++G  + G D   +G IP+PAVA LTR   AD GV+ISASHNP + NGIK F  DG+K+ 
Sbjct: 61  ISGLMSVGCDVITVGVIPTPAVAYLTRKYNADCGVVISASHNPVEFNGIKFFNKDGFKLD 120

Query: 123 TDIEDRIETLLED-DLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVV 181
            +IE  IE  ++D D          +G         + Y++ +  +    V L G +IV+
Sbjct: 121 DNIELEIEKYIDDIDAVDSNPTGTEVGKRIHRHEAQNEYVDFLIESA--GVDLTGKKIVL 178

Query: 182 DCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIA 241
           DCANGA+ KVAPE +  LGA+V+ I  +P+G NIN  CGST+  +LQ+ V E  AD G+A
Sbjct: 179 DCANGAASKVAPEAYRRLGAEVIAIAAEPDGTNINDKCGSTHPENLQKVVVEEGADYGLA 238

Query: 242 LDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLG 301
            DGD DR+I VDEKG IV+GD+IM L A        L  N +V TVM+NIGL+       
Sbjct: 239 YDGDADRLIAVDEKGNIVDGDRIMILSAINLKKKGKLAKNTLVVTVMTNIGLKIAAKEND 298

Query: 302 LSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKP 361
           + L  T+VGDRY+ME M   G+ +GGEQSGH+I  D  +TGDG +++L +   I +  K 
Sbjct: 299 IDLAITKVGDRYVMEEMLKEGYVLGGEQSGHLIFLDNNTTGDGTLSSLVLSGIIAEEGKT 358

Query: 362 VSTICHCFEEYPQFLRSVSVKDTSI---LNSSSIVQAIADAESELRGIDRLIVRASGTES 418
           +S +    E+YPQ L +  VK+ +    +    +   I   E  L G  R+++R SGTE 
Sbjct: 359 LSELASVMEQYPQVLINAKVKNENKNRYMEFPEVKAEIERIEKLLDGEGRVLIRPSGTEP 418

Query: 419 LIRIMAEGDDLSRIKRIVDDLAKVIPM 445
           L+R+M EG ++ +IK +  +LA++I  
Sbjct: 419 LVRVMLEGKEVEQIKELATNLAELIKE 445


>gi|161507233|ref|YP_001577187.1| phosphoglucomutase (glycolysis) [Lactobacillus helveticus DPC 4571]
 gi|172048212|sp|A8YUF8|GLMM_LACH4 RecName: Full=Phosphoglucosamine mutase
 gi|160348222|gb|ABX26896.1| phosphoglucomutase (glycolysis) [Lactobacillus helveticus DPC 4571]
          Length = 450

 Score =  259 bits (660), Expect = 9e-67,   Method: Composition-based stats.
 Identities = 179/447 (40%), Positives = 273/447 (61%), Gaps = 8/447 (1%)

Query: 4   RFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHR---RVVIGKDTRLSGYMLEN 60
           ++FGTDG+RG +N   +TP    ++G   GY+    KK     +V++ +DTR+SG MLE 
Sbjct: 3   KYFGTDGVRGVANQG-LTPEMAFKLGRDGGYVLTKNKKDGEQAKVLVSRDTRISGQMLEY 61

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +L++G  + G++   +G I +P ++ L R+  AD GV ISASHNP +DNGIK FG DG K
Sbjct: 62  ALISGLLSVGIEVLEVGVITTPGLSYLVRAQGADAGVQISASHNPVEDNGIKFFGSDGLK 121

Query: 121 VSTDIEDRIETLLEDDLTS-YLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRI 179
           +S ++E+ IE L++    +      + +G          +Y++ ++ T+P    L G+++
Sbjct: 122 LSDEMEEEIEKLIDAKGDNLPRPSAEGLGTVTDFHEGSAKYLQFIENTIPE--DLDGIKV 179

Query: 180 VVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIG 239
           V+D ANGAS  +   +F + G D   I   PNG+NIN  CG+T+  +LQ++V +  A +G
Sbjct: 180 VIDGANGASSALISRLFADCGVDFTTIYTHPNGLNINDHCGATHTENLQKEVVKQGAQLG 239

Query: 240 IALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAG 299
           +A DGD DR I VDE G  V+GD IM +I      H  L+ + IVTTVMSN+G  + +  
Sbjct: 240 LAFDGDADRCIAVDENGNEVDGDHIMYVIGSYLAEHGRLKKDTIVTTVMSNLGFTKALEK 299

Query: 300 LGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYD 359
            GL   RT+VGDRY+ E M+ +G+N+GGEQSGH+I+SDY +TGDG++  L ++  +K+  
Sbjct: 300 EGLKNVRTQVGDRYVSEEMRAHGYNLGGEQSGHVIMSDYHNTGDGMLTGLHLMLVMKKTG 359

Query: 360 KPVSTICHCFEEYPQFLRSVSVKDTS-ILNSSSIVQAIADAESELRGIDRLIVRASGTES 418
           K +S +   F++YPQ L +V VKD         I+  IA+ E ++ G  R++VR SGT+ 
Sbjct: 360 KSLSELLKDFKDYPQGLVNVPVKDKKSWKEHQPILDVIAEVEKDMNGNGRVLVRPSGTQD 419

Query: 419 LIRIMAEGDDLSRIKRIVDDLAKVIPM 445
           L+R+MAEG         VD + KV+  
Sbjct: 420 LLRVMAEGPTQEETDAYVDRIVKVVEK 446


>gi|188584566|ref|YP_001928011.1| phosphoglucosamine mutase [Methylobacterium populi BJ001]
 gi|205830887|sp|B1ZBR8|GLMM_METPB RecName: Full=Phosphoglucosamine mutase
 gi|179348064|gb|ACB83476.1| phosphoglucosamine mutase [Methylobacterium populi BJ001]
          Length = 446

 Score =  259 bits (660), Expect = 9e-67,   Method: Composition-based stats.
 Identities = 258/429 (60%), Positives = 332/429 (77%), Gaps = 1/429 (0%)

Query: 3   RRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSL 62
           R+ FGTDGIRG++N   ITP   +++G A G +F+      RVVIGKDTRLSGYM+E +L
Sbjct: 2   RKHFGTDGIRGRAN-GIITPELALKVGQAAGVIFQRGDHRHRVVIGKDTRLSGYMIETAL 60

Query: 63  VAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVS 122
           VAGFT+ GMD  +LGP+P+PAVAMLTRS+RAD+GVMISASHNP++DNGIKLFGPDG+K++
Sbjct: 61  VAGFTSVGMDVLLLGPMPTPAVAMLTRSMRADIGVMISASHNPFEDNGIKLFGPDGFKLN 120

Query: 123 TDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVVD 182
            ++E  IE+L++ D+   L+    +G AKR++ VH RYIE  KRTLPR VTL GLR+VVD
Sbjct: 121 DELELEIESLIDGDMRRRLAGSRDLGRAKRIESVHARYIEFAKRTLPRHVTLDGLRVVVD 180

Query: 183 CANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIAL 242
           CANGA+Y+VAPE  WELGA+V+ IG +P+G NIN D GST   SL +KV E+RAD+GIAL
Sbjct: 181 CANGAAYRVAPETLWELGAEVIAIGVEPDGFNINRDVGSTAPESLVQKVRELRADVGIAL 240

Query: 243 DGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLGL 302
           DGD DRV+IVDEKG  V+GDQ+MA +AR W     L   G+V T+MSN+GLERFI GLGL
Sbjct: 241 DGDADRVLIVDEKGQKVDGDQLMAAVARSWKEDERLTQPGLVATIMSNLGLERFINGLGL 300

Query: 303 SLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKPV 362
           +L RT VGDRY++E+M+ +G+N+GGEQSGHII+SDY +TGDGLVAALQ+L  +K+ + PV
Sbjct: 301 TLARTAVGDRYVLEHMREHGYNLGGEQSGHIIMSDYATTGDGLVAALQLLSVVKRRNLPV 360

Query: 363 STICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLIRI 422
           S +CHCFE  PQ L++V  +    L + S+V AIA A+  L    RL++R SGTE +IR+
Sbjct: 361 SEVCHCFEPLPQILKNVRFRSGEPLRADSVVTAIAHAKDRLGQSGRLVIRPSGTEPVIRV 420

Query: 423 MAEGDDLSR 431
           MAEGDD + 
Sbjct: 421 MAEGDDHAL 429


>gi|296283044|ref|ZP_06861042.1| phosphoglucosamine mutase [Citromicrobium bathyomarinum JL354]
          Length = 445

 Score =  259 bits (660), Expect = 1e-66,   Method: Composition-based stats.
 Identities = 235/445 (52%), Positives = 315/445 (70%), Gaps = 2/445 (0%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M R++FGTDGIRG++N   +T    MR+  A G  FR      RVVIGKDTRLSGYM+EN
Sbjct: 1   MARKYFGTDGIRGETNKGAMTATMAMRVAQAAGAHFRRGDHRHRVVIGKDTRLSGYMVEN 60

