RPSBLAST alignment for GI: 254780544 and conserved domain: PRK14314

>gnl|CDD|184614 PRK14314, glmM, phosphoglucosamine mutase; Provisional. Length = 450
 Score =  586 bits (1513), Expect = e-168
 Identities = 221/445 (49%), Positives = 309/445 (69%), Gaps = 2/445 (0%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           M ++ FGTDG+RG++N +P+T    +++G A  Y+FR      RVVIGKDTRLSGYM EN
Sbjct: 1   MMKKLFGTDGVRGRANVYPMTAEMALQLGRAAAYVFRNGSGRHRVVIGKDTRLSGYMFEN 60

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +L+AG  + G+D  ++GP+P+P +A +TRS+RAD GV+ISASHNPYQDNGIK F  DG+K
Sbjct: 61  ALIAGLCSMGVDVLLVGPLPTPGIAFITRSMRADAGVVISASHNPYQDNGIKFFSSDGFK 120

Query: 121 VSTDIEDRIETLLED-DLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRI 179
           +  ++E RIE ++   D    L    ++G AKR+D    RYI  +K T P+ +TL+GL+I
Sbjct: 121 LPDEVELRIEAMVLSKDFDWLLPDAHAVGKAKRIDDAPGRYIVFLKATFPKGLTLKGLKI 180

Query: 180 VVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIG 239
           V+DCANGA+YKVAP VF ELGA+V+ IG +PNG+NIN  CGS +   + + V E  AD+G
Sbjct: 181 VLDCANGAAYKVAPAVFEELGAEVICIGVEPNGLNINAGCGSLHPEVIAKAVIEHGADLG 240

Query: 240 IALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAG 299
           IALDGD DR+I+VDEKG IV+GDQIMA+ A +      L  N +V TVMSN+GLE  +  
Sbjct: 241 IALDGDADRLIVVDEKGHIVDGDQIMAICATDLKKRGALPKNTLVATVMSNMGLEVAMKE 300

Query: 300 LGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYD 359
           LG  + RT VGDRY++E M+  G N+GGEQSGH+I  D+ +TGDG+++ALQVLR + +  
Sbjct: 301 LGGQVLRTPVGDRYVVEEMRRGGANLGGEQSGHLIFLDHNTTGDGILSALQVLRIMIESG 360

Query: 360 KPVSTICHCFEEYPQFLRSVSVKDTSILNS-SSIVQAIADAESELRGIDRLIVRASGTES 418
           KP+S +    E +PQ L +V VK+   L +   + +AI D E  L    R+++R SGTE+
Sbjct: 361 KPLSELAGLLEPFPQALINVRVKEKIPLETLPEVAKAIKDVEEALGDSGRVLLRYSGTEN 420

Query: 419 LIRIMAEGDDLSRIKRIVDDLAKVI 443
           L R+M EG+D  ++  +  ++A V+
Sbjct: 421 LCRVMVEGEDKHQVDSLAKEIADVV 445