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +LVAGFT+ G++    GP+P+PA+AMLTR +RAD+GVMISASHNPYQDNGIKLFGPDG+K
Sbjct: 61  ALVAGFTSMGVNVIQTGPLPTPAIAMLTREMRADLGVMISASHNPYQDNGIKLFGPDGFK 120

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +S + E  IE L++ +    L     IG A+R++    RYI  VK+++        L++V
Sbjct: 121 LSDEDEAAIEALIDQE--PELVPASEIGRARRIEDSRGRYIHAVKQSVSDKTRFDDLKVV 178

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           VDCANGA+Y+VAP   WELGA+V+ +G  PNG NIN   GST++ +++ KV E  ADIGI
Sbjct: 179 VDCANGAAYQVAPSAIWELGAEVITLGVDPNGTNINDGVGSTSLDAVKAKVVETGADIGI 238

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           ALDGD DR+I++DEKG  ++GDQIMA IA        LRG G+V TVMSN+GLER++ G 
Sbjct: 239 ALDGDADRLIVIDEKGEAIDGDQIMASIATRMAEKGQLRGGGVVATVMSNLGLERYLEGK 298

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           GL+L+RT+VGDRY++  M++ GFNVGGEQSGH+IL D+ +TGDG VAA++VL  + + ++
Sbjct: 299 GLTLERTKVGDRYVLGRMRSGGFNVGGEQSGHMILLDHATTGDGTVAAMRVLASLVRSNR 358

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
           P S     FE  PQ L++V     S L++ ++  AI DAE  L G  RL++RASGTE LI
Sbjct: 359 PASEELRMFEPVPQLLKNVRYDGASPLDAETVKAAIKDAERALAGKGRLVIRASGTEPLI 418

Query: 421 RIMAEGDDLSRIKRIVDDLAKVIPM 445
           R+MAEGDD   ++++VD +   +  
Sbjct: 419 RVMAEGDDAGEVEQVVDAVCDAVRA 443


>gi|315650487|ref|ZP_07903557.1| phosphoglucosamine mutase [Eubacterium saburreum DSM 3986]
 gi|315487283|gb|EFU77595.1| phosphoglucosamine mutase [Eubacterium saburreum DSM 3986]
          Length = 448

 Score =  259 bits (660), Expect = 1e-66,   Method: Composition-based stats.
 Identities = 175/444 (39%), Positives = 269/444 (60%), Gaps = 5/444 (1%)

Query: 4   RFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSLV 63
           ++FGTDG RG++N   +T     ++G  +G  +    K  RVVIGKDTR S YM E SLV
Sbjct: 3   KYFGTDGFRGEAN-IDLTVEHAYKVGRFLGSYYSKDGKKCRVVIGKDTRRSSYMFEYSLV 61

Query: 64  AGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVST 123
           AG TA+G D ++L    +P+V+ + RS   D G+MISASHNPY DNGIK+   +G K+  
Sbjct: 62  AGLTASGADVYLLHVTTTPSVSYVVRSDDFDCGIMISASHNPYYDNGIKVINGNGEKLEE 121

Query: 124 DIEDRIETLLEDDLTSYLS-CYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVVD 182
           ++ ++IE  ++    +      ++IG         +RYI ++     R  + +G ++ +D
Sbjct: 122 EVIEKIEGYIDGPDDAIAFATKENIGRTVDYAAGRNRYIGYLISIATR--SFKGKKVALD 179

Query: 183 CANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIAL 242
            ANG++  +A  VF  LGAD  VI + P+G+NIN DCGST++ SLQ+ V E   DIG A 
Sbjct: 180 LANGSASSIAKNVFDALGADTFVIHNNPDGLNINTDCGSTHIESLQKCVLENGCDIGFAY 239

Query: 243 DGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLGL 302
           DGD DR + VDE G +V+GD I+ +  +       L  N +VTTVMSN GL +     G+
Sbjct: 240 DGDADRCLCVDENGNVVDGDLILYICGKYMKERGELFNNTVVTTVMSNFGLYKAFEREGI 299

Query: 303 SLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKPV 362
           + ++T VGD+Y+ E M+NNG  +GGEQSGHII + + +TGDG++ +L+V+  + +  +P+
Sbjct: 300 NYEKTAVGDKYVYENMQNNGHCLGGEQSGHIIFAKHATTGDGILTSLKVMEVVLETKQPL 359

Query: 363 STICHCFEEYPQFLRSVSVKDTSIL-NSSSIVQAIADAESELRGIDRLIVRASGTESLIR 421
           S +    E +PQ L++V V D  I   + ++++A+      L G  R+++R SGTE LIR
Sbjct: 360 SKLASEVEIFPQVLKNVRVTDKKIAGENKAVLEAVDKVSKALGGDGRILLRPSGTEPLIR 419

Query: 422 IMAEGDDLSRIKRIVDDLAKVIPM 445
           +M E   +   ++  D++ KV+  
Sbjct: 420 VMVEAKSMDDCEKYTDEVIKVMEK 443


>gi|312113974|ref|YP_004011570.1| phosphoglucosamine mutase [Rhodomicrobium vannielii ATCC 17100]
 gi|311219103|gb|ADP70471.1| phosphoglucosamine mutase [Rhodomicrobium vannielii ATCC 17100]
          Length = 456

 Score =  259 bits (660), Expect = 1e-66,   Method: Composition-based stats.
 Identities = 249/445 (55%), Positives = 323/445 (72%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M+++ FGTDGIRG++NT+P+T    +++G+A G++F    +  RVVIGKDTRLSGY +EN
Sbjct: 1   MRQKLFGTDGIRGQANTWPMTAEIALKVGMAAGHMFTNGGRRHRVVIGKDTRLSGYTIEN 60

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +LV+GFT+ GMD   LGPIP+PAVAML RSLRAD+GVMISASHN YQDNGIKLFGPDGYK
Sbjct: 61  ALVSGFTSVGMDVVQLGPIPTPAVAMLVRSLRADLGVMISASHNAYQDNGIKLFGPDGYK 120

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +S ++E  IE  +  D+   L+  D IG ++R+DG+ DRYIE  KRTL R ++L GL+IV
Sbjct: 121 LSDEVETEIEAEVFGDIDRLLAEPDHIGKSRRIDGIVDRYIEFAKRTLDRTISLSGLKIV 180

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           +DCANGA+Y+VAP   WELGA+VV +G  P+G NIN +CGST    + RKV E  A IGI
Sbjct: 181 IDCANGAAYRVAPAALWELGAEVVALGVAPDGRNINRECGSTVPDHICRKVLETGAHIGI 240

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           ALDGD DRVII DE G IV+GDQI+A+I   + +   LRG G+V TVMSN+GLER    L
Sbjct: 241 ALDGDADRVIISDENGQIVDGDQILAVIGENFRNTGRLRGGGVVATVMSNLGLERHFEKL 300

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
            LSL RT+VGDRY++E M+   +NVGGEQSGH++LSD+ +TGDGLV ALQVL  + Q DK
Sbjct: 301 DLSLIRTKVGDRYVVEAMRRGDYNVGGEQSGHVVLSDFTTTGDGLVTALQVLSVVIQSDK 360

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
           PVS +C  FE  PQ L+++     S L S ++   IA  E  L    RL++R SGTE LI
Sbjct: 361 PVSEVCRRFEPVPQLLKNLRFSGPSPLESEAVKSVIAAQEVRLGRAGRLLIRKSGTEPLI 420

Query: 421 RIMAEGDDLSRIKRIVDDLAKVIPM 445
           R+MA+G+D + I  +V ++   +  
Sbjct: 421 RVMAQGEDQTLISGVVAEIVAAVQA 445


>gi|56696249|ref|YP_166606.1| phosphoglucosamine mutase [Ruegeria pomeroyi DSS-3]
 gi|81558615|sp|Q5LTP9|GLMM_SILPO RecName: Full=Phosphoglucosamine mutase
 gi|56677986|gb|AAV94652.1| phosphoglucosamine mutase [Ruegeria pomeroyi DSS-3]
          Length = 448

 Score =  258 bits (659), Expect = 1e-66,   Method: Composition-based stats.
 Identities = 227/444 (51%), Positives = 307/444 (69%), Gaps = 4/444 (0%)

Query: 3   RRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKH-RRVVIGKDTRLSGYMLENS 61
           R+ FGTDG+RG +NT P+T    +RIG AVG  FR +     RVVIGKDTRLSGYM EN+
Sbjct: 2   RKLFGTDGVRGTANTHPMTAEMALRIGAAVGRYFRREAGGVHRVVIGKDTRLSGYMFENA 61

Query: 62  LVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKV 121
           L AG  + GM+  +LGP+P+PAV ++TRS+RAD+GVMISASHN  +DNGIK FGPDG+K+
Sbjct: 62  LTAGLASTGMNVLLLGPVPTPAVGLMTRSMRADLGVMISASHNSAEDNGIKFFGPDGFKL 121

Query: 122 STDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVV 181
           S   E  IE ++   +   L+   +IG  +RVD    RY E VK +L R + L GL++VV
Sbjct: 122 SDQAEMEIEEMVATGV--RLAQAHNIGRVRRVDDARFRYGERVKSSLTRGLRLDGLKVVV 179

Query: 182 DCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIA 241
           DCANGA+++ APE+ WELGADVV IG  P+G+NIN  CGST   +    V    AD+GI 
Sbjct: 180 DCANGAAHRTAPEILWELGADVVPIGTSPDGLNINRGCGSTCPRTASEAVVAHGADVGIC 239

Query: 242 LDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLG 301
           LDGD DRVI++D+ G + +GDQIMAL+A  W +   L+G  +V TVMSN+GLERF+   G
Sbjct: 240 LDGDADRVIVIDQLGNVADGDQIMALLAARWAAEGRLQGGALVATVMSNLGLERFLGDRG 299

Query: 302 LSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKP 361
           + L+RT VGDRY++E M+  GFN+GGEQSGHI++SD+ +TGDGL+A L  L  + +  +P
Sbjct: 300 IGLERTAVGDRYVVERMREGGFNLGGEQSGHIVMSDFATTGDGLMAGLHFLGEMMRSGQP 359

Query: 362 VSTICHCFEEYPQFLRSVSV-KDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
            S +   F   PQ L++V   K  + L+++S+  AIA+AE  L G  RL++R SGTE LI
Sbjct: 360 SSELVRQFVPVPQLLKNVRFAKGQTPLDAASVQSAIAEAEGVLNGSGRLLIRKSGTEPLI 419

Query: 421 RIMAEGDDLSRIKRIVDDLAKVIP 444
           R+MAE +D + + R VD + + + 
Sbjct: 420 RVMAECEDEALLTRAVDSVVEAVA 443


>gi|308172071|ref|YP_003918776.1| phosphoglucomutase GlmM [Bacillus amyloliquefaciens DSM 7]
 gi|307604935|emb|CBI41306.1| phosphoglucomutase GlmM [Bacillus amyloliquefaciens DSM 7]
 gi|328551883|gb|AEB22375.1| phosphoglucosamine mutase [Bacillus amyloliquefaciens TA208]
 gi|328910139|gb|AEB61735.1| phosphoglucomutase GlmM [Bacillus amyloliquefaciens LL3]
          Length = 448

 Score =  258 bits (659), Expect = 1e-66,   Method: Composition-based stats.
 Identities = 184/443 (41%), Positives = 276/443 (62%), Gaps = 5/443 (1%)

Query: 4   RFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSLV 63
           ++FGTDG+RG +N   +TP    ++G   GY+    K+  +V+IG+DTR+SG+MLE +LV
Sbjct: 3   KYFGTDGVRGVAN-SELTPELAFKVGRFGGYVLTKDKQRPKVLIGRDTRISGHMLEGALV 61

Query: 64  AGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVST 123
           AG  + G +   LG I +P V+ LT+++ A+ GVMISASHNP QDNGIK FG DG+K+S 
Sbjct: 62  AGLLSIGAEVMRLGVISTPGVSYLTKAMDAEAGVMISASHNPVQDNGIKFFGGDGFKLSD 121

Query: 124 DIEDRIETLLEDDLTSYLSCYD-SIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVVD 182
           + E  IE L+++            +G          +Y++ +K+T   D T  G+ + +D
Sbjct: 122 EQEAEIERLMDEPEDKLPRPTGADLGLVNDYFEGVQKYLQFLKQTADEDFT--GIHVALD 179

Query: 183 CANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIAL 242
           CA+GA+  +A  +F +L ADV  +G  PNG+NIN   GST+  +L   V E  ADIG+A 
Sbjct: 180 CAHGATSSIATHLFADLDADVSTMGTSPNGLNINDGVGSTHPEALSAFVKEKNADIGLAF 239

Query: 243 DGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLGL 302
           DGDGDR+I VDEKG IV+GDQIM + A+   S   L+ + +V+TVMSN+G  + +    +
Sbjct: 240 DGDGDRLIAVDEKGNIVDGDQIMYICAKYLKSEGRLKDDTVVSTVMSNLGFYKALEKEEI 299

Query: 303 SLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKPV 362
              +T VGDRY++E MK +G+NVGGEQSGH+I  DY +TGDGL++A+ ++  +K   K +
Sbjct: 300 KSIQTAVGDRYVVEAMKKDGYNVGGEQSGHLIFLDYNTTGDGLLSAIMLVNTLKASGKTL 359

Query: 363 STICHCFEEYPQFLRSVSVKDT-SILNSSSIVQAIADAESELRGIDRLIVRASGTESLIR 421
           S +    +++PQ L +V V D   +  ++ +   I++ E E+ G  R++VR SGTE L+R
Sbjct: 360 SELAGEMKKFPQLLVNVKVTDKYKVEENAKVKAVISEVEKEMNGDGRILVRPSGTEPLVR 419

Query: 422 IMAEGDDLSRIKRIVDDLAKVIP 444
           +MAE          V  +  V+ 
Sbjct: 420 VMAEARTKELCDEYVTKIVDVVR 442


>gi|261392085|emb|CAX49582.1| phosphoglucosamine mutase [Neisseria meningitidis 8013]
          Length = 444

 Score =  258 bits (659), Expect = 1e-66,   Method: Composition-based stats.
 Identities = 196/445 (44%), Positives = 291/445 (65%), Gaps = 6/445 (1%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKK--KHRRVVIGKDTRLSGYML 58
           M +++FGTDG+RG+   FPITP+F++++G A G +       +   V+IGKDTR+SGYML
Sbjct: 1   MAKKYFGTDGVRGEVGQFPITPDFVLKLGYAAGQVLVQHDTDQKPTVLIGKDTRISGYML 60

Query: 59  ENSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDG 118
           E +LVAGFTAAG++    GP+P+P VA LTR+LR   GVMISASHN Y DNGIK F   G
Sbjct: 61  EAALVAGFTAAGVNVVQTGPLPTPGVAYLTRALRLSAGVMISASHNAYSDNGIKFFAEGG 120

Query: 119 YKVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLR 178
            K+S ++E  IE  ++ ++ +       +G A+R++G  DRYIE  K T P    L+GL+
Sbjct: 121 VKLSDEVELEIEAKIDGEMKTQP--SARLGRARRINGADDRYIEFCKSTFPTHSDLRGLK 178

Query: 179 IVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADI 238
           +VVD ANGA+Y VAP+VF ELGA VV IGD+PNG NIN  CG+T   +LQ  V +  AD 
Sbjct: 179 LVVDAANGAAYSVAPKVFHELGAQVVSIGDEPNGYNINEKCGATYTKTLQAAVLQHEADY 238

Query: 239 GIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIA 298
           GIALDGDGDR+++VD+ G + +GD ++ +IA+   +   +   G+V TVM+N+ +E  + 
Sbjct: 239 GIALDGDGDRLMMVDKNGKVYDGDSLIYVIAK-ARAREGINIGGVVGTVMTNMAMEIALK 297

Query: 299 GLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQY 358
             G+   R +VGDRY++E +    + +GGE SGHI+  D  +TGDG+++ALQVL  ++  
Sbjct: 298 EQGVDFCRAKVGDRYVLEQLNQRSWLIGGEASGHILCMDKHNTGDGIISALQVLAALQTL 357

Query: 359 DKPVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTES 418
           ++ ++T+C  ++ YPQ + +V ++       +S    +A+ E EL G  R+++RASGTE 
Sbjct: 358 NQDLATVCADWQPYPQTMINVRIQKGQKWQEAS-KDVLAEVEKELEGKGRVVLRASGTEP 416

Query: 419 LIRIMAEGDDLSRIKRIVDDLAKVI 443
           ++R+M E       +   + +A  I
Sbjct: 417 VVRVMVEARQADWARDGAERIASAI 441


>gi|298527834|ref|ZP_07015238.1| phosphoglucosamine mutase [Desulfonatronospira thiodismutans
           ASO3-1]
 gi|298511486|gb|EFI35388.1| phosphoglucosamine mutase [Desulfonatronospira thiodismutans
           ASO3-1]
          Length = 451

 Score =  258 bits (659), Expect = 1e-66,   Method: Composition-based stats.
 Identities = 203/447 (45%), Positives = 307/447 (68%), Gaps = 2/447 (0%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M+++ FGTDG+RG++N FP+ P  ++R+G+A G  FR   +  RV+IGKDTRLSGY+ EN
Sbjct: 1   MRKKLFGTDGLRGQANIFPMLPEIVLRLGLAAGQYFRNGHRRHRVLIGKDTRLSGYVFEN 60

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +L +GF A+GMD F++GP+P+PA++ LT+++RAD+GV+ISASHNP+ DNGIK F   G+K
Sbjct: 61  ALTSGFCASGMDVFLVGPMPTPAISFLTKNMRADLGVVISASHNPFMDNGIKFFDHKGFK 120

Query: 121 VSTD-IEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRI 179
           +S    ED  E +L  D+       ++IG A+++     RYI H+K +LP  ++LQG+++
Sbjct: 121 LSDQVEEDISELVLSPDVNWKHPQPEAIGRARKIVDSPGRYIVHLKNSLPNTMSLQGMKV 180

Query: 180 VVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIG 239
           V+DCA+GA+Y+VAP +F ELGA V++ G +P+G+NIN  CGS         V E  AD+G
Sbjct: 181 VIDCAHGATYRVAPLIFEELGAKVIMAGTEPDGVNINKKCGSLYPEVAASMVLEHGADLG 240

Query: 240 IALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAG 299
           + LDGDGDR+I +DE G I++GDQIMA+ A + M    L GN +V+TVMSN+ LE F+  
Sbjct: 241 LTLDGDGDRLIAIDENGVILDGDQIMAICAMDLMERDALPGNLLVSTVMSNMALEVFMQE 300

Query: 300 LGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYD 359
            G  L RT+VGDRY++E M+  G  +GGEQSGH+I  DY +TGDG++A +++L+ + Q +
Sbjct: 301 HGGRLLRTKVGDRYVVEAMRKEGAVLGGEQSGHLIFLDYATTGDGILAGIKLLKIMLQKN 360

Query: 360 KPVSTICHCFEEYPQFLRSVSVKDT-SILNSSSIVQAIADAESELRGIDRLIVRASGTES 418
           +P+S +      +PQ L +V V+          + +A+ DAE++L    R+++R SGTES
Sbjct: 361 RPLSELSRLLTPFPQRLINVHVERKMPFEEVQQVQEAVKDAEAQLGSKGRVLLRYSGTES 420

Query: 419 LIRIMAEGDDLSRIKRIVDDLAKVIPM 445
           + R+M EG D + ++ +   LA+ +  
Sbjct: 421 VARVMVEGQDDTLVEDMAIKLARAVEE 447


>gi|325201653|gb|ADY97107.1| phosphoglucosamine mutase [Neisseria meningitidis M01-240149]
 gi|325208612|gb|ADZ04064.1| phosphoglucosamine mutase [Neisseria meningitidis NZ-05/33]
          Length = 444

 Score =  258 bits (659), Expect = 1e-66,   Method: Composition-based stats.
 Identities = 197/445 (44%), Positives = 289/445 (64%), Gaps = 6/445 (1%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKK--KHRRVVIGKDTRLSGYML 58
           M +++FGTDG+RG+   FPITP+F++++G A G +       +   V+IGKDTR+SGYML
Sbjct: 1   MAKKYFGTDGVRGEVGQFPITPDFVLKLGYAAGQVLVQHDTDQKPTVLIGKDTRISGYML 60

Query: 59  ENSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDG 118
           E +LVAGFTAAG++    GP+P+P VA LTR+LR   GVMISASHN Y DNGIK F   G
Sbjct: 61  EAALVAGFTAAGVNVIQTGPLPTPGVAYLTRALRLSAGVMISASHNAYSDNGIKFFAEGG 120

Query: 119 YKVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLR 178
            K+S +IE  IE  +++++ +       +G A+R+ G  DRYIE  K T P    L+GL+
Sbjct: 121 VKLSDEIELEIEAKIDEEMKTQP--SARLGRARRISGADDRYIEFCKSTFPSHSDLRGLK 178

Query: 179 IVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADI 238
           +V+D ANGA Y VAP+VF ELGA VV IGD+PNG NIN  CG+T   +LQ  V +  AD 
Sbjct: 179 LVIDTANGAGYGVAPKVFHELGAQVVSIGDEPNGYNINEKCGATYTKTLQAAVLQHEADY 238

Query: 239 GIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIA 298
           GIALDGDGDR+++VD+ G + +GD ++ +IA+   +   +   G+V TVM+N+ +E  + 
Sbjct: 239 GIALDGDGDRLMMVDKNGKVYDGDSLIYVIAK-ARAREGINIGGVVGTVMTNMAMEIALK 297

Query: 299 GLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQY 358
             G+   R +VGDRY++E +   G+ VGGE SGHI+  D  +TGDG+++ALQVL  ++  
Sbjct: 298 EQGVDFCRAKVGDRYVLEQLNQRGWLVGGEASGHILCMDKHNTGDGIISALQVLAALQTL 357

Query: 359 DKPVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTES 418
           ++ ++ +C  ++ YPQ + +V +        +S    +A+ E EL G  R+++RASGTE 
Sbjct: 358 NQDLAAVCADWQPYPQTMINVRIGKGQNWQEAS-KDVLAEVEKELEGKGRVVLRASGTEP 416

Query: 419 LIRIMAEGDDLSRIKRIVDDLAKVI 443
           ++R+M E       +   + +A  I
Sbjct: 417 VVRVMVEARQADWARDGAERIASAI 441


>gi|295702397|ref|YP_003595472.1| phosphoglucosamine mutase [Bacillus megaterium DSM 319]
 gi|294800056|gb|ADF37122.1| phosphoglucosamine mutase [Bacillus megaterium DSM 319]
          Length = 448

 Score =  258 bits (659), Expect = 1e-66,   Method: Composition-based stats.
 Identities = 183/444 (41%), Positives = 277/444 (62%), Gaps = 5/444 (1%)

Query: 4   RFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSLV 63
           ++FGTDG+RG +N   +TP    +IG   GY+     +  +V+IG+DTR+SG+MLE +LV
Sbjct: 3   KYFGTDGVRGVAN-SELTPELAFKIGRLGGYVLTKDSERPKVLIGRDTRVSGHMLEGALV 61

Query: 64  AGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVST 123
           AG  + G +   LG I +P VA LT++L A  GVMISASHNP QDNGIK FGPDG+K+S 
Sbjct: 62  AGLLSIGAEVMRLGVISTPGVAYLTKALGAQAGVMISASHNPVQDNGIKFFGPDGFKLSD 121

Query: 124 DIEDRIETLLEDDLTSYLSCY-DSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVVD 182
             E+ IE L++ D           +G          +Y++++K+T+       G+ + +D
Sbjct: 122 AQENEIEALMDSDTDQLPRPVGGDLGQVNDYFEGGQKYLQYLKQTVDE--DFSGIHVALD 179

Query: 183 CANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIAL 242
           CA+GA+  +A  +F +L AD+  +G  PNG+NIN   GST+  +L   + E  AD+G+A 
Sbjct: 180 CAHGATSSLAAHLFADLDADISTMGASPNGLNINDGVGSTHPEALSAFLKEKGADVGLAF 239

Query: 243 DGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLGL 302
           DGDGDR+I +DEKG IV+GDQIM + A+   +   L+ N +V+TVMSN+G  + +   G+
Sbjct: 240 DGDGDRLIAIDEKGEIVDGDQIMFICAKYLYAQGRLKKNTLVSTVMSNLGFYKALEASGI 299

Query: 303 SLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKPV 362
              +T VGDRY++E MK N +N+GGEQSGHII  DY +TGDG+++A+Q++  ++   KP+
Sbjct: 300 ESAQTGVGDRYVVEEMKANQYNLGGEQSGHIIFLDYNTTGDGMLSAIQLVNIMQATKKPL 359

Query: 363 STICHCFEEYPQFLRSVSVKDT-SILNSSSIVQAIADAESELRGIDRLIVRASGTESLIR 421
           S +    ++YPQ L +V V D   + ++  +   I + E E+ G  R++VR SGTE L+R
Sbjct: 360 SELAAEMKKYPQLLVNVKVTDKHHVTDNEKVKVVIEEVEKEMNGNGRVLVRPSGTEPLVR 419

Query: 422 IMAEGDDLSRIKRIVDDLAKVIPM 445
           +M E       +  V  + +V+  
Sbjct: 420 VMVEAQTQEECETYVTRIVEVVKE 443


>gi|313500625|gb|ADR61991.1| GlmM [Pseudomonas putida BIRD-1]
          Length = 446

 Score =  258 bits (659), Expect = 1e-66,   Method: Composition-based stats.
 Identities = 201/448 (44%), Positives = 295/448 (65%), Gaps = 6/448 (1%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M R++FGTDGIRG+   +PITP+FM+++G A G  FR +  H RV++GKDTR+SGYM E+
Sbjct: 1   MSRKYFGTDGIRGRVGEYPITPDFMLKLGWAAGMAFRKQG-HCRVLVGKDTRISGYMFES 59

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +L AG +AAG D  +LGP+P+PA+A LTR+  A+ G++ISASHNP+ DNGIK F   G K
Sbjct: 60  ALEAGLSAAGADVMLLGPMPTPAIAYLTRTFHAEAGIVISASHNPHDDNGIKFFSGQGTK 119

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +  ++E  IE LL+  +T  +     +G   R++    RYIE  K ++P   +  GL++V
Sbjct: 120 LPDEVELMIEELLDQPMT--VVESGKLGKVSRINDAAGRYIEFCKSSVPSSTSFDGLKLV 177

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           VDCA+GA+YKVAP VF ELGADV V+  +P+G+NIN  CGST++ SLQ  V    AD+GI
Sbjct: 178 VDCAHGATYKVAPSVFRELGADVTVLHAQPDGLNINEGCGSTHIESLQAAVLVGHADLGI 237

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           A DGDGDRV++VD  GAIV+GD+++ +IAR+   H  L+G  + T  MSN+GLE  +  L
Sbjct: 238 AFDGDGDRVLMVDHTGAIVDGDELLFIIARDLQEHGKLQGGVVGTL-MSNLGLELALKDL 296

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
            +   R +VGDRY+M  +    + VGGE SGH++  ++ +TGD ++AALQVL  +K+  +
Sbjct: 297 DIPFVRAKVGDRYVMAELLEREWLVGGENSGHVVCCNHTTTGDAIIAALQVLMALKRRGE 356

Query: 361 PVSTICHCFEEYPQFLRSVSV--KDTSILNSSSIVQAIADAESELRGIDRLIVRASGTES 418
            ++       + PQ L +V         L   ++ +A A     L G  R+++R SGTE 
Sbjct: 357 TLAQARQALRKCPQVLINVRFGASKVDPLEHPAVKEASAKVTEALAGRGRVLLRKSGTEP 416

Query: 419 LIRIMAEGDDLSRIKRIVDDLAKVIPMI 446
           L+R+M EG+D S+++   + LAK++  +
Sbjct: 417 LVRVMVEGEDESQVRAHAEALAKLVGEV 444


>gi|58337035|ref|YP_193620.1| phosphoglucosamine mutase [Lactobacillus acidophilus NCFM]
 gi|227903598|ref|ZP_04021403.1| phosphoglucomutase (glycolysis) [Lactobacillus acidophilus ATCC
           4796]
 gi|75432981|sp|Q5FL35|GLMM_LACAC RecName: Full=Phosphoglucosamine mutase
 gi|58254352|gb|AAV42589.1| phosphoglucomutase (glycolysis) [Lactobacillus acidophilus NCFM]
 gi|227868485|gb|EEJ75906.1| phosphoglucomutase (glycolysis) [Lactobacillus acidophilus ATCC
           4796]
          Length = 452

 Score =  258 bits (659), Expect = 1e-66,   Method: Composition-based stats.
 Identities = 177/447 (39%), Positives = 272/447 (60%), Gaps = 8/447 (1%)

Query: 4   RFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHR---RVVIGKDTRLSGYMLEN 60
           ++FGTDG+RG +N   +TP    ++G   GY+    KK     +V++ +DTR+SG MLE 
Sbjct: 3   KYFGTDGVRGVANQG-LTPEMAFKLGRDGGYVLTKNKKDGEQAKVLVSRDTRISGQMLEY 61

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +L++G  + G++   +G I +P ++ L R+  AD G+ ISASHNP +DNGIK FG DG K
Sbjct: 62  ALISGLLSVGIEVLEVGVITTPGLSYLVRAQGADAGIQISASHNPVEDNGIKFFGSDGLK 121

Query: 121 VSTDIEDRIETLLE-DDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRI 179
           +S ++E  IE L++ ++ T      + +G          +Y++ ++ T+P    L G+++
Sbjct: 122 LSDEMEGEIEKLIDAEEDTLPRPSAEGLGTVTDFHEGSAKYLQFIENTIPE--ELDGIKV 179

Query: 180 VVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIG 239
           V+D ANGAS  +   +F + G D   I   PNG+NIN  CG+T+  +LQ++V +  A +G
Sbjct: 180 VIDGANGASSALISRLFADCGVDFTTIYTHPNGLNINDHCGATHTENLQKEVVKQGAQLG 239

Query: 240 IALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAG 299
           +A DGD DR I VDE G  V+GD IM +I      H  L+ + IVTTVMSN+G  + +  
Sbjct: 240 LAFDGDADRCIAVDENGNEVDGDHIMYVIGSYLAEHGRLKKDTIVTTVMSNLGFTKALEK 299

Query: 300 LGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYD 359
             L   RT+VGDRY+ E M+ +G+N+GGEQSGH+I+SDY +TGDG++  L ++  +K+  
Sbjct: 300 EDLKNVRTQVGDRYVSEEMRAHGYNLGGEQSGHVIMSDYHNTGDGMLTGLHLMLVMKKTG 359

Query: 360 KPVSTICHCFEEYPQFLRSVSVKDTS-ILNSSSIVQAIADAESELRGIDRLIVRASGTES 418
           K +S +   F++YPQ L +V V D         I+  IA+ E ++ G  R++VR SGT+ 
Sbjct: 360 KSLSELLKDFKDYPQCLVNVPVTDKKSWKEHQPILDVIAEVEKDMAGNGRVLVRPSGTQD 419

Query: 419 LIRIMAEGDDLSRIKRIVDDLAKVIPM 445
           L+R+MAEG         VD + KV+  
Sbjct: 420 LLRVMAEGPTQEETDAYVDRIVKVVEK 446


>gi|319654747|ref|ZP_08008825.1| phosphoglucosamine mutase [Bacillus sp. 2_A_57_CT2]
 gi|317393572|gb|EFV74332.1| phosphoglucosamine mutase [Bacillus sp. 2_A_57_CT2]
          Length = 449

 Score =  258 bits (659), Expect = 1e-66,   Method: Composition-based stats.
 Identities = 186/443 (41%), Positives = 278/443 (62%), Gaps = 5/443 (1%)

Query: 4   RFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSLV 63
           ++FGTDG+RG +N   +TP    ++G   GY+        +V+IG+DTR+SG+MLE +LV
Sbjct: 3   KYFGTDGVRGVAN-SELTPELAFKLGRFGGYVLTKDHDRPKVLIGRDTRISGHMLEGALV 61

Query: 64  AGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVST 123
           AG  + G +   LG I +P VA LT++L A+ GVMISASHNP +DNGIK FGPDG+K+S 
Sbjct: 62  AGLLSIGAEVMRLGVISTPGVAYLTKALGAEAGVMISASHNPVEDNGIKFFGPDGFKLSD 121

Query: 124 DIEDRIETLLE-DDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVVD 182
           D E  IE L++  +         S+G          +Y++++K+T+       G+ I +D
Sbjct: 122 DQEAEIEGLMDMAEDQLPRPVGGSLGQVNDYFEGGQKYLQYLKQTVDE--DFSGIHIALD 179

Query: 183 CANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIAL 242
           CA+GA+  +A  +F +L AD+ ++G  PNG+NIN   GST+  +L   V E  AD+G+A 
Sbjct: 180 CAHGATSPLATHLFADLDADLSMMGASPNGLNINAGVGSTHPEALSAFVKEKEADVGLAF 239

Query: 243 DGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLGL 302
           DGDGDR+I +DE G IV+GDQIM +  +       L+ N +V+TVMSN+G  + +   G+
Sbjct: 240 DGDGDRLIAIDENGDIVDGDQIMYICGKYMKEQGRLKQNTVVSTVMSNLGFYKGLEANGV 299

Query: 303 SLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKPV 362
              +T VGDRY++E MK NG+N+GGEQSGHII  DY +TGDGL+  LQ++  +K   KP+
Sbjct: 300 ESVQTAVGDRYVVEEMKKNGYNLGGEQSGHIIFLDYITTGDGLLTGLQLVNIMKVTKKPL 359

Query: 363 STICHCFEEYPQFLRSVSVKDT-SILNSSSIVQAIADAESELRGIDRLIVRASGTESLIR 421
           S + +  +++PQ L ++ V D   + ++  + + IA  E E+ G  R++VR SGTE L+R
Sbjct: 360 SELANEMQKFPQKLVNIRVTDKHHVTDNEKVKEVIAQVEEEMNGNGRILVRPSGTEPLVR 419

Query: 422 IMAEGDDLSRIKRIVDDLAKVIP 444
           +MAE          V+ +A V+ 
Sbjct: 420 VMAEAPTGELCASYVERIAAVVE 442


>gi|269214212|ref|ZP_05986075.2| phosphoglucosamine mutase [Neisseria lactamica ATCC 23970]
 gi|269210402|gb|EEZ76857.1| phosphoglucosamine mutase [Neisseria lactamica ATCC 23970]
          Length = 445

 Score =  258 bits (659), Expect = 1e-66,   Method: Composition-based stats.
 Identities = 197/446 (44%), Positives = 294/446 (65%), Gaps = 8/446 (1%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGK--KKHRRVVIGKDTRLSGYML 58
           M +++FGTDG+RG+   FPITP+F++++G A G +       +   V+IGKDTR+SGYML
Sbjct: 2   MAKKYFGTDGVRGEVGQFPITPDFVLKLGYAAGQVLVQHDTGQKPTVLIGKDTRISGYML 61

Query: 59  ENSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDG 118
           E +LVAGFTAAG++    GP+P+P VA LTR+LR   GVMISASHN Y DNGIK F   G
Sbjct: 62  EAALVAGFTAAGVNVIQTGPLPTPGVAYLTRALRLSAGVMISASHNAYSDNGIKFFAEGG 121

Query: 119 YKVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLR 178
            K+S ++E  IE  +++++ +       +G A+R++G  DRYIE  K T P    L+GL+
Sbjct: 122 VKLSDEVELEIEAKIDEEMKTQP--SARLGRARRINGADDRYIEFCKSTFPTHSDLRGLK 179

Query: 179 IVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADI 238
           +VVD ANGA+Y  AP+VF ELGA VV IG++PNG NIN  CG+T+  +LQ  V +  AD 
Sbjct: 180 LVVDAANGAAYSAAPKVFHELGAQVVSIGNEPNGYNINEKCGATHTKTLQAAVLQNEADY 239

Query: 239 GIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIA 298
           GIALDGDGDR+++VD+ G + +GD ++ +IA+   +   +   G+V TVM+N+ +E  + 
Sbjct: 240 GIALDGDGDRLMMVDKNGQVYDGDSLIYVIAK-ARAGEGVNIGGVVGTVMTNMAMENALK 298

Query: 299 GLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQY 358
             G+   R +VGDRY++E +   G+ VGGE SGHI+  D  +TGDG+++ALQVL  ++  
Sbjct: 299 EQGVDFCRAKVGDRYVLEQLNRRGWLVGGEASGHILCMDKHNTGDGIISALQVLAALQTL 358

Query: 359 DKPVSTICHCFEEYPQFLRSVSV-KDTSILNSSSIVQAIADAESELRGIDRLIVRASGTE 417
           ++ ++ +C  ++ YPQ + +V + K  +   +S  V  +A+ E EL G  R+++RASGTE
Sbjct: 359 NQDLAAVCADWQPYPQTMINVRIGKGQNWQEASKTV--LAEVEKELEGKGRVVLRASGTE 416

Query: 418 SLIRIMAEGDDLSRIKRIVDDLAKVI 443
            ++R+M E       +   + +A  I
Sbjct: 417 PVVRVMVEARQADWARDGAERIAAAI 442


>gi|146313244|ref|YP_001178318.1| phosphoglucosamine mutase [Enterobacter sp. 638]
 gi|166990415|sp|A4WEY7|GLMM_ENT38 RecName: Full=Phosphoglucosamine mutase
 gi|145320120|gb|ABP62267.1| phosphoglucosamine mutase [Enterobacter sp. 638]
          Length = 445

 Score =  258 bits (659), Expect = 1e-66,   Method: Composition-based stats.
 Identities = 199/446 (44%), Positives = 294/446 (65%), Gaps = 6/446 (1%)

Query: 2   KRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENS 61
            R++FGTDGIRG+    PITP F++++G A G +   +   R+++IGKDTR+SGYMLE++
Sbjct: 3   NRKYFGTDGIRGRVGDAPITPEFVLKLGWAAGKVL-ARHGSRKIIIGKDTRISGYMLESA 61

Query: 62  LVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKV 121
           L AG +AAG+ A   GP+P+PAVA LTR+ RA+ G++ISASHNP+ DNGIK F  DG K+
Sbjct: 62  LEAGLSAAGLSASFTGPMPTPAVAYLTRTFRAEAGIVISASHNPFYDNGIKFFSIDGTKL 121

Query: 122 STDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVV 181
             ++E+ IE  +E +LT        +G A R+     RYIE  K T P +++L  L+IVV
Sbjct: 122 PDEVEEAIEAEMEKELT--CVDSSELGKASRIVDAAGRYIEFCKGTFPNELSLSHLKIVV 179

Query: 182 DCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIA 241
           DCANGA+Y +AP VF ELGA V+ IG +P+G+NIN + G+T+V +LQ +V   +AD+GIA
Sbjct: 180 DCANGATYHIAPNVFRELGAKVIAIGCEPDGLNINEEVGATDVRALQARVLAEKADLGIA 239

Query: 242 LDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLG 301
            DGDGDRVI+VD +G  V+GDQI+ +IARE +        G V T+MSN+GLE  +  LG
Sbjct: 240 FDGDGDRVIMVDHEGNKVDGDQILYIIAREGLRQ-GQLRGGAVGTLMSNMGLELALKQLG 298

Query: 302 LSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKP 361
           +   R +VGDRY++E ++  G+ +G E SGH+IL D  +TGDG+VA+LQV+  + +    
Sbjct: 299 IPFARAKVGDRYVLEKLQEKGWRIGAENSGHVILLDKTTTGDGIVASLQVVAAMVRNHMN 358

Query: 362 VSTICHCFEEYPQFLRSVSVK--DTSILNSSSIVQAIADAESELRGIDRLIVRASGTESL 419
           +  +C   + +PQ L +V         L + ++   +A+ E+ L    R+++R SGTE L
Sbjct: 359 LHDLCSGMKMFPQILVNVRFTAGKGDPLENENVKAVMAEVEAALGNRGRVLLRKSGTEPL 418

Query: 420 IRIMAEGDDLSRIKRIVDDLAKVIPM 445
           IR+M EG++ +++      +A  +  
Sbjct: 419 IRVMVEGEEEAQVTEFAHRIADAVKA 444


>gi|254805446|ref|YP_003083667.1| phosphoglucosamine mutase [Neisseria meningitidis alpha14]
 gi|254668988|emb|CBA07332.1| phosphoglucosamine mutase [Neisseria meningitidis alpha14]
          Length = 444

 Score =  258 bits (659), Expect = 1e-66,   Method: Composition-based stats.
 Identities = 198/446 (44%), Positives = 295/446 (66%), Gaps = 8/446 (1%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGK--KKHRRVVIGKDTRLSGYML 58
           M +++FGTDG+RG+   FPITP+F++++G A G +       +   V+IGKDTR+SGYML
Sbjct: 1   MAKKYFGTDGVRGEVGQFPITPDFVLKLGYAAGQVLVQHDTGQKPTVLIGKDTRISGYML 60

Query: 59  ENSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDG 118
           E +LVAGFTAAG++    GP+P+P VA LTR+LR   GVMISASHN Y DNGIK F   G
Sbjct: 61  EAALVAGFTAAGVNVIQTGPLPTPGVAYLTRALRLSAGVMISASHNAYSDNGIKFFAEGG 120

Query: 119 YKVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLR 178
            K+S ++E  IE  +++++ +       +G A+R++G  DRYIE  K T P    L+GL+
Sbjct: 121 VKLSDEVELEIEAKIDEEMKTQP--SARLGRARRINGADDRYIEFCKSTFPTHSDLRGLK 178

Query: 179 IVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADI 238
           +VVD ANGA+Y VAP+VF ELGA VV IG++PNG NIN  CG+T+  +LQ  V +  AD 
Sbjct: 179 LVVDAANGAAYSVAPKVFHELGAQVVSIGNEPNGYNINEKCGATHTKTLQAVVLQNEADY 238

Query: 239 GIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIA 298
           GIALDGDGDR+++VD+ G + +GD ++ +IA+   +   +   G+V TVM+N+ +E  + 
Sbjct: 239 GIALDGDGDRLMMVDKNGQVYDGDSLIYVIAK-ARAGEGVNIGGVVGTVMTNMAMENALK 297

Query: 299 GLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQY 358
             G+   R +VGDRY++E +   G+ VGGE SGHI+  D  +TGDG+++ALQVL  ++  
Sbjct: 298 EQGVDFCRAKVGDRYVLEQLNRRGWLVGGEASGHILCMDKHNTGDGIISALQVLAALQTL 357

Query: 359 DKPVSTICHCFEEYPQFLRSVSV-KDTSILNSSSIVQAIADAESELRGIDRLIVRASGTE 417
           ++ ++ +C  ++ YPQ + +V + K  +   +S  V  +A+ E EL G  R+++RASGTE
Sbjct: 358 NQDLAAVCADWQPYPQTMINVRIGKGQNWQEASKTV--LAEVEKELEGKGRVVLRASGTE 415

Query: 418 SLIRIMAEGDDLSRIKRIVDDLAKVI 443
            ++R+M E       +   + +A  I
Sbjct: 416 PVVRVMVEARQADWARDGAERIAAAI 441


>gi|116333333|ref|YP_794860.1| phosphomannomutase [Lactobacillus brevis ATCC 367]
 gi|122269979|sp|Q03SJ3|GLMM_LACBA RecName: Full=Phosphoglucosamine mutase
 gi|116098680|gb|ABJ63829.1| phosphoglucosamine mutase [Lactobacillus brevis ATCC 367]
          Length = 451

 Score =  258 bits (659), Expect = 1e-66,   Method: Composition-based stats.
 Identities = 182/448 (40%), Positives = 271/448 (60%), Gaps = 9/448 (2%)

Query: 4   RFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRG----KKKHRRVVIGKDTRLSGYMLE 59
           ++FGTDG+RG +N   +TP    ++G   GY+       +  H +V++ +DTR+SG +LE
Sbjct: 2   KYFGTDGVRGVANQ-ELTPELAFKVGRFGGYVLTQHADSQNAHPQVLVARDTRISGELLE 60

Query: 60  NSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGY 119
           N+LVAG  + G++   LG I +PAVA L R+  A  GVMI+ASHNP + NGIK FG DGY
Sbjct: 61  NALVAGLLSVGIEVLRLGVITTPAVAYLVRTQGAAAGVMITASHNPVEYNGIKYFGNDGY 120

Query: 120 KVSTDIEDRIETLLEDDLTS-YLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLR 178
           K+S ++E+ IE LL+           D +G  +       +YI+ +++T+     L GL 
Sbjct: 121 KLSDEMEEEIEALLDAPTDDLPRPTTDGLGTVEDYSEGSQKYIQFLEQTIAD--DLDGLH 178

Query: 179 IVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADI 238
           I VD ANG++  +   ++ +L  D   I   PNG+NIN   GST+   LQ+ V +  A I
Sbjct: 179 IAVDSANGSTSGLVSRLYADLNLDFDTIATTPNGLNINDQVGSTHPEQLQKFVVDQGAAI 238

Query: 239 GIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIA 298
           G+A DGDGDR I VDE+G +V+GD+IM +  +    H  L+ + IVTTVMSN+G+ + + 
Sbjct: 239 GLAFDGDGDRCIAVDEEGHLVDGDKIMYICGKYMAEHGRLKKDTIVTTVMSNLGMYKAME 298

Query: 299 GLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQY 358
              L   +T+VGDRY++E M+ +G+N+GGEQSGHI+  D+ +TGDGL+ +LQ+L  +K  
Sbjct: 299 AHDLQSVKTKVGDRYVVEEMRKSGYNLGGEQSGHIVFLDFNTTGDGLLTSLQLLHILKVT 358

Query: 359 DKPVSTICHCFEEYPQFLRSVSVKDT-SILNSSSIVQAIADAESELRGIDRLIVRASGTE 417
            K +S +    + YPQ L +V V D  + L +  +   IA  E E+ G  R++VR SGTE
Sbjct: 359 GKKLSELAADVKTYPQKLVNVKVSDKQAALTNPQVQAMIATVEKEMNGDGRVLVRPSGTE 418

Query: 418 SLIRIMAEGDDLSRIKRIVDDLAKVIPM 445
            L+R+MAE      +   V  +A V+  
Sbjct: 419 PLLRVMAEAPTEETVAAYVGRIADVVRA 446


>gi|319942665|ref|ZP_08016972.1| phosphoglucosamine mutase [Sutterella wadsworthensis 3_1_45B]
 gi|319803748|gb|EFW00683.1| phosphoglucosamine mutase [Sutterella wadsworthensis 3_1_45B]
          Length = 452

 Score =  258 bits (658), Expect = 1e-66,   Method: Composition-based stats.
 Identities = 187/448 (41%), Positives = 278/448 (62%), Gaps = 7/448 (1%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRR--VVIGKDTRLSGYML 58
           MKRR+FGTDG+RGK  + PITP+F+M++G A G + +      R  V+IGKDTR+SGYML
Sbjct: 1   MKRRYFGTDGVRGKVGSAPITPDFVMKLGQAAGRVLKRHNPTGRASVLIGKDTRVSGYML 60

Query: 59  ENSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDG 118
           E +L AGF++AG+D  + GPIP+PAVA LTR+ R D GV+ISASHNPY DNGIK F   G
Sbjct: 61  EAALQAGFSSAGVDVVLCGPIPTPAVAYLTRAQRLDAGVVISASHNPYDDNGIKFFSAAG 120

Query: 119 YKVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLR 178
            K+    E  IE  +++           +G A+R+D    RYIE  K T+  D+ L+GL+
Sbjct: 121 QKLPDSWEVEIEEEIDEGFACVP--SAELGKARRLDDASGRYIEFCKSTIDSDIDLKGLK 178

Query: 179 IVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADI 238
           I VDCANGA+Y VAP+VF ELGADVV +G+ P+G NIN   G+T+   L  +       +
Sbjct: 179 IFVDCANGAAYHVAPDVFHELGADVVAVGNTPDGFNINRGVGATHTEHLSEQCRAAGCQV 238

Query: 239 GIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIA 298
            ++LDGD DR+I+ D  G +  GD+++ ++ R     S     G+  T+M+N GLE+ + 
Sbjct: 239 AVSLDGDADRLIMADADGRVYTGDELLYVMIR--DRLSKGMVAGVAGTLMTNYGLEKRLN 296

Query: 299 GLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQY 358
            LG+   R +VGDRY++E +   G+ +GGE SGH++  D  +TGDG+V+ALQVL  ++  
Sbjct: 297 ELGIPFGRAKVGDRYVLEMLLERGWILGGETSGHLLALDRQTTGDGIVSALQVLSAMRHT 356

Query: 359 DKPVSTICHCFEEYPQFLRSVSV-KDTSILNSSSIVQAIADAESELRGIDRLIVRASGTE 417
            K ++ +    +  PQ L +    +     +       + +AE  + G  R+++R SGTE
Sbjct: 357 GKSLAELTADLQLMPQVLINRPFTRGADWHSLPQFAATVTEAEQAVAGRGRVLIRPSGTE 416

Query: 418 SLIRIMAEGDDLSRIKRIVDDLAKVIPM 445
            ++RIM E DD +  +++ + +A+ +  
Sbjct: 417 PVLRIMVEADDKAFAEQLAEKMAQALEN 444


>gi|116494522|ref|YP_806256.1| phosphomannomutase [Lactobacillus casei ATCC 334]
 gi|191637959|ref|YP_001987125.1| phosphoglucosamine mutase [Lactobacillus casei BL23]
 gi|239631883|ref|ZP_04674914.1| phosphoglucosamine mutase [Lactobacillus paracasei subsp. paracasei
           8700:2]
 gi|301066042|ref|YP_003788065.1| phosphomannomutase [Lactobacillus casei str. Zhang]
 gi|122264052|sp|Q03AF8|GLMM_LACC3 RecName: Full=Phosphoglucosamine mutase
 gi|226722761|sp|B3WD16|GLMM_LACCB RecName: Full=Phosphoglucosamine mutase
 gi|116104672|gb|ABJ69814.1| phosphoglucosamine mutase [Lactobacillus casei ATCC 334]
 gi|190712261|emb|CAQ66267.1| Phosphoglucosamine mutase [Lactobacillus casei BL23]
 gi|239526348|gb|EEQ65349.1| phosphoglucosamine mutase [Lactobacillus paracasei subsp. paracasei
           8700:2]
 gi|300438449|gb|ADK18215.1| Phosphomannomutase [Lactobacillus casei str. Zhang]
 gi|327382034|gb|AEA53510.1| Phosphoglucosamine mutase [Lactobacillus casei LC2W]
 gi|327385188|gb|AEA56662.1| Phosphoglucosamine mutase [Lactobacillus casei BD-II]
          Length = 454

 Score =  258 bits (658), Expect = 1e-66,   Method: Composition-based stats.
 Identities = 178/451 (39%), Positives = 268/451 (59%), Gaps = 10/451 (2%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRR----VVIGKDTRLSGY 56
           M + +FGTDG+RG +N   ++P    R+G   GY+    K+       V++ +DTR+SG 
Sbjct: 1   MTK-YFGTDGVRGIANK-ELSPEMAFRLGRTGGYVLTQHKEDASRRPLVLVARDTRISGQ 58

Query: 57  MLENSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGP 116
           ML ++L+AG  + G++   LG I +PAVA L +   AD G+ ISASHNP  DNGIK FG 
Sbjct: 59  MLADALIAGLLSVGIEVLDLGVITTPAVAYLIKIQGADAGIQISASHNPVADNGIKFFGA 118

Query: 117 DGYKVSTDIEDRIETLLEDDLTS-YLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQ 175
           DGYK+S D E+ IE LL+           + +G          +Y + +++TL     L 
Sbjct: 119 DGYKLSDDTEEEIEALLDAPEDKLPRPAAEGLGTVDDYPEGALKYTQFLEQTLAD--DLS 176

Query: 176 GLRIVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVR 235
           G+ + +D ANGA+  +   +F +L  D   +   P+G+NIN + GST+  +L + V E  
Sbjct: 177 GIHVCLDGANGATSGLVSRIFADLETDFDTMAISPDGLNINANVGSTHPQALSKFVVEKG 236

Query: 236 ADIGIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLER 295
           AD+G+A DGDGDR I VDE+G IV+GD+IM ++     S   L+ + +VTTVMSN+GL +
Sbjct: 237 ADVGLAFDGDGDRCIAVDEQGNIVDGDKIMFILGSYMKSQGRLKQDTVVTTVMSNLGLYK 296

Query: 296 FIAGLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYI 355
            +   G+   +T VGDR+++E M+ +G+N+GGEQSGH+IL DY +TGDG++  + +L  +
Sbjct: 297 ALEANGMKSVQTAVGDRHVVEAMRKDGYNIGGEQSGHVILFDYHNTGDGMLTGIHLLNVM 356

Query: 356 KQYDKPVSTICHCFEEYPQFLRSVSVKDT-SILNSSSIVQAIADAESELRGIDRLIVRAS 414
           K+  K +S +    ++YPQ L +V V D  +      I  AI   E E+ G  R++VR S
Sbjct: 357 KKTGKKLSELAAPVQDYPQKLVNVKVADKENWQAYPEIQSAIDTVEKEMAGDGRVLVRPS 416

Query: 415 GTESLIRIMAEGDDLSRIKRIVDDLAKVIPM 445
           GTE L+R+MAE      + R VD +  V+  
Sbjct: 417 GTEPLLRVMAEAKTEDLVSRYVDQIVDVVKQ 447


>gi|317495790|ref|ZP_07954153.1| phosphoglucosamine mutase [Gemella moribillum M424]
 gi|316913967|gb|EFV35450.1| phosphoglucosamine mutase [Gemella moribillum M424]
          Length = 447

 Score =  258 bits (658), Expect = 1e-66,   Method: Composition-based stats.
 Identities = 189/444 (42%), Positives = 283/444 (63%), Gaps = 4/444 (0%)

Query: 3   RRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSL 62
           R++FGTDGIRG +    +T +   ++G A+G L   +K+  +V+IG+DTR+S  M+E +L
Sbjct: 2   RKYFGTDGIRGVAGE-SLTSDLSFKVGKALGKLLTEEKERPKVIIGRDTRISCDMIEYAL 60

Query: 63  VAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVS 122
            AG T+ G++   +G IP+PA+A LT+++  D G+MISASHNPYQDNGIK+FGPDG+K++
Sbjct: 61  TAGLTSVGVNVMTVGVIPTPAIAYLTKTIETDSGIMISASHNPYQDNGIKIFGPDGFKLT 120

Query: 123 TDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVVD 182
            + E  IETL+++      + YD IG       +  +YI H+K+++     L  L I +D
Sbjct: 121 DEQELEIETLIDNSNEIANASYDRIGKLYSGSELSQKYIHHIKQSISG--DLSNLNIALD 178

Query: 183 CANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIAL 242
           CANGA+  VAP +F +L AD+  IG  PNGININ + GST + +L   V E   D+G A 
Sbjct: 179 CANGATTGVAPFLFGDLEADIETIGCTPNGININENVGSTKINTLANFVKENNVDVGFAF 238

Query: 243 DGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLGL 302
           DGDGDRV+ VD  G +V+GD+IM ++A+       L  N +V+TVMSNIG  + I   GL
Sbjct: 239 DGDGDRVLAVDANGNVVDGDKIMFILAKHLKEKGELNNNMVVSTVMSNIGFYKAIEENGL 298

Query: 303 SLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKPV 362
              +T VGDRY++E M+NN +++GGEQSGHIIL +Y +TGDG++ A+++   +K   K +
Sbjct: 299 QSVKTAVGDRYVVEEMRNNNYSLGGEQSGHIILMNYATTGDGILTAVKLADILKTSGKTL 358

Query: 363 STICHCFEEYPQFLRSVSVKDTS-ILNSSSIVQAIADAESELRGIDRLIVRASGTESLIR 421
             + +    YPQ L ++ V D    +    I++  A  E EL G  R+++RASGTE+LIR
Sbjct: 359 EELANEVNIYPQKLVNIKVLDKKLAMEDQDILEECAKVEKELEGNGRILLRASGTENLIR 418

Query: 422 IMAEGDDLSRIKRIVDDLAKVIPM 445
           +M E        +  + +A+++  
Sbjct: 419 VMVEASSDELTDKYCEQVAQIVRE 442


>gi|270290669|ref|ZP_06196893.1| phosphoglucosamine mutase [Pediococcus acidilactici 7_4]
 gi|304386193|ref|ZP_07368526.1| phosphoglucosamine mutase [Pediococcus acidilactici DSM 20284]
 gi|270280729|gb|EFA26563.1| phosphoglucosamine mutase [Pediococcus acidilactici 7_4]
 gi|304327550|gb|EFL94777.1| phosphoglucosamine mutase [Pediococcus acidilactici DSM 20284]
          Length = 453

 Score =  258 bits (658), Expect = 1e-66,   Method: Composition-based stats.
 Identities = 178/450 (39%), Positives = 271/450 (60%), Gaps = 9/450 (2%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKH----RRVVIGKDTRLSGY 56
           MK ++FGTDG+RG +N   +TP    ++G   GY+     K      RV++ +DTR+SG 
Sbjct: 1   MKLKYFGTDGVRGIANE-TLTPELAFQLGRTGGYVLTKHAKDADQRPRVLVSRDTRVSGQ 59

Query: 57  MLENSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGP 116
           +L+++L++G  + G++   +G + +P VA L R   AD GVMI+ASHNP +DNGIK FG 
Sbjct: 60  LLKHALISGLLSVGIEVMDMGIVTTPGVAYLVRKQEADAGVMITASHNPVEDNGIKFFGS 119

Query: 117 DGYKVSTDIEDRIETLLEDDLTS-YLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQ 175
           DGYK+S ++E  IE LL+ +  +        +G           Y   +++T+P    L+
Sbjct: 120 DGYKLSDELEAEIEVLLDAEKDNLPRPSAKGLGSVTDYPEGGLNYTAFLEQTIPD--DLE 177

Query: 176 GLRIVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVR 235
           GL I VD ANGA+     ++F +L  +   +   P+G+NIN   GST+  +L + V E  
Sbjct: 178 GLHIAVDAANGATSGYVSQIFADLNTEFETMATNPDGLNINAGVGSTHPEALAKFVVEKG 237

Query: 236 ADIGIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLER 295
           AD+G+A DGDGDR I VDEKG IV+GD+IM +  +       L+ + +VTTVMSN+G+ +
Sbjct: 238 ADMGVAFDGDGDRCIAVDEKGNIVDGDKIMYICGKFLSERGRLKEDTVVTTVMSNLGMYK 297

Query: 296 FIAGLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYI 355
            +   G+   +T+VGDRY++E M  +G+N+GGEQSGHII  D+ +TGDG++ A+Q++  +
Sbjct: 298 ALEKHGMHSVKTQVGDRYVVEEMLKDGYNLGGEQSGHIIFLDHNTTGDGMLTAIQLMYVV 357

Query: 356 KQYDKPVSTICHCFEEYPQFLRSVSVKDTS-ILNSSSIVQAIADAESELRGIDRLIVRAS 414
           KQ  K +S +      YPQ L +V V+D    L + +I   I   E E+ G  R++VR S
Sbjct: 358 KQTGKKLSELAAEVTTYPQKLVNVRVQDKKLALENQAIKDIIKKVEDEMAGEGRVLVRPS 417

Query: 415 GTESLIRIMAEGDDLSRIKRIVDDLAKVIP 444
           GTE L+R+MAE      + + VD +  V+ 
Sbjct: 418 GTEDLLRVMAEAPTEEAVNQYVDRIVAVVK 447


>gi|170697954|ref|ZP_02889037.1| phosphoglucosamine mutase [Burkholderia ambifaria IOP40-10]
 gi|170137120|gb|EDT05365.1| phosphoglucosamine mutase [Burkholderia ambifaria IOP40-10]
          Length = 451

 Score =  258 bits (658), Expect = 1e-66,   Method: Composition-based stats.
 Identities = 200/454 (44%), Positives = 283/454 (62%), Gaps = 9/454 (1%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGK-----KKHRRVVIGKDTRLSG 55
           M RR+FGTDGIRG     PITP+F++R+G A G +  G           V+IGKDTR+SG
Sbjct: 1   MGRRYFGTDGIRGTVGEAPITPDFVLRLGYAAGKVLAGTADVAAGARPTVLIGKDTRVSG 60

Query: 56  YMLENSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFG 115
           YMLE +L AGF+AAG+D  + GP+P+P VA LTR+LR   GV+ISASHNPYQDNGIK F 
Sbjct: 61  YMLEAALEAGFSAAGVDVMLAGPMPTPGVAYLTRALRLSAGVVISASHNPYQDNGIKFFS 120

Query: 116 PDGYKVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQ 175
            DG K+  D E  IE  L+  L    +  D +G A+R++    RYIE  K T P    L+
Sbjct: 121 ADGNKLPDDTEAAIEAWLDKPLE--CASADRLGKARRLEDAAGRYIEFCKSTFPAAYDLR 178

Query: 176 GLRIVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVR 235
           GL++V+DCA+GA+Y++AP VF ELGADV+ IG  PNG NIN   G+T   +L R V    
Sbjct: 179 GLKLVIDCAHGAAYQIAPHVFHELGADVIPIGVAPNGFNINDGVGATAPDALVRAVRANH 238

Query: 236 ADIGIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLER 295
           AD+GIALDGD DR+ +VD  G + NGD+++ ++ ++ ++ +      + T  M+N+ +E 
Sbjct: 239 ADLGIALDGDADRLQVVDSTGRLYNGDELLYVLVKDRIATAGKVDGAVGTL-MTNLAVEV 297

Query: 296 FIAGLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYI 355
            +   G+   R  VGDRY++E ++  G+ +